data_7Q16 # _entry.id 7Q16 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Q16 pdb_00007q16 10.2210/pdb7q16/pdb WWPDB D_1292118740 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-11-17 2 'Structure model' 1 1 2022-10-26 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_struct_assembly 2 2 'Structure model' pdbx_struct_assembly_gen 3 2 'Structure model' pdbx_struct_assembly_prop 4 2 'Structure model' pdbx_struct_oper_list 5 2 'Structure model' refine 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_struct_assembly.details' 2 2 'Structure model' '_pdbx_struct_assembly.method_details' 3 2 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 4 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 2 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 6 2 'Structure model' '_pdbx_struct_assembly_prop.value' 7 2 'Structure model' '_refine.pdbx_diffrn_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Q16 _pdbx_database_status.recvd_initial_deposition_date 2021-10-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 4 _pdbx_contact_author.email nikolai.sluchanko@mail.ru _pdbx_contact_author.name_first Nikolai _pdbx_contact_author.name_last Sluchanko _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8608-1416 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sluchanko, N.N.' 1 ? 'Tugaeva, K.V.' 2 ? 'Gushchin, I.' 3 ? 'Remeeva, A.' 4 ? 'Kovalev, K.' 5 ? 'Cooley, R.B.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 583 _citation.language ? _citation.page_first 100 _citation.page_last 105 _citation.title 'Crystal structure of human 14-3-3 zeta complexed with the noncanonical phosphopeptide from proapoptotic BAD.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2021.10.053 _citation.pdbx_database_id_PubMed 34735870 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sluchanko, N.N.' 1 ? primary 'Tugaeva, K.V.' 2 ? primary 'Gushchin, I.' 3 ? primary 'Remeeva, A.' 4 ? primary 'Kovalev, K.' 5 ? primary 'Cooley, R.B.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein zeta/delta,Bcl2-associated agonist of cell death' 27552.871 1 ? ? ? ? 2 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Protein kinase C inhibitor protein 1,KCIP-1,BAD,Bcl-2-binding component 6,Bcl-2-like protein 8,Bcl2-L-8,Bcl-xL/Bcl-2-associated death promoter,Bcl2 antagonist of cell death ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSAWRVVSSIEQKTEGAEKKQQMAR EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISAAAM QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTGSGGSRH (SEP)SYPAGTE ; _entity_poly.pdbx_seq_one_letter_code_can ;MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSAWRVVSSIEQKTEGAEKKQQMAR EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISAAAM QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTGSGGSRHSSYP AGTE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 ASN n 1 5 GLU n 1 6 LEU n 1 7 VAL n 1 8 GLN n 1 9 LYS n 1 10 ALA n 1 11 LYS n 1 12 LEU n 1 13 ALA n 1 14 GLU n 1 15 GLN n 1 16 ALA n 1 17 GLU n 1 18 ARG n 1 19 TYR n 1 20 ASP n 1 21 ASP n 1 22 MET n 1 23 ALA n 1 24 ALA n 1 25 CYS n 1 26 MET n 1 27 LYS n 1 28 SER n 1 29 VAL n 1 30 THR n 1 31 GLU n 1 32 GLN n 1 33 GLY n 1 34 ALA n 1 35 GLU n 1 36 LEU n 1 37 SER n 1 38 ASN n 1 39 GLU n 1 40 GLU n 1 41 ARG n 1 42 ASN n 1 43 LEU n 1 44 LEU n 1 45 SER n 1 46 VAL n 1 47 ALA n 1 48 TYR n 1 49 LYS n 1 50 ASN n 1 51 VAL n 1 52 VAL n 1 53 