data_7PYC # _entry.id 7PYC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PYC pdb_00007pyc 10.2210/pdb7pyc/pdb WWPDB D_1292118624 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-10-12 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PYC _pdbx_database_status.recvd_initial_deposition_date 2021-10-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email guichou@cbs.cnrs.fr _pdbx_contact_author.name_first Jean-Francois _pdbx_contact_author.name_last Guichou _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7699-3235 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Duclovel, C.' 1 0000-0002-6908-3284 'Gelin, M.' 2 ? 'Krimm, I.' 3 ? 'Cerdan, R.' 4 ? 'Guichou, J.-F.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystallographic screening using ultra-low-molecular-weight ligands to guide drug design of PfCCT inhibitors' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Duclovel, C.' 1 ? primary 'Gelin, M.' 2 ? primary 'Wein, S.' 3 ? primary 'Wengelnik, K.' 4 ? primary 'Krimm, I.' 5 ? primary 'Guichou, J.F.' 6 ? primary 'Cerdan, R.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cholinephosphate cytidylyltransferase' 20810.123 1 2.7.7.15 ? ? ? 2 non-polymer syn 2-AMINOPYRIDINE 95.122 1 ? ? ? ? 3 non-polymer syn Guanidinium 60.078 1 ? ? ? ? 4 water nat water 18.015 7 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYEDY ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYEDY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-AMINOPYRIDINE 2AP 3 Guanidinium GZ6 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 VAL n 1 6 PRO n 1 7 ASP n 1 8 ASP n 1 9 ASP n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 ASN n 1 15 SER n 1 16 ASN n 1 17 ASP n 1 18 GLU n 1 19 SER n 1 20 GLU n 1 21 TYR n 1 22 GLU n 1 23 SER n 1 24 SER n 1 25 GLN n 1 26 MET n 1 27 ASP n 1 28 SER n 1 29 GLU n 1 30 LYS n 1 31 ASN n 1 32 LYS n 1 33 GLY n 1 34 SER n 1 35 ILE n 1 36 LYS n 1 37 ASN n 1 38 SER n 1 39 LYS n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 ILE n 1 44 TYR n 1 45 ALA n 1 46 ASP n 1 47 GLY n 1 48 VAL n 1 49 TYR n 1 50 ASP n 1 51 MET n 1 52 LEU n 1 53 HIS n 1 54 LEU n 1 55 GLY n 1 56 HIS n 1 57 MET n 1 58 LYS n 1 59 GLN n 1 60 LEU n 1 61 GLU n 1 62 GLN n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 GLU n 1 69 ASN n 1 70 THR n 1 71 THR n 1 72 LEU n 1 73 ILE n 1 74 VAL n 1 75 GLY n 1 76 VAL n 1 77 THR n 1 78 SER n 1 79 ASP n 1 80 ASN n 1 81 GLU n 1 82 THR n 1 83 LYS n 1 84 LEU n 1 85 PHE n 1 86 LYS n 1 87 GLY n 1 88 GLN n 1 89 VAL n 1 90 VAL n 1 91 GLN n 1 92 THR n 1 93 LEU n 1 94 GLU n 1 95 GLU n 1 96 ARG n 1 97 THR n 1 98 GLU n 1 99 THR n 1 100 LEU n 1 101 LYS n 1 102 HIS n 1 103 ILE n 1 104 ARG n 1 105 TRP n 1 106 VAL n 1 107 ASP n 1 108 GLU n 1 109 ILE n 1 110 ILE n 1 111 SER n 1 112 PRO n 1 113 CYS n 1 114 PRO n 1 115 TRP n 1 116 VAL n 1 117 VAL n 1 118 THR n 1 119 PRO n 1 120 GLU n 1 121 PHE n 1 122 LEU n 1 123 GLU n 1 124 LYS n 1 125 TYR n 1 126 LYS n 1 127 ILE n 1 128 ASP n 1 129 TYR n 1 130 VAL n 1 131 ALA n 1 132 HIS n 1 133 ASP n 1 134 ASP n 1 135 ILE n 1 136 PRO n 1 137 TYR n 1 138 ALA n 1 139 ASN n 1 140 ASN n 1 141 GLN n 1 142 LYS n 1 143 GLU n 1 144 ASP n 1 145 ILE n 1 146 TYR n 1 147 ALA n 1 148 TRP n 1 149 LEU n 1 150 LYS n 1 151 ARG n 1 152 ALA n 1 153 GLY n 1 154 LYS n 1 155 PHE n 1 156 LYS n 1 157 ALA n 1 158 THR n 1 159 GLN n 1 160 ARG n 1 161 THR n 1 162 GLU n 1 163 GLY n 1 164 VAL n 1 165 SER n 1 166 THR n 1 167 THR n 1 168 ASP n 1 169 LEU n 1 170 ILE n 1 171 VAL n 1 172 ARG n 1 173 ILE n 1 174 LEU n 1 175 LYS n 1 176 ASN n 1 177 TYR n 1 178 GLU n 1 179 ASP n 1 180 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ctP, MAL13P1.86' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5833 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2AP non-polymer . 2-AMINOPYRIDINE ? 'C5 H7 N2 1' 95.122 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GZ6 non-polymer . Guanidinium ? 