data_7QAP # _entry.id 7QAP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QAP pdb_00007qap 10.2210/pdb7qap/pdb WWPDB D_1292119266 ? ? BMRB 34683 ? 10.13018/BMR34683 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-05-04 2 'Structure model' 1 1 2022-08-17 3 'Structure model' 1 2 2022-09-07 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_citation.journal_volume' 14 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7QAP _pdbx_database_status.recvd_initial_deposition_date 2021-11-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Three-dimensional structure of the PGAM5 G17L mutant TMD' _pdbx_database_related.db_id 34683 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email claudia.muhle@kit.edu _pdbx_contact_author.name_first Claudia _pdbx_contact_author.name_last Muhle-Goll _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9474-9041 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Silber, M.' 1 0000-0003-2479-9024 'Muhle-Goll, C.' 2 0000-0002-9474-9041 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 298 _citation.language ? _citation.page_first 102321 _citation.page_last 102321 _citation.title ;Cleavage of mitochondrial homeostasis regulator PGAM5 by the intramembrane protease PARL is governed by transmembrane helix dynamics and oligomeric state. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2022.102321 _citation.pdbx_database_id_PubMed 35921890 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Siebert, V.' 1 ? primary 'Silber, M.' 2 ? primary 'Heuten, E.' 3 ? primary 'Muhle-Goll, C.' 4 ? primary 'Lemberg, M.K.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Serine/threonine-protein phosphatase PGAM5, mitochondrial' _entity.formula_weight 3360.907 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.3.16 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bcl-XL-binding protein v68,Phosphoglycerate mutase family member 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AFRQALQLAACGLAGLSAAVLFSAVAVGKPRAGGD _entity_poly.pdbx_seq_one_letter_code_can AFRQALQLAACGLAGLSAAVLFSAVAVGKPRAGGD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PHE n 1 3 ARG n 1 4 GLN n 1 5 ALA n 1 6 LEU n 1 7 GLN n 1 8 LEU n 1 9 ALA n 1 10 ALA n 1 11 CYS n 1 12 GLY n 1 13 LEU n 1 14 ALA n 1 15 GLY n 1 16 LEU n 1 17 SER n 1 18 ALA n 1 19 ALA n 1 20 VAL n 1 21 LEU n 1 22 PHE n 1 23 SER n 1 24 ALA n 1 25 VAL n 1 26 ALA n 1 27 VAL n 1 28 GLY n 1 29 LYS n 1 30 PRO n 1 31 ARG n 1 32 ALA n 1 33 GLY n 1 34 GLY n 1 35 ASP n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 35 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 PHE 2 3 3 PHE PHE A . n A 1 3 ARG 3 4 4 ARG ARG A . n A 1 4 GLN 4 5 5 GLN GLN A . n A 1 5 ALA 5 6 6 ALA ALA A . n A 1 6 LEU 6 7 7 LEU LEU A . n A 1 7 GLN 7 8 8 GLN GLN A . n A 1 8 LEU 8 9 9 LEU LEU A . n A 1 9 ALA 9 10 10 ALA ALA A . n A 1 10 ALA 10 11 11 ALA ALA A . n A 1 11 CYS 11 12 12 CYS CYS A . n A 1 12 GLY 12 13 13 GLY GLY A . n A 1 13 LEU 13 14 14 LEU LEU A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 GLY 15 16 16 GLY GLY A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 SER 17 18 18 SER SER A . n A 1 18 ALA 18 19 19 ALA ALA A . n A 1 19 ALA 19 20 20 ALA ALA A . n A 1 20 VAL 20 21 21 VAL VAL A . n A 1 21 LEU 21 22 22 LEU LEU A . n A 1 22 PHE 22 23 23 PHE PHE A . n A 1 23 SER 23 24 24 SER SER A . n A 1 24 ALA 24 25 25 ALA ALA A . n A 1 25 VAL 25 26 26 VAL VAL A . n A 1 26 ALA 26 27 27 ALA ALA A . n A 1 27 VAL 27 28 28 VAL VAL A . n A 1 28 GLY 28 29 29 GLY GLY A . n A 1 29 LYS 29 30 30 LYS LYS A . n A 1 30 PRO 30 31 31 PRO PRO A . n A 1 31 ARG 31 32 32 ARG ARG A . n A 1 32 