GLY n 1 54 ALA n 1 55 ARG n 1 56 ARG n 1 57 SER n 1 58 ALA n 1 59 TRP n 1 60 ARG n 1 61 VAL n 1 62 VAL n 1 63 SER n 1 64 SER n 1 65 ILE n 1 66 GLU n 1 67 GLN n 1 68 LYS n 1 69 THR n 1 70 GLU n 1 71 GLY n 1 72 ALA n 1 73 GLU n 1 74 LYS n 1 75 LYS n 1 76 GLN n 1 77 GLN n 1 78 MET n 1 79 ALA n 1 80 ARG n 1 81 GLU n 1 82 TYR n 1 83 ARG n 1 84 GLU n 1 85 LYS n 1 86 ILE n 1 87 GLU n 1 88 THR n 1 89 GLU n 1 90 LEU n 1 91 ARG n 1 92 ASP n 1 93 ILE n 1 94 CYS n 1 95 ASN n 1 96 ASP n 1 97 VAL n 1 98 LEU n 1 99 SER n 1 100 LEU n 1 101 LEU n 1 102 GLU n 1 103 LYS n 1 104 PHE n 1 105 LEU n 1 106 ILE n 1 107 PRO n 1 108 ASN n 1 109 ALA n 1 110 SER n 1 111 GLN n 1 112 ALA n 1 113 GLU n 1 114 SER n 1 115 LYS n 1 116 VAL n 1 117 PHE n 1 118 TYR n 1 119 LEU n 1 120 LYS n 1 121 MET n 1 122 LYS n 1 123 GLY n 1 124 ASP n 1 125 TYR n 1 126 TYR n 1 127 ARG n 1 128 TYR n 1 129 LEU n 1 130 ALA n 1 131 GLU n 1 132 VAL n 1 133 ALA n 1 134 ALA n 1 135 GLY n 1 136 ASP n 1 137 ASP n 1 138 LYS n 1 139 LYS n 1 140 GLY n 1 141 ILE n 1 142 VAL n 1 143 ASP n 1 144 GLN n 1 145 SER n 1 146 GLN n 1 147 GLN n 1 148 ALA n 1 149 TYR n 1 150 GLN n 1 151 GLU n 1 152 ALA n 1 153 PHE n 1 154 GLU n 1 155 ILE n 1 156 SER n 1 157 ALA n 1 158 ALA n 1 159 ALA n 1 160 MET n 1 161 GLN n 1 162 PRO n 1 163 THR n 1 164 HIS n 1 165 PRO n 1 166 ILE n 1 167 ARG n 1 168 LEU n 1 169 GLY n 1 170 LEU n 1 171 ALA n 1 172 LEU n 1 173 ASN n 1 174 PHE n 1 175 SER n 1 176 VAL n 1 177 PHE n 1 178 TYR n 1 179 TYR n 1 180 GLU n 1 181 ILE n 1 182 LEU n 1 183 ASN n 1 184 SER n 1 185 PRO n 1 186 GLU n 1 187 LYS n 1 188 ALA n 1 189 CYS n 1 190 SER n 1 191 LEU n 1 192 ALA n 1 193 LYS n 1 194 THR n 1 195 ALA n 1 196 PHE n 1 197 ASP n 1 198 GLU n 1 199 ALA n 1 200 ILE n 1 201 ALA n 1 202 GLU n 1 203 LEU n 1 204 ASP n 1 205 THR n 1 206 LEU n 1 207 SER n 1 208 GLU n 1 209 GLU n 1 210 SER n 1 211 TYR n 1 212 LYS n 1 213 ASP n 1 214 SER n 1 215 THR n 1 216 LEU n 1 217 ILE n 1 218 MET n 1 219 GLN n 1 220 LEU n 1 221 LEU n 1 222 ARG n 1 223 ASP n 1 224 ASN n 1 225 LEU n 1 226 THR n 1 227 LEU n 1 228 TRP n 1 229 THR n 1 230 GLY n 1 231 SER n 1 232 GLY n 1 233 GLY n 1 234 SER n 1 235 ARG n 1 236 HIS n 1 237 SEP n 1 238 SER n 1 239 TYR n 1 240 PRO n 1 241 ALA n 1 242 GLY n 1 243 THR n 1 244 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 229 Human ? YWHAZ ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 230 244 Human ? 'BAD, BBC6, BCL2L8' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 CYS 189 189 189 CYS CYS A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 LYS 212 212 212 LYS LYS A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 MET 218 218 218 MET MET A . n A 1 219 GLN 219 219 219 GLN GLN A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 TRP 228 228 228 TRP TRP A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 SER 234 234 234 SER SER A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 HIS 236 236 236 HIS HIS A . n A 1 237 SEP 237 237 237 SEP SEP A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 TYR 239 239 239 TYR TYR A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 GLY 242 242 ? ? ? A . n A 1 243 THR 243 243 ? ? ? A . n A 1 244 GLU 244 244 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 15 HOH HOH A . B 2 HOH 2 302 46 HOH HOH A . B 2 HOH 3 303 12 HOH HOH A . B 2 HOH 4 304 1 HOH HOH A . B 2 HOH 5 305 30 HOH HOH A . B 2 HOH 6 306 49 HOH HOH A . B 2 HOH 