'C H6 N3 1' 60.078 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 578 ? ? ? A . n A 1 2 HIS 2 579 ? ? ? A . n A 1 3 MET 3 580 ? ? ? A . n A 1 4 ALA 4 581 ? ? ? A . n A 1 5 VAL 5 582 ? ? ? A . n A 1 6 PRO 6 583 ? ? ? A . n A 1 7 ASP 7 584 ? ? ? A . n A 1 8 ASP 8 585 ? ? ? A . n A 1 9 ASP 9 586 ? ? ? A . n A 1 10 ASP 10 587 ? ? ? A . n A 1 11 ASP 11 588 ? ? ? A . n A 1 12 ASP 12 589 ? ? ? A . n A 1 13 ASP 13 590 ? ? ? A . n A 1 14 ASN 14 591 ? ? ? A . n A 1 15 SER 15 592 ? ? ? A . n A 1 16 ASN 16 593 ? ? ? A . n A 1 17 ASP 17 594 ? ? ? A . n A 1 18 GLU 18 595 ? ? ? A . n A 1 19 SER 19 596 ? ? ? A . n A 1 20 GLU 20 597 ? ? ? A . n A 1 21 TYR 21 598 ? ? ? A . n A 1 22 GLU 22 599 ? ? ? A . n A 1 23 SER 23 600 ? ? ? A . n A 1 24 SER 24 601 ? ? ? A . n A 1 25 GLN 25 602 ? ? ? A . n A 1 26 MET 26 603 ? ? ? A . n A 1 27 ASP 27 604 ? ? ? A . n A 1 28 SER 28 605 ? ? ? A . n A 1 29 GLU 29 606 ? ? ? A . n A 1 30 LYS 30 607 ? ? ? A . n A 1 31 ASN 31 608 ? ? ? A . n A 1 32 LYS 32 609 ? ? ? A . n A 1 33 GLY 33 610 ? ? ? A . n A 1 34 SER 34 611 ? ? ? A . n A 1 35 ILE 35 612 ? ? ? A . n A 1 36 LYS 36 613 ? ? ? A . n A 1 37 ASN 37 614 ? ? ? A . n A 1 38 SER 38 615 615 SER SER A . n A 1 39 LYS 39 616 616 LYS LYS A . n A 1 40 ASN 40 617 617 ASN ASN A . n A 1 41 VAL 41 618 618 VAL VAL A . n A 1 42 VAL 42 619 619 VAL VAL A . n A 1 43 ILE 43 620 620 ILE ILE A . n A 1 44 TYR 44 621 621 TYR TYR A . n A 1 45 ALA 45 622 622 ALA ALA A . n A 1 46 ASP 46 623 623 ASP ASP A . n A 1 47 GLY 47 624 624 GLY GLY A . n A 1 48 VAL 48 625 625 VAL VAL A . n A 1 49 TYR 49 626 626 TYR TYR A . n A 1 50 ASP 50 627 627 ASP ASP A . n A 1 51 MET 51 628 628 MET MET A . n A 1 52 LEU 52 629 629 LEU LEU A . n A 1 53 HIS 53 630 630 HIS HIS A . n A 1 54 LEU 54 631 631 LEU LEU A . n A 1 55 GLY 55 632 632 GLY GLY A . n A 1 56 HIS 56 633 633 HIS HIS A . n A 1 57 MET 57 634 634 MET MET A . n A 1 58 LYS 58 635 635 LYS LYS A . n A 1 59 GLN 59 636 636 GLN GLN A . n A 1 60 LEU 60 637 637 LEU LEU A . n A 1 61 GLU 61 638 638 GLU GLU A . n A 1 62 GLN 62 639 639 GLN GLN A . n A 1 63 ALA 63 640 640 ALA ALA A . n A 1 64 LYS 64 641 641 LYS LYS A . n A 1 65 LYS 65 642 642 LYS LYS A . n A 1 66 LEU 66 643 643 LEU LEU A . n A 1 67 PHE 67 644 644 PHE PHE A . n A 1 68 GLU 68 645 645 GLU GLU A . n A 1 69 ASN 69 646 646 ASN ASN A . n A 1 70 THR 70 647 647 THR THR A . n A 1 71 THR 71 648 648 THR THR A . n A 1 72 LEU 72 649 649 LEU LEU A . n A 1 73 ILE 73 650 650 ILE ILE A . n A 1 74 VAL 74 651 651 VAL VAL A . n A 1 75 GLY 75 652 652 GLY GLY A . n A 1 76 VAL 76 653 653 VAL VAL A . n A 1 77 THR 77 654 654 THR THR A . n A 1 78 SER 78 655 655 SER SER A . n A 1 79 ASP 79 656 656 ASP ASP A . n A 1 80 ASN 80 657 657 ASN ASN A . n A 1 81 GLU 81 658 658 GLU GLU A . n A 1 82 THR 82 659 659 THR THR A . n A 1 83 LYS 83 660 660 LYS LYS A . n A 1 84 LEU 84 661 661 LEU LEU A . n A 1 85 PHE 85 662 662 PHE PHE A . n A 1 86 LYS 86 663 663 LYS LYS A . n A 1 87 GLY 87 664 664 GLY GLY A . n A 1 88 GLN 88 665 665 GLN GLN A . n A 1 89 VAL 89 666 666 VAL VAL A . n A 1 90 VAL 90 667 667 VAL VAL A . n A 1 91 GLN 91 668 668 GLN GLN A . n A 1 92 THR 92 669 669 THR THR A . n A 1 93 LEU 93 670 670 LEU LEU A . n A 1 94 GLU 94 671 671 GLU GLU A . n A 1 95 GLU 95 672 672 GLU GLU A . n A 1 96 ARG 96 673 673 ARG ARG A . n A 1 97 THR 97 674 674 THR THR A . n A 1 98 GLU 98 675 675 GLU GLU A . n A 1 99 THR 99 676 676 THR THR A . n A 1 100 LEU 100 677 677 LEU LEU A . n A 1 101 LYS 101 678 678 LYS LYS A . n A 1 102 HIS 102 679 679 HIS HIS A . n A 1 103 ILE 103 680 680 ILE ILE A . n A 1 104 ARG 104 681 681 ARG ARG A . n A 1 105 TRP 105 682 682 TRP TRP A . n A 1 106 VAL 106 683 683 VAL VAL A . n A 1 107 ASP 107 684 684 ASP ASP A . n A 1 108 GLU 108 685 685 GLU GLU A . n A 1 109 ILE 109 686 686 ILE ILE A . n A 1 110 ILE 110 687 687 ILE ILE A . n A 1 111 SER 111 688 688 SER SER A . n A 1 112 PRO 112 689 689 PRO PRO A . n A 1 113 CYS 113 690 690 CYS CYS A . n A 1 114 PRO 114 691 691 PRO PRO A . n A 1 115 TRP 115 692 692 TRP TRP A . n A 1 116 VAL 116 693 693 VAL VAL A . n A 1 117 VAL 117 694 694 VAL VAL A . n A 1 118 THR 118 695 695 THR THR A . n A 1 119 PRO 119 696 696 PRO PRO A . n A 1 120 GLU 120 697 697 GLU GLU A . n A 1 121 PHE 121 698 698 PHE PHE A . n A 1 122 LEU 122 699 699 LEU LEU A . n A 1 123 GLU 123 700 700 GLU GLU A . n A 1 124 LYS 124 701 701 LYS LYS A . n A 1 125 TYR 125 702 702 TYR TYR A . n A 1 126 LYS 126 703 703 LYS LYS A . n A 1 127 ILE 127 704 704 ILE ILE A . n A 1 128 ASP 128 705 705 ASP ASP A . n A 1 129 TYR 129 706 706 TYR TYR A . n A 1 130 VAL 130 707 707 VAL VAL A . n A 1 131 ALA 131 708 708 ALA ALA A . n A 1 132 HIS 132 709 709 HIS HIS A . n A 1 133 ASP 133 710 710 ASP ASP A . n A 1 134 ASP 134 729 ? ? ? A . n A 1 135 ILE 135 730 ? ? ? A . n A 1 136 PRO 136 731 ? ? ? A . n A 1 137 TYR 137 732 ? ? ? A . n A 1 138 ALA 138 733 ? ? ? A . n A 1 139 ASN 139 734 ? ? ? A . n A 1 140 ASN 140 