ALA 32 33 33 ALA ALA A . n A 1 33 GLY 33 34 34 GLY GLY A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 ASP 35 36 36 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QAP _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7QAP _struct.title 'Three-dimensional structure of the PGAM5 G17L mutant TMD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QAP _struct_keywords.text 'PARL, MITOCHONDRIA, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGAM5_HUMAN _struct_ref.pdbx_db_accession Q96HS1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGD _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QAP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96HS1 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 36 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 36 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7QAP _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 16 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q96HS1 _struct_ref_seq_dif.db_mon_id GLY _struct_ref_seq_dif.pdbx_seq_db_seq_num 17 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 17 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 3 ? LEU A 13 ? ARG A 4 LEU A 14 1 ? 11 HELX_P HELX_P2 AA2 GLY A 15 ? LYS A 29 ? GLY A 16 LYS A 30 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 32 ? ? -66.77 98.67 2 2 ARG A 32 ? ? -63.02 94.95 3 2 ALA A 33 ? ? -113.90 75.75 4 3 ARG A 32 ? ? -61.21 98.15 5 5 ARG A 32 ? ? -68.50 90.10 6 6 ARG A 32 ? ? -66.06 96.91 7 7 ARG A 32 ? ? -63.18 99.10 8 8 ARG A 32 ? ? -60.96 93.64 9 12 ARG A 32 ? ? -66.42 87.96 10 15 ARG A 32 ? ? -63.70 90.46 11 17 ARG A 32 ? ? -67.83 84.99 12 18 ARG A 32 ? ? -69.32 88.91 13 19 PHE A 23 ? ? -49.68 -19.45 14 20 PRO A 31 ? ? -48.14 163.00 15 20 ARG A 32 ? ? -63.43 86.53 # _pdbx_nmr_ensemble.entry_id 7QAP _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7QAP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM G17L, trifluoroethanol/water' _pdbx_nmr_sample_details.solvent_system trifluoroethanol/water _pdbx_nmr_sample_details.label G17L _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component G17L _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label G17L _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-1H TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 7QAP _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' ? 'Vranken WF, Boucher W, Stevens TJ, Fogh RH, Pajon A, Llinas M, Ulrich EL, Markley JL, Ionides J, Laue ED' 4 'peak picking' 'CcpNmr Analysis' ? 'Vranken WF, Boucher W, Stevens TJ, Fogh RH, Pajon A, Llinas M, Ulrich EL, Markley JL, Ionides J, Laue ED' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLY N N N N 91 GLY CA C N N 92 GLY C C N N 93 GLY O O N N 94 GLY OXT O N N 95 GLY H H N N 96 GLY H2 H N N 97 GLY HA2 H N N 98 GLY HA3 H N N 99 GLY HXT H N N 100 LEU N N N N 101 LEU CA C N S 102 LEU C C N N 103 LEU O O N N 104 LEU CB C N N 105 LEU CG C N N 106 LEU CD1 C N N 107 LEU CD2 C N N 108 LEU OXT O N N 109 LEU H H N N 110 LEU H2 H N N 111 LEU HA H N N 112 LEU HB2 H N N 113 LEU HB3 H N N 114 LEU HG H N N 115 LEU HD11 H N N 116 LEU HD12 H N N 117 LEU HD13 H N N 118 LEU HD21 H N N 119 LEU HD22 H N N 120 LEU HD23 H N N 121 LEU HXT H N N 122 LYS N N N N 123 LYS CA C N S 124 LYS C C N N 125 LYS O O N N 126 LYS CB C N N 127 LYS CG C N N 128 LYS CD C N N 129 LYS CE C N N 130 LYS NZ N N N 131 LYS OXT O N N 132 LYS H H N N 133 LYS H2 H N N 134 LYS HA H N N 135 LYS HB2 H N N 136 LYS HB3 H N N 137 LYS HG2 H N N 138 LYS HG3 H N N 139 LYS HD2 H N N 140 LYS HD3 H N N 141 LYS HE2 H N N 142 LYS HE3 H N N 143 LYS HZ1 H N N 144 LYS HZ2 H N N 145