7 307 4 HOH HOH A . B 2 HOH 8 308 1 HOH HOH A . B 2 HOH 9 309 8 HOH HOH A . B 2 HOH 10 310 40 HOH HOH A . B 2 HOH 11 311 36 HOH HOH A . B 2 HOH 12 312 16 HOH HOH A . B 2 HOH 13 313 29 HOH HOH A . B 2 HOH 14 314 35 HOH HOH A . B 2 HOH 15 315 43 HOH HOH A . B 2 HOH 16 316 24 HOH HOH A . B 2 HOH 17 317 2 HOH HOH A . B 2 HOH 18 318 13 HOH HOH A . B 2 HOH 19 319 41 HOH HOH A . B 2 HOH 20 320 39 HOH HOH A . B 2 HOH 21 321 27 HOH HOH A . B 2 HOH 22 322 18 HOH HOH A . B 2 HOH 23 323 26 HOH HOH A . B 2 HOH 24 324 47 HOH HOH A . B 2 HOH 25 325 32 HOH HOH A . B 2 HOH 26 326 37 HOH HOH A . B 2 HOH 27 327 38 HOH HOH A . B 2 HOH 28 328 9 HOH HOH A . B 2 HOH 29 329 20 HOH HOH A . B 2 HOH 30 330 10 HOH HOH A . B 2 HOH 31 331 11 HOH HOH A . B 2 HOH 32 332 23 HOH HOH A . B 2 HOH 33 333 17 HOH HOH A . B 2 HOH 34 334 22 HOH HOH A . B 2 HOH 35 335 6 HOH HOH A . B 2 HOH 36 336 25 HOH HOH A . B 2 HOH 37 337 42 HOH HOH A . B 2 HOH 38 338 7 HOH HOH A . B 2 HOH 39 339 34 HOH HOH A . B 2 HOH 40 340 14 HOH HOH A . B 2 HOH 41 341 5 HOH HOH A . B 2 HOH 42 342 31 HOH HOH A . B 2 HOH 43 343 10 HOH HOH A . B 2 HOH 44 344 17 HOH HOH A . B 2 HOH 45 345 16 HOH HOH A . B 2 HOH 46 346 45 HOH HOH A . B 2 HOH 47 347 28 HOH HOH A . B 2 HOH 48 348 33 HOH HOH A . B 2 HOH 49 349 44 HOH HOH A . B 2 HOH 50 350 5 HOH HOH A . B 2 HOH 51 351 6 HOH HOH A . B 2 HOH 52 352 11 HOH HOH A . B 2 HOH 53 353 3 HOH HOH A . B 2 HOH 54 354 19 HOH HOH A . B 2 HOH 55 355 9 HOH HOH A . B 2 HOH 56 356 8 HOH HOH A . B 2 HOH 57 357 21 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 139 ? CB ? A LYS 139 CB 2 1 Y 1 A LYS 139 ? CG ? A LYS 139 CG 3 1 Y 1 A LYS 139 ? CD ? A LYS 139 CD 4 1 Y 1 A LYS 139 ? CE ? A LYS 139 CE 5 1 Y 1 A LYS 139 ? NZ ? A LYS 139 NZ 6 1 Y 1 A GLU 186 ? CB ? A GLU 186 CB 7 1 Y 1 A GLU 186 ? CG ? A GLU 186 CG 8 1 Y 1 A GLU 186 ? CD ? A GLU 186 CD 9 1 Y 1 A GLU 186 ? OE1 ? A GLU 186 OE1 10 1 Y 1 A GLU 186 ? OE2 ? A GLU 186 OE2 11 1 Y 1 A LYS 187 ? CD ? A LYS 187 CD 12 1 Y 1 A LYS 187 ? CE ? A LYS 187 CE 13 1 Y 1 A LYS 187 ? NZ ? A LYS 187 NZ 14 1 Y 1 A LYS 212 ? CG ? A LYS 212 CG 15 1 Y 1 A LYS 212 ? CD ? A LYS 212 CD 16 1 Y 1 A LYS 212 ? CE ? A LYS 212 CE 17 1 Y 1 A LYS 212 ? NZ ? A LYS 212 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7Q16 _cell.details ? _cell.formula_units_Z ? _cell.length_a 85.698 _cell.length_a_esd ? _cell.length_b 112.147 _cell.length_b_esd ? _cell.length_c 75.719 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7Q16 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Q16 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.16 M calcium acetate, 0.08 M sodium cacodylate pH 6.5, 14.4 % w/v PEG 8000, 20 % v/v glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-09-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9724 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9724 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 52.490 _reflns.entry_id 7Q16 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.356 _reflns.d_resolution_low 45.062 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11472 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.356 _reflns_shell.d_res_low 2.523 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.07 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 574 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.523 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 148.300 _refine.B_iso_mean 60.2522 _refine.B_iso_min 29.990 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Q16 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3560 _refine.ls_d_res_low 45.0620 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11354 _refine.ls_number_reflns_R_free 583 _refine.ls_number_reflns_R_work 10771 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 73.5800 _refine.ls_percent_reflns_R_free 5.1300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1989 _refine.ls_R_factor_R_free 0.2414 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1968 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6ZFD _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.9600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3560 _refine_hist.d_res_low 45.0620 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 1940 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 240 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 55.79 _refine_hist.pdbx_number_atoms_protein 1883 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1911 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.564 ? 2578 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.035 ? 283 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 337 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.509 ? 1173 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3564 2.5936 . . 47 858 24.0000 . . . 0.3022 0.0000 0.2980 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5936 2.9688 . . 135 2495 69.0000 . . . 0.3043 0.0000 0.2683 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9688 3.7401 . . 205 3635 100.0000 . . . 0.2739 0.0000 0.2186 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7401 45.062 . . 196 3783 100.0000 . . . 0.2076 0.0000 0.1695 . . . . . . . . . . . # _struct.entry_id 7Q16 _struct.title 'Human 14-3-3 zeta fused to the BAD peptide including phosphoserine-74' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Q16 _struct_keywords.text 'Signaling protein, apoptotic regulation, phosphorylation, phosphopeptide binding' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP 1433Z_HUMAN P63104 ? 1 ;MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWT ; 1 2 UNP BAD_HUMAN Q92934 ? 1 SRHSSYPAGTE 71 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7Q16 A 1 ? 229 ? P63104 1 ? 229 ? 1 229 2 2 7Q16 A 234 ? 244 ? Q92934 71 ? 81 ? 234 244 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Q16 ALA A 58 ? UNP P63104 SER 58 'engineered mutation' 58 1 1 7Q16 ALA A 157 ? UNP P63104 LYS 157 'engineered mutation' 157 2 1 7Q16 ALA A 158 ? UNP P63104 LYS 158 'engineered mutation' 158 3 1 7Q16 ALA A 159 ? UNP P63104 GLU 159 'engineered mutation' 159 4 1 7Q16 GLY A 230 ? UNP P63104 ? ? linker 230 5 1 7Q16 SER A 231 ? UNP P63104 ? ? linker 231 6 1 7Q16 GLY A 232 ? UNP P63104 ? ? linker 232 7 1 7Q16 GLY A 233 ? UNP P63104 ? ? linker 233 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1800 ? 1 MORE -13 ? 1 'SSA (A^2)' 24790 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? GLU A 17 ? ASP A 2 GLU A 17 1 ? 16 HELX_P HELX_P2 AA2 ARG A 18 ? GLN A 32 ? ARG A 18 GLN A 32 1 ? 15 HELX_P HELX_P3 AA3 SER A 37 ? THR A 69 ? SER A 37 THR A 69 1 ? 33 HELX_P HELX_P4 AA4 ALA A 72 ? PHE A 104 ? ALA A 72 PHE A 104 1 ? 33 HELX_P HELX_P5 AA5 PHE A 104 ? ALA A 109 ? PHE A 104 ALA A 109 1 ? 6 HELX_P HELX_P6 AA6 GLN A 111 ? VAL A 132 ? GLN A 111 VAL A 132 1 ? 