735 ? ? ? A . n A 1 141 GLN 141 736 ? ? ? A . n A 1 142 LYS 142 737 ? ? ? A . n A 1 143 GLU 143 738 ? ? ? A . n A 1 144 ASP 144 739 ? ? ? A . n A 1 145 ILE 145 740 740 ILE ILE A . n A 1 146 TYR 146 741 741 TYR TYR A . n A 1 147 ALA 147 742 742 ALA ALA A . n A 1 148 TRP 148 743 743 TRP TRP A . n A 1 149 LEU 149 744 744 LEU LEU A . n A 1 150 LYS 150 745 745 LYS LYS A . n A 1 151 ARG 151 746 746 ARG ARG A . n A 1 152 ALA 152 747 747 ALA ALA A . n A 1 153 GLY 153 748 748 GLY GLY A . n A 1 154 LYS 154 749 749 LYS LYS A . n A 1 155 PHE 155 750 750 PHE PHE A . n A 1 156 LYS 156 751 751 LYS LYS A . n A 1 157 ALA 157 752 752 ALA ALA A . n A 1 158 THR 158 753 753 THR THR A . n A 1 159 GLN 159 754 754 GLN GLN A . n A 1 160 ARG 160 755 755 ARG ARG A . n A 1 161 THR 161 756 756 THR THR A . n A 1 162 GLU 162 757 757 GLU GLU A . n A 1 163 GLY 163 758 758 GLY GLY A . n A 1 164 VAL 164 759 759 VAL VAL A . n A 1 165 SER 165 760 760 SER SER A . n A 1 166 THR 166 761 761 THR THR A . n A 1 167 THR 167 762 762 THR THR A . n A 1 168 ASP 168 763 763 ASP ASP A . n A 1 169 LEU 169 764 764 LEU LEU A . n A 1 170 ILE 170 765 765 ILE ILE A . n A 1 171 VAL 171 766 766 VAL VAL A . n A 1 172 ARG 172 767 767 ARG ARG A . n A 1 173 ILE 173 768 768 ILE ILE A . n A 1 174 LEU 174 769 769 LEU LEU A . n A 1 175 LYS 175 770 770 LYS LYS A . n A 1 176 ASN 176 771 771 ASN ASN A . n A 1 177 TYR 177 772 772 TYR TYR A . n A 1 178 GLU 178 773 773 GLU GLU A . n A 1 179 ASP 179 774 774 ASP ASP A . n A 1 180 TYR 180 775 775 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 2AP 1 801 7 2AP 2AP A . C 3 GZ6 1 802 2 GZ6 GZ6 A . D 4 HOH 1 901 1 HOH HOH A . D 4 HOH 2 902 5 HOH HOH A . D 4 HOH 3 903 10 HOH HOH A . D 4 HOH 4 904 6 HOH HOH A . D 4 HOH 5 905 8 HOH HOH A . D 4 HOH 6 906 11 HOH HOH A . D 4 HOH 7 907 12 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 741 ? CG ? A TYR 146 CG 2 1 Y 1 A TYR 741 ? CD1 ? A TYR 146 CD1 3 1 Y 1 A TYR 741 ? CD2 ? A TYR 146 CD2 4 1 Y 1 A TYR 741 ? CE1 ? A TYR 146 CE1 5 1 Y 1 A TYR 741 ? CE2 ? A TYR 146 CE2 6 1 Y 1 A TYR 741 ? CZ ? A TYR 146 CZ 7 1 Y 1 A TYR 741 ? OH ? A TYR 146 OH # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? v1.19 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7PYC _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.462 _cell.length_a_esd ? _cell.length_b 69.329 _cell.length_b_esd ? _cell.length_c 118.132 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PYC _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PYC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;PEG 4000 19%, TRIS pH8 0.1M 6-7-8-9-10% Guanidine HCl 5-6-7% Glycerol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96546 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96546 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 58.050 _reflns.entry_id 7PYC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.038 _reflns.d_resolution_low 46.405 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8793 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.800 _reflns.pdbx_Rmerge_I_obs 0.044 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.049 _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 59423 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.038 2.268 ? ? 2917 ? ? ? 876 40.300 ? ? ? ? 0.632 ? ? ? ? ? ? ? ? 5.700 ? ? ? 2.300 0.701 0.299 ? 1 1 0.975 ? ? ? ? ? ? ? ? ? ? 6.307 46.405 ? ? 2784 ? ? ? 512 98.500 ? ? ? ? 0.018 ? ? ? ? ? ? ? ? 5.400 ? ? ? 62.000 0.020 0.009 ? 2 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 133.450 _refine.B_iso_mean 69.9781 _refine.B_iso_min 46.980 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PYC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3600 _refine.ls_d_res_low 46.4100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8790 _refine.ls_number_reflns_R_free 744 _refine.ls_number_reflns_R_work 15440 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4100 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2178 _refine.ls_R_factor_R_free 0.2586 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2161 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZCT _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.4900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3600 _refine_hist.d_res_low 46.4100 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 1103 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 132 _refine_hist.pdbx_B_iso_mean_ligand 74.62 _refine_hist.pdbx_B_iso_mean_solvent 64.97 _refine_hist.pdbx_number_atoms_protein 1080 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3600 2.5400 3280 . 137 3143 100.0000 . . . 0.3497 0.0000 0.2948 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.5400 2.8000 3254 . 143 3111 99.0000 . . . 0.3017 0.0000 0.2956 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.8000 3.2100 3269 . 118 3151 99.0000 . . . 0.3100 0.0000 0.2863 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.2100 4.0400 3170 . 187 2983 97.0000 . . . 0.2609 0.0000 0.2273 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.0400 46.4100 3211 . 159 3052 97.0000 . . . 0.2268 0.0000 0.1677 . . . . . . . 5 . . . # _struct.entry_id 7PYC _struct.title ;Crystal structure of the C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with 2-Aminopyridine ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PYC _struct_keywords.text 'Plasmodium Falciparum CCT Inhibitors Fragments, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8IEE9_PLAF7 _struct_ref.pdbx_db_accession Q8IEE9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETK LFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKKKKKKKSKGKSFSFDEENEDI YAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY ; _struct_ref.pdbx_align_begin 581 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PYC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IEE9 _struct_ref_seq.db_align_beg 581 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 775 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 581 _struct_ref_seq.pdbx_auth_seq_align_end 775 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PYC GLY A 1 ? UNP Q8IEE9 ? ? 'expression tag' 578 1 1 7PYC HIS A 2 ? UNP Q8IEE9 ? ? 'expression tag' 579 2 1 7PYC MET A 3 ? UNP Q8IEE9 ? ? 'expression tag' 580 3 1 7PYC ? A ? ? UNP Q8IEE9 LYS 720 deletion ? 4 1 7PYC ? A ? ? UNP Q8IEE9 LYS 721 deletion ? 5 1 7PYC ? A ? ? UNP Q8IEE9 LYS 722 deletion ? 6 1 7PYC ? A ? ? UNP Q8IEE9 LYS 723 deletion ? 7 1 7PYC ? A ? ? UNP Q8IEE9 LYS 724 deletion ? 8 1 7PYC ? A ? ? UNP Q8IEE9 LYS 725 deletion ? 9 1 7PYC ? A ? ? UNP Q8IEE9 SER 726 deletion ? 10 1 7PYC ? A ? ? UNP Q8IEE9 LYS 727 deletion ? 11 1 7PYC ? A ? ? UNP Q8IEE9 GLY 728 deletion ? 12 1 7PYC ? A ? ? UNP Q8IEE9 LYS 729 deletion ? 13 1 7PYC ? A ? ? UNP Q8IEE9 SER 730 deletion ? 14 1 7PYC ? A ? ? UNP Q8IEE9 PHE 731 deletion ? 15 1 7PYC ? A ? ? UNP Q8IEE9 SER 732 deletion ? 16 1 7PYC ? A ? ? UNP Q8IEE9 PHE 733 deletion ? 17 1 7PYC ? A ? ? UNP Q8IEE9 ASP 734 deletion ? 18 1 7PYC ? A ? ? UNP Q8IEE9 GLU 735 deletion ? 19 1 7PYC ? A ? ? UNP Q8IEE9 GLU 736 deletion ? 20 1 7PYC ? A ? ? UNP Q8IEE9 ASN 737 deletion ? 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2830 ? 1 MORE -3 ? 1 'SSA (A^2)' 15200 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -x-1,-y,z -1.0000000000 0.0000000000 0.0000000000 -50.4620000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 53 ? LEU A 66 ? HIS A 630 LEU A 643 1 ? 14 HELX_P HELX_P2 AA2 SER A 78 ? LYS A 86 ? SER A 655 LYS A 663 1 ? 9 HELX_P HELX_P3 AA3 THR A 92 ? LYS A 101 ? THR A 669 LYS A 678 1 ? 10 HELX_P HELX_P4 AA4 THR A 118 ? LYS A 126 ? THR A 695 LYS A 703 1 ? 9 HELX_P HELX_P5 AA5 TYR A 146 ? ALA A 152 ? TYR A 741 ALA A 747 1 ? 7 HELX_P HELX_P6 AA6 SER A 165 ? LYS A 175 ? SER A 760 LYS A 770 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 111 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 688 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 112 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 689 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.06 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 108 ? CYS A 113 ? GLU A 685 CYS A 690 AA1 2 THR A 70 ? THR A 77 ? THR A 647 THR A 654 AA1 3 VAL A 41 ? GLY A 47 ? VAL A 618 GLY A 624 AA1 4 TYR A 129 ? HIS A 132 ? TYR A 706 HIS A 709 AA1 5 PHE A 155 ? ALA A 157 ? PHE A 750 ALA A 752 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 110 ? O ILE A 687 N VAL A 74 ? N VAL A 651 AA1 2 3 O ILE A 73 ? O ILE A 650 N ILE A 43 ? N ILE A 620 AA1 3 4 N TYR A 44 ? N TYR A 621 O ALA A 131 ? O ALA A 708 AA1 4 5 N VAL A 130 ? N VAL A 707 O LYS A 156 ? O LYS A 751 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 663 ? ? -124.17 -64.81 2 1 GLU A 773 ? ? -48.29 154.55 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -18.1787 -8.1557 -24.9011 0.4706 ? 0.0117 ? -0.0273 ? 0.4522 ? 