22 HELX_P HELX_P7 AA7 GLY A 135 ? MET A 160 ? GLY A 135 MET A 160 1 ? 26 HELX_P HELX_P8 AA8 HIS A 164 ? ILE A 181 ? HIS A 164 ILE A 181 1 ? 18 HELX_P HELX_P9 AA9 SER A 184 ? GLU A 202 ? SER A 184 GLU A 202 1 ? 19 HELX_P HELX_P10 AB1 LEU A 203 ? LEU A 206 ? LEU A 203 LEU A 206 5 ? 4 HELX_P HELX_P11 AB2 SER A 210 ? GLY A 230 ? SER A 210 GLY A 230 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A HIS 236 C ? ? ? 1_555 A SEP 237 N ? ? A HIS 236 A SEP 237 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A SEP 237 C ? ? ? 1_555 A SER 238 N ? ? A SEP 237 A SER 238 1_555 ? ? ? ? ? ? ? 1.330 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 104 ? ? -125.91 -56.08 2 1 GLU A 202 ? ? -108.58 43.08 3 1 SER A 210 ? ? -156.34 33.77 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 237 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 237 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 28.1783 18.8470 -2.5905 0.5188 ? -0.0266 ? 0.0346 ? 0.4420 ? 0.0376 ? 0.5627 ? 0.4282 ? -0.4118 ? -0.4527 ? 0.4129 ? 0.5611 ? 1.0394 ? 0.1697 ? 0.7826 ? 0.3955 ? -0.7594 ? 0.0191 ? -0.1457 ? -0.6032 ? -0.0248 ? -0.0003 ? 2 'X-RAY DIFFRACTION' ? refined 30.6828 15.3610 3.9939 0.3490 ? -0.0572 ? 0.0081 ? 0.4638 ? -0.0493 ? 0.5552 ? 0.8586 ? -0.2856 ? -0.5088 ? 0.7558 ? -0.8209 ? 1.7959 ? -0.0935 ? 0.3234 ? 0.3974 ? -0.1561 ? 0.1852 ? -0.0126 ? 0.0195 ? 0.7238 ? -0.0005 ? 3 'X-RAY DIFFRACTION' ? refined 23.3063 2.9655 10.7517 0.3273 ? 0.0154 ? -0.0167 ? 0.3790 ? 0.0147 ? 0.4285 ? 0.2734 ? 0.1935 ? -0.2243 ? 0.4948 ? 0.2014 ? 0.9909 ? -0.2248 ? 0.0393 ? 0.0802 ? 0.4179 ? 0.3536 ? 0.4287 ? 0.0309 ? -0.0829 ? -0.0004 ? 4 'X-RAY DIFFRACTION' ? refined 31.0317 -6.1020 14.4048 0.4763 ? 0.0239 ? -0.0957 ? 0.4867 ? 0.0454 ? 0.5664 ? 0.1085 ? -0.6468 ? -0.1824 ? 1.3139 ? 0.2152 ? -0.0192 ? -0.1081 ? -0.3034 ? -0.2182 ? 0.6134 ? 0.1408 ? -1.1001 ? 0.2167 ? 0.2590 ? -0.0039 ? 5 'X-RAY DIFFRACTION' ? refined 31.8190 23.9363 17.4483 0.5634 ? -0.2014 ? 0.0014 ? 0.6914 ? -0.2251 ? 0.9023 ? 0.6110 ? -0.3787 ? -0.4484 ? 1.0304 ? -1.3553 ? 3.5235 ? 0.2596 ? -0.5606 ? 0.7510 ? 0.1725 ? 0.0339 ? -0.5442 ? -1.4304 ? 0.6753 ? 0.2577 ? 6 'X-RAY DIFFRACTION' ? refined 25.8552 10.9175 20.1460 0.5206 ? -0.0036 ? -0.0460 ? 0.5001 ? -0.0510 ? 0.3572 ? 0.5701 ? 0.2855 ? -0.1125 ? 1.1796 ? 1.2785 ? 1.5848 ? 0.0300 ? -0.1481 ? 0.0354 ? 0.6646 ? 0.0141 ? 0.0586 ? 0.0995 ? 0.1016 ? 0.0002 ? 7 'X-RAY DIFFRACTION' ? refined 25.8044 11.8002 28.5002 0.8623 ? 0.0704 ? -0.1271 ? 0.7806 ? -0.1038 ? 0.4025 ? 1.9860 ? 1.5015 ? -0.2022 ? 1.3719 ? 0.2627 ? 0.9725 ? -0.4668 ? -1.1676 ? 0.3448 ? 2.0364 ? 0.6001 ? -0.9299 ? -0.1568 ? 0.6038 ? -0.0098 ? 8 'X-RAY DIFFRACTION' ? refined 15.6552 12.1164 24.6893 0.7098 ? 0.0310 ? 0.1665 ? 0.5075 ? -0.0483 ? 0.4362 ? 1.5649 ? 0.2498 ? 1.1026 ? 0.3559 ? 0.3064 ? 0.5501 ? -0.3013 ? -0.5207 ? 0.1019 ? 0.4952 ? 0.2110 ? -0.0567 ? 0.2167 ? -0.1898 ? -0.0004 ? 9 'X-RAY DIFFRACTION' ? refined 7.4444 13.2993 28.9513 0.7642 ? 0.0264 ? 0.2721 ? 0.7704 ? -0.0785 ? 0.6195 ? 0.1768 ? -0.1710 ? -0.2699 ? 0.0697 ? 0.1587 ? 0.2936 ? -0.1328 ? -0.7838 ? 0.0364 ? 0.4491 ? 0.0403 ? 0.5316 ? 0.2157 ? -0.4009 ? -0.0003 ? 10 'X-RAY DIFFRACTION' ? refined 5.8747 27.1097 17.3622 1.1377 ? 0.0537 ? -0.0209 ? 0.7741 ? -0.0915 ? 1.0525 ? 0.4433 ? -0.1015 ? 0.3199 ? 0.1868 ? -0.0650 ? 1.0416 ? -1.0889 ? -0.1753 ? 1.7714 ? -0.2872 ? -0.4610 ? 0.5599 ? -1.9971 ? 