0.0316 ? 0.5189 ? 3.8821 ? 1.2281 ? 2.0171 ? 5.8405 ? 0.8858 ? 1.4618 ? 0.0767 ? -0.0363 ? 0.1214 ? 0.0433 ? -0.1672 ? -0.0708 ? 0.0687 ? 0.3326 ? 0.1585 ? 2 'X-RAY DIFFRACTION' ? refined -21.7833 -15.3045 -22.9072 0.4077 ? 0.0035 ? -0.0216 ? 0.4052 ? -0.0039 ? 0.6147 ? 5.6214 ? -1.4551 ? 1.2912 ? 3.9865 ? 2.5376 ? 3.3625 ? -0.2596 ? 0.0740 ? -0.5272 ? 0.2610 ? 0.0713 ? 0.0188 ? 0.3688 ? -0.4273 ? 0.1715 ? 3 'X-RAY DIFFRACTION' ? refined -26.8263 -12.0200 -20.4472 0.4782 ? -0.0097 ? -0.0321 ? 0.4738 ? 0.0031 ? 0.4723 ? 5.3217 ? -0.1502 ? -1.4251 ? 3.8587 ? 0.7995 ? 2.5402 ? -0.1344 ? -0.0794 ? -0.2100 ? 0.2161 ? -0.0162 ? 0.2516 ? 0.1254 ? -0.2414 ? 0.1257 ? 4 'X-RAY DIFFRACTION' ? refined -13.7817 -21.5340 -28.7477 0.5122 ? 0.0943 ? 0.0198 ? 0.4409 ? 0.0253 ? 0.4583 ? 5.6077 ? 1.1516 ? -0.9340 ? 9.3444 ? -0.5917 ? 4.5108 ? 0.0586 ? -0.2610 ? -0.3657 ? 0.7919 ? -0.2534 ? 0.0465 ? 0.0340 ? 0.4639 ? 0.2391 ? 5 'X-RAY DIFFRACTION' ? refined -11.8363 -4.7124 -15.5375 1.0617 ? 0.1272 ? -0.2153 ? 0.9720 ? -0.1029 ? 0.9403 ? 0.4755 ? -1.0621 ? -0.9739 ? 1.8985 ? 2.0941 ? 2.3837 ? -0.4776 ? -0.6870 ? -0.3074 ? 0.9869 ? 0.0203 ? 0.5890 ? 0.2661 ? 1.3748 ? 0.4302 ? 6 'X-RAY DIFFRACTION' ? refined -19.1245 5.9331 0.6954 0.9288 ? -0.0624 ? -0.0167 ? 0.9906 ? 0.1076 ? 0.8175 ? 3.7059 ? -0.6363 ? -1.0224 ? 3.9448 ? -1.1877 ? 3.4579 ? 0.3195 ? -0.1493 ? 0.3377 ? 0.5142 ? -0.5710 ? -1.1188 ? -0.3708 ? 0.3848 ? 0.0079 ? 7 'X-RAY DIFFRACTION' ? refined -28.0010 -16.8939 -32.4912 -1.6658 ? 1.3591 ? -0.0547 ? 1.3168 ? 0.2551 ? 0.6960 ? 1.9993 ? 1.9976 ? 2.0005 ? 1.9986 ? 2.0022 ? 2.0009 ? 6.2117 ? 4.2669 ? 4.3075 ? -2.9712 ? 0.7503 ? 0.6874 ? -1.2453 ? -4.5767 ? -7.1137 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 615 ? ? ? A 642 ? ? ;chain 'A' and (resid 615 through 642 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 643 ? ? ? A 662 ? ? ;chain 'A' and (resid 643 through 662 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 663 ? ? ? A 695 ? ? ;chain 'A' and (resid 663 through 695 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 696 ? ? ? A 752 ? ? ;chain 'A' and (resid 696 through 752 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 753 ? ? ? A 760 ? ? ;chain 'A' and (resid 753 through 760 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 761 ? ? ? A 775 ? ? ;chain 'A' and (resid 761 through 775 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 802 ? ? ? A 802 ? ? ;chain 'A' and (resid 802 through 802 ) ; # _pdbx_entry_details.entry_id 7PYC _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 578 ? A GLY 1 2 1 Y 1 A HIS 579 ? A HIS 2 3 1 Y 1 A MET 580 ? A MET 3 4 1 Y 1 A ALA 581 ? A ALA 4 5 1 Y 1 A VAL 582 ? A VAL 5 6 1 Y 1 A PRO 583 ? A PRO 6 7 1 Y 1 A ASP 584 ? A ASP 7 8 1 Y 1 A ASP 585 ? A ASP 8 9 1 Y 1 A ASP 586 ? A ASP 9 10 1 Y 1 A ASP 587 ? A ASP 10 11 1 Y 1 A ASP 588 ? A ASP 11 12 1 Y 1 A ASP 589 ? A ASP 12 13 1 Y 1 A ASP 590 ? A ASP 13 14 1 Y 1 A ASN 591 ? A ASN 14 15 1 Y 1 A SER 592 ? A SER 15 16 1 Y 1 A ASN 593 ? A ASN 16 17 1 Y 1 A ASP 594 ? A ASP 17 18 1 Y 1 A GLU 595 ? A GLU 18 19 1 Y 1 A SER 596 ? A SER 19 20 1 Y 1 A GLU 597 ? A GLU 20 21 1 Y 1 A TYR 598 ? A TYR 21 22 1 Y 1 A GLU 599 ? A GLU 22 23 1 Y 1 A SER 600 ? A SER 23 24 1 Y 1 A SER 601 ? A SER 24 25 1 Y 1 A GLN 602 ? A GLN 25 26 1 Y 1 A MET 603 ? A MET 26 27 1 Y 1 A ASP 604 ? A ASP 27 28 1 Y 1 A SER 605 ? A SER 28 29 1 Y 1 A GLU 606 ? A GLU 29 30 1 Y 1 A LYS 607 ? A LYS 30 31 1 Y 1 A ASN 608 ? A ASN 31 32 1 Y 1 A LYS 609 ? A LYS 32 33 1 Y 1 A GLY 610 ? A GLY 33 34 1 Y 1 A SER 611 ? A SER 34 35 1 Y 1 A ILE 612 ? A ILE 35 36 1 Y 1 A LYS 613 ? A LYS 36 37 1 Y 1 A ASN 614 ? A ASN 37 38 1 Y 1 A ASP 729 ? A ASP 134 39 1 Y 1 A ILE 730 ? A ILE 135 40 1 Y 1 A PRO 731 ? A PRO 136 41 1 Y 1 A TYR 732 ? A TYR 137 42 1 Y 1 A ALA 733 ? A ALA 138 43 1 Y 1 A ASN 734 ? A ASN 139 44 1 Y 1 A ASN 735 ? A ASN 140 45 1 Y 1 A GLN 736 ? A GLN 141 46 1 Y 1 A LYS 737 ? A LYS 142 47 1 Y 1 A GLU 738 ? A GLU 143 48 1 Y 1 A ASP 739 ? A ASP 144 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2AP N1 N Y N 1 2AP C2 C Y N 2 2AP C3 C Y N 3 2AP C4 C Y N 4 2AP C5 C Y N 5 2AP C6 C Y N 6 2AP N N N N 7 2AP HN1 H N N 8 2AP H3 H N N 9 2AP H4 H N N 10 2AP H5 H N N 11 2AP H6 H N N 12 2AP HN1A H N N 13 2AP HN2 H N N 14 ALA N N N N 15 ALA CA C N S 16 ALA C C N N 17 ALA O O N N 18 ALA CB C N N 19 ALA OXT O N N 20 ALA H H N N 21 ALA H2 H N N 22 ALA HA H N N 23 ALA HB1 H N N 24 ALA HB2 H N N 25 ALA HB3 H N N 26 ALA HXT H N N 27 ARG N N N N 28 ARG CA C N S 29 ARG C C N N 30 ARG O O N N 31 ARG CB C N N 32 ARG CG C N N 33 ARG CD C N N 34 ARG NE N N N 35 ARG CZ C N N 36 ARG NH1 N N N 37 ARG NH2 N N N 38 ARG OXT O N N 39 ARG H H N N 40 ARG H2 H N N 41 ARG HA H N N 42 ARG HB2 H N N 43 ARG HB3 H N N 44 ARG HG2 H N N 45 ARG HG3 H N N 46 ARG HD2 H N N 47 ARG HD3 H N N 48 ARG HE H N N 49 ARG HH11 H N N 50 ARG HH12 H N N 51 ARG HH21 H N N 52 ARG HH22 H N N 53 ARG HXT H N N 54 ASN N N N N 55 ASN CA C N S 56 ASN C C N N 57 ASN O O N N 58 ASN CB C N N 59 ASN CG C N N 60 ASN OD1 O N N 61 ASN ND2 N N N 62 ASN OXT O N N 63 ASN H H N N 64 ASN H2 H N N 65 ASN HA H N N 66 ASN HB2 H N N 67 ASN HB3 H N N 68 ASN HD21 H N N 69 ASN HD22 H N N 70 ASN HXT H N N 71 ASP N N N N 72 ASP CA C N S 73 ASP C C N N 74 ASP O O N N 75 ASP CB C N N 76 ASP CG C N N 77 ASP OD1 O N N 78 ASP OD2 O N N 79 ASP OXT O N N 80 ASP H H N N 81 ASP H2 H N N 82 ASP HA H N N 83 ASP HB2 H N N 84 ASP HB3 H N N 85 ASP HD2 H N N 86 ASP HXT H N N 87 CYS N N N N 88 CYS CA C N R 89 CYS C C N N 90 CYS O O N N 91 CYS CB C N N 92 CYS SG S N N 93 CYS OXT O N N 94 CYS H H N N 95 CYS H2 H N N 96 CYS HA H N N 97 CYS HB2 H N N 98 CYS HB3 H N N 99 CYS HG H N N 100 CYS HXT H N N 101 GLN N N N N 102 GLN CA C N S 103 GLN C C N N 104 GLN O O N N 105 GLN CB C N N 106 GLN CG C N N 107 GLN CD C N N 108 GLN OE1 O N N 109 GLN NE2 N N N 110 GLN OXT O N N 111 GLN H H N N 112 GLN H2 H N N 113 GLN HA H N N 114 GLN HB2 H N N 115 GLN HB3 H N N 116 GLN HG2 H N N 117 GLN HG3 H N N 118 GLN HE21 H N N 119 GLN HE22 H N N 120 GLN HXT H N N 121 GLU N N N N 122 GLU CA C N S 123 GLU C C N N 124 GLU O O N N 125 GLU CB C N N 126 GLU CG C N N 127 GLU CD C N N 128 GLU OE1 O N N 129 GLU OE2 O N N 130 GLU OXT O N N 131 GLU H H N N 132 GLU H2 H N N 133 GLU HA H N N 134 GLU HB2 H N N 135 GLU HB3 H N N 136 GLU HG2 H N N 137 GLU HG3 H N N 138 GLU HE2 H N N 139 GLU HXT H N N 140 GLY N N N N 141 GLY CA C N N 142 GLY C C N N 143 GLY O O N N 144 GLY OXT O N N 145 GLY H H N N 146 GLY H2 H N N 147 GLY HA2 H N N 148 GLY HA3 H N N 149 GLY HXT H N N 150 GZ6 C C N N 151 GZ6 N1 N N N 152 GZ6 N2 N N N 153 GZ6 N3 N N N 154 GZ6 H1 H N N 155 GZ6 H2 H N N 156 GZ6 H3 H N N 157 GZ6 H4 H N N 158 GZ6 H5 H N N 159 GZ6 H6 H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 THR N N N N 328 THR CA C N S 329 THR C C N N 330 THR O O N N 331 THR CB C N R 332 THR OG1 O N N 333 THR CG2 C N N 334 THR OXT O N N 335 THR H H N N 336 THR H2 H N N 337 THR HA H N N 338 THR HB H N N 339 THR HG1 H N N 340 THR HG21 H N N 341 THR HG22 H N N 342 THR HG23 H N N 343 THR HXT H N N 344 TRP N N N N 345 TRP CA C N S 346 TRP C C N N 347 TRP O O N N 348 TRP CB C N N 349 TRP CG C Y N 350 TRP CD1 C Y N 351 TRP CD2 C Y N 352 TRP NE1 N Y N 353 TRP CE2 C Y N 354 TRP CE3 C Y N 355 TRP CZ2 C Y N 356 TRP CZ3 C Y N 357 TRP CH2 C Y N 358 TRP OXT O N N 359 TRP H H N N 360 TRP H2 H N N 361 TRP HA H N N 362 TRP HB2 H N N 363 TRP HB3 H N N 364 TRP HD1 H N N 365 TRP HE1 H N N 366 TRP HE3 H N N 367 TRP HZ2 H N N 368 TRP HZ3 H N N 369 TRP HH2 H N N 370 TRP HXT H N N 371 TYR N N N N 372 TYR CA C N S 373 TYR C C N N 374 TYR O O N N 375 TYR CB C N N 376 TYR CG C Y N 377 TYR CD1 C Y N 378 TYR CD2 C Y N 379 TYR CE1 C Y N 380 TYR CE2 C Y N 381 TYR CZ C Y N 382 TYR OH O N N 383 TYR OXT O N N 384 TYR H H N N 385 TYR H2 H N N 386 TYR HA H N N 387 TYR HB2 H N N 388 TYR HB3 H N N 389 TYR HD1 H N N 390 TYR HD2 H N N 391 TYR HE1 H N N 392 TYR HE2 H N N 393 TYR HH H N N 394 TYR HXT H N N 395 VAL N N N N 396 VAL CA C N S 397 VAL C C N N 398 VAL O O N N 399 VAL CB C N N 400 VAL CG1 C N N 401 VAL CG2 C N N 402 VAL OXT O N N 403 VAL H H N N 404 VAL H2 H N N 405 VAL HA H N N 406 VAL HB H N N 407 VAL HG11 H N N 408 VAL HG12 H N N 409 VAL HG13 H N N 410 VAL HG21 H N N 411 VAL HG22 H N N 412 VAL HG23 H N N 413 VAL HXT H N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2AP N1 C2 sing Y N 1 2AP N1 C6 doub Y N 2 2AP N1 HN1 sing N N 3 2AP C2 C3 doub Y N 4 2AP C2 N sing N N 5 2AP C3 C4 sing Y N 6 2AP C3 H3 sing N N 7 2AP C4 C5 doub Y N 8 2AP C4 H4 sing N N 9 2AP C5 C6 sing Y N 10 2AP C5 H5 sing N N 11 2AP C6 H6 sing N N 12 2AP N HN1A sing N N 13 2AP N HN2 sing N N 14 ALA N CA sing N N 15 ALA N H sing N N 16 ALA N H2 sing N N 17 ALA CA C sing N N 18 ALA CA CB sing N N 19 ALA CA HA sing N N 20 ALA C O doub N N 21 ALA C OXT sing N N 22 ALA CB HB1 sing N N 23 ALA CB HB2 