0.4006 ? -0.0863 ? 11 'X-RAY DIFFRACTION' ? refined 5.9854 10.9908 19.2467 0.5115 ? -0.0564 ? 0.1882 ? 0.6348 ? -0.0614 ? 0.6338 ? 0.8788 ? 0.0618 ? 0.6484 ? 0.6626 ? 0.5507 ? 0.6965 ? -0.0565 ? -0.0510 ? -0.1460 ? -0.1225 ? 0.3042 ? 0.9523 ? 0.0254 ? 0.0561 ? -0.0005 ? 12 'X-RAY DIFFRACTION' ? refined -10.9536 5.8789 23.4146 0.4704 ? 0.0979 ? -0.0541 ? 0.6660 ? 0.0959 ? 0.5185 ? 0.9036 ? 0.5745 ? -0.8871 ? 0.3584 ? -0.5738 ? 0.8884 ? -1.6107 ? -1.0381 ? 0.1002 ? 0.2327 ? 0.3991 ? -0.2282 ? -0.3986 ? 0.3809 ? -0.1813 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 2 ? ? ? A 15 ? ? ;chain 'A' and (resid 2 through 15 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 16 ? ? ? A 37 ? ? ;chain 'A' and (resid 16 through 37 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 38 ? ? ? A 68 ? ? ;chain 'A' and (resid 38 through 68 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 69 ? ? ? A 103 ? ? ;chain 'A' and (resid 69 through 103 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 104 ? ? ? A 111 ? ? ;chain 'A' and (resid 104 through 111 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 112 ? ? ? A 135 ? ? ;chain 'A' and (resid 112 through 135 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 136 ? ? ? A 159 ? ? ;chain 'A' and (resid 136 through 159 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 160 ? ? ? A 184 ? ? ;chain 'A' and (resid 160 through 184 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? A 185 ? ? ? A 201 ? ? ;chain 'A' and (resid 185 through 201 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? A 202 ? ? ? A 210 ? ? ;chain 'A' and (resid 202 through 210 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? A 211 ? ? ? A 229 ? ? ;chain 'A' and (resid 211 through 229 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? A 230 ? ? ? A 241 ? ? ;chain 'A' and (resid 230 through 241 ) ; # _pdbx_entry_details.entry_id 7Q16 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 242 ? A GLY 242 3 1 Y 1 A THR 243 ? A THR 243 4 1 Y 1 A GLU 244 ? A GLU 244 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SEP N N N N 290 SEP CA C N S 291 SEP CB C N N 292 SEP OG O N N 293 SEP C C N N 294 SEP O O N N 295 SEP OXT O N N 296 SEP P P N N 297 SEP O1P O N N 298 SEP O2P O N N 299 SEP O3P O N N 300 SEP H H N N 301 SEP H2 H N N 302 SEP HA H N N 303 SEP HB2 H N N 304 SEP HB3 H N N 305 SEP HXT H N N 306 SEP HOP2 H N N 307 SEP HOP3 H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SEP N CA sing N N 277 SEP N H sing N N 278 SEP N H2 sing N N 279 SEP CA CB sing N N 280 SEP CA C sing N N 281 SEP CA HA sing N N 282 SEP CB OG sing N N 283 SEP CB HB2 sing N N 284 SEP CB HB3 sing N N 285 SEP OG P sing N N 286 SEP C O doub N N 287 SEP C OXT sing N N 288 SEP OXT HXT sing N N 289 SEP P O1P doub N N 290 SEP P O2P sing N N 291 SEP P O3P sing N N 292 SEP O2P HOP2 sing N N 293 SEP O3P HOP3 sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 19-74-10031 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SEP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SEP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6ZFD _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7Q16 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011669 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008917 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013207 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_