sing N N 24 ALA CB HB3 sing N N 25 ALA OXT HXT sing N N 26 ARG N CA sing N N 27 ARG N H sing N N 28 ARG N H2 sing N N 29 ARG CA C sing N N 30 ARG CA CB sing N N 31 ARG CA HA sing N N 32 ARG C O doub N N 33 ARG C OXT sing N N 34 ARG CB CG sing N N 35 ARG CB HB2 sing N N 36 ARG CB HB3 sing N N 37 ARG CG CD sing N N 38 ARG CG HG2 sing N N 39 ARG CG HG3 sing N N 40 ARG CD NE sing N N 41 ARG CD HD2 sing N N 42 ARG CD HD3 sing N N 43 ARG NE CZ sing N N 44 ARG NE HE sing N N 45 ARG CZ NH1 sing N N 46 ARG CZ NH2 doub N N 47 ARG NH1 HH11 sing N N 48 ARG NH1 HH12 sing N N 49 ARG NH2 HH21 sing N N 50 ARG NH2 HH22 sing N N 51 ARG OXT HXT sing N N 52 ASN N CA sing N N 53 ASN N H sing N N 54 ASN N H2 sing N N 55 ASN CA C sing N N 56 ASN CA CB sing N N 57 ASN CA HA sing N N 58 ASN C O doub N N 59 ASN C OXT sing N N 60 ASN CB CG sing N N 61 ASN CB HB2 sing N N 62 ASN CB HB3 sing N N 63 ASN CG OD1 doub N N 64 ASN CG ND2 sing N N 65 ASN ND2 HD21 sing N N 66 ASN ND2 HD22 sing N N 67 ASN OXT HXT sing N N 68 ASP N CA sing N N 69 ASP N H sing N N 70 ASP N H2 sing N N 71 ASP CA C sing N N 72 ASP CA CB sing N N 73 ASP CA HA sing N N 74 ASP C O doub N N 75 ASP C OXT sing N N 76 ASP CB CG sing N N 77 ASP CB HB2 sing N N 78 ASP CB HB3 sing N N 79 ASP CG OD1 doub N N 80 ASP CG OD2 sing N N 81 ASP OD2 HD2 sing N N 82 ASP OXT HXT sing N N 83 CYS N CA sing N N 84 CYS N H sing N N 85 CYS N H2 sing N N 86 CYS CA C sing N N 87 CYS CA CB sing N N 88 CYS CA HA sing N N 89 CYS C O doub N N 90 CYS C OXT sing N N 91 CYS CB SG sing N N 92 CYS CB HB2 sing N N 93 CYS CB HB3 sing N N 94 CYS SG HG sing N N 95 CYS OXT HXT sing N N 96 GLN N CA sing N N 97 GLN N H sing N N 98 GLN N H2 sing N N 99 GLN CA C sing N N 100 GLN CA CB sing N N 101 GLN CA HA sing N N 102 GLN C O doub N N 103 GLN C OXT sing N N 104 GLN CB CG sing N N 105 GLN CB HB2 sing N N 106 GLN CB HB3 sing N N 107 GLN CG CD sing N N 108 GLN CG HG2 sing N N 109 GLN CG HG3 sing N N 110 GLN CD OE1 doub N N 111 GLN CD NE2 sing N N 112 GLN NE2 HE21 sing N N 113 GLN NE2 HE22 sing N N 114 GLN OXT HXT sing N N 115 GLU N CA sing N N 116 GLU N H sing N N 117 GLU N H2 sing N N 118 GLU CA C sing N N 119 GLU CA CB sing N N 120 GLU CA HA sing N N 121 GLU C O doub N N 122 GLU C OXT sing N N 123 GLU CB CG sing N N 124 GLU CB HB2 sing N N 125 GLU CB HB3 sing N N 126 GLU CG CD sing N N 127 GLU CG HG2 sing N N 128 GLU CG HG3 sing N N 129 GLU CD OE1 doub N N 130 GLU CD OE2 sing N N 131 GLU OE2 HE2 sing N N 132 GLU OXT HXT sing N N 133 GLY N CA sing N N 134 GLY N H sing N N 135 GLY N H2 sing N N 136 GLY CA C sing N N 137 GLY CA HA2 sing N N 138 GLY CA HA3 sing N N 139 GLY C O doub N N 140 GLY C OXT sing N N 141 GLY OXT HXT sing N N 142 GZ6 N1 C doub N N 143 GZ6 C N3 sing N N 144 GZ6 C N2 sing N N 145 GZ6 N1 H1 sing N N 146 GZ6 N2 H2 sing N N 147 GZ6 N2 H3 sing N N 148 GZ6 N3 H4 sing N N 149 GZ6 N3 H5 sing N N 150 GZ6 N1 H6 sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 HOH O H1 sing N N 173 HOH O H2 sing N N 174 ILE N CA sing N N 175 ILE N H sing N N 176 ILE N H2 sing N N 177 ILE CA C sing N N 178 ILE CA CB sing N N 179 ILE CA HA sing N N 180 ILE C O doub N N 181 ILE C OXT sing N N 182 ILE CB CG1 sing N N 183 ILE CB CG2 sing N N 184 ILE CB HB sing N N 185 ILE CG1 CD1 sing N N 186 ILE CG1 HG12 sing N N 187 ILE CG1 HG13 sing N N 188 ILE CG2 HG21 sing N N 189 ILE CG2 HG22 sing N N 190 ILE CG2 HG23 sing N N 191 ILE CD1 HD11 sing N N 192 ILE CD1 HD12 sing N N 193 ILE CD1 HD13 sing N N 194 ILE OXT HXT sing N N 195 LEU N CA sing N N 196 LEU N H sing N N 197 LEU N H2 sing N N 198 LEU CA C sing N N 199 LEU CA CB sing N N 200 LEU CA HA sing N N 201 LEU C O doub N N 202 LEU C OXT sing N N 203 LEU CB CG sing N N 204 LEU CB HB2 sing N N 205 LEU CB HB3 sing N N 206 LEU CG CD1 sing N N 207 LEU CG CD2 sing N N 208 LEU CG HG sing N N 209 LEU CD1 HD11 sing N N 210 LEU CD1 HD12 sing N N 211 LEU CD1 HD13 sing N N 212 LEU CD2 HD21 sing N N 213 LEU CD2 HD22 sing N N 214 LEU CD2 HD23 sing N N 215 LEU OXT HXT sing N N 216 LYS N CA sing N N 217 LYS N H sing N N 218 LYS N H2 sing N N 219 LYS CA C sing N N 220 LYS CA CB sing N N 221 LYS CA HA sing N N 222 LYS C O doub N N 223 LYS C OXT sing N N 224 LYS CB CG sing N N 225 LYS CB HB2 sing N N 226 LYS CB HB3 sing N N 227 LYS CG CD sing N N 228 LYS CG HG2 sing N N 229 LYS CG HG3 sing N N 230 LYS CD CE sing N N 231 LYS CD HD2 sing N N 232 LYS CD HD3 sing N N 233 LYS CE NZ sing N N 234 LYS CE HE2 sing N N 235 LYS CE HE3 sing N N 236 LYS NZ HZ1 sing N N 237 LYS NZ HZ2 sing N N 238 LYS NZ HZ3 sing N N 239 LYS OXT HXT sing N N 240 MET N CA sing N N 241 MET N H sing N N 242 MET N H2 sing N N 243 MET CA C sing N N 244 MET CA CB sing N N 245 MET CA HA sing N N 246 MET C O doub N N 247 MET C OXT sing N N 248 MET CB CG sing N N 249 MET CB HB2 sing N N 250 MET CB HB3 sing N N 251 MET CG SD sing N N 252 MET CG HG2 sing N N 253 MET CG HG3 sing N N 254 MET SD CE sing N N 255 MET CE HE1 sing N N 256 MET CE HE2 sing N N 257 MET CE HE3 sing N N 258 MET OXT HXT sing N N 259 PHE N CA sing N N 260 PHE N H sing N N 261 PHE N H2 sing N N 262 PHE CA C sing N N 263 PHE CA CB sing N N 264 PHE CA HA sing N N 265 PHE C O doub N N 266 PHE C OXT sing N N 267 PHE CB CG sing N N 268 PHE CB HB2 sing N N 269 PHE CB HB3 sing N N 270 PHE CG CD1 doub Y N 271 PHE CG CD2 sing Y N 272 PHE CD1 CE1 sing Y N 273 PHE CD1 HD1 sing N N 274 PHE CD2 CE2 doub Y N 275 PHE CD2 HD2 sing N N 276 PHE CE1 CZ doub Y N 277 PHE CE1 HE1 sing N N 278 PHE CE2 CZ sing Y N 279 PHE CE2 HE2 sing N N 280 PHE CZ HZ sing N N 281 PHE OXT HXT sing N N 282 PRO N CA sing N N 283 PRO N CD sing N N 284 PRO N H sing N N 285 PRO CA C sing N N 286 PRO CA CB sing N N 287 PRO CA HA sing N N 288 PRO C O doub N N 289 PRO C OXT sing N N 290 PRO CB CG sing N N 291 PRO CB HB2 sing N N 292 PRO CB HB3 sing N N 293 PRO CG CD sing N N 294 PRO CG HG2 sing N N 295 PRO CG HG3 sing N N 296 PRO CD HD2 sing N N 297 PRO CD HD3 sing N N 298 PRO OXT HXT sing N N 299 SER N CA sing N N 300 SER N H sing N N 301 SER N H2 sing N N 302 SER CA C sing N N 303 SER CA CB sing N N 304 SER CA HA sing N N 305 SER C O doub N N 306 SER C OXT sing N N 307 SER CB OG sing N N 308 SER CB HB2 sing N N 309 SER CB HB3 sing N N 310 SER OG HG sing N N 311 SER OXT HXT sing N N 312 THR N CA sing N N 313 THR N H sing N N 314 THR N H2 sing N N 315 THR CA C sing N N 316 THR CA CB sing N N 317 THR CA HA sing N N 318 THR C O doub N N 319 THR C OXT sing N N 320 THR CB OG1 sing N N 321 THR CB CG2 sing N N 322 THR CB HB sing N N 323 THR OG1 HG1 sing N N 324 THR CG2 HG21 sing N N 325 THR CG2 HG22 sing N N 326 THR CG2 HG23 sing N N 327 THR OXT HXT sing N N 328 TRP N CA sing N N 329 TRP N H sing N N 330 TRP N H2 sing N N 331 TRP CA C sing N N 332 TRP CA CB sing N N 333 TRP CA HA sing N N 334 TRP C O doub N N 335 TRP C OXT sing N N 336 TRP CB CG sing N N 337 TRP CB HB2 sing N N 338 TRP CB HB3 sing N N 339 TRP CG CD1 doub Y N 340 TRP CG CD2 sing Y N 341 TRP CD1 NE1 sing Y N 342 TRP CD1 HD1 sing N N 343 TRP CD2 CE2 doub Y N 344 TRP CD2 CE3 sing Y N 345 TRP NE1 CE2 sing Y N 346 TRP NE1 HE1 sing N N 347 TRP CE2 CZ2 sing Y N 348 TRP CE3 CZ3 doub Y N 349 TRP CE3 HE3 sing N N 350 TRP CZ2 CH2 doub Y N 351 TRP CZ2 HZ2 sing N N 352 TRP CZ3 CH2 sing Y N 353 TRP CZ3 HZ3 sing N N 354 TRP CH2 HH2 sing N N 355 TRP OXT HXT sing N N 356 TYR N CA sing N N 357 TYR N H sing N N 358 TYR N H2 sing N N 359 TYR CA C sing N N 360 TYR CA CB sing N N 361 TYR CA HA sing N N 362 TYR C O doub N N 363 TYR C OXT sing N N 364 TYR CB CG sing N N 365 TYR CB HB2 sing N N 366 TYR CB HB3 sing N N 367 TYR CG CD1 doub Y N 368 TYR CG CD2 sing Y N 369 TYR CD1 CE1 sing Y N 370 TYR CD1 HD1 sing N N 371 TYR CD2 CE2 doub Y N 372 TYR CD2 HD2 sing N N 373 TYR CE1 CZ doub Y N 374 TYR CE1 HE1 sing N N 375 TYR CE2 CZ sing Y N 376 TYR CE2 HE2 sing N N 377 TYR CZ OH sing N N 378 TYR OH HH sing N N 379 TYR OXT HXT sing N N 380 VAL N CA sing N N 381 VAL N H sing N N 382 VAL N H2 sing N N 383 VAL CA C sing N N 384 VAL CA CB sing N N 385 VAL CA HA sing N N 386 VAL C O doub N N 387 VAL C OXT sing N N 388 VAL CB CG1 sing N N 389 VAL CB CG2 sing N N 390 VAL CB HB sing N N 391 VAL CG1 HG11 sing N N 392 VAL CG1 HG12 sing N N 393 VAL CG1 HG13 sing N N 394 VAL CG2 HG21 sing N N 395 VAL CG2 HG22 sing N N 396 VAL CG2 HG23 sing N N 397 VAL OXT HXT sing N N 398 # _pdbx_audit_support.funding_organization 'Montpellier University of Excellence (MUSE)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 GZ6 ? ? GZ6 ? ? 'SUBJECT OF INVESTIGATION' ? 2 2AP ? ? 2AP ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ZCT _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7PYC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019817 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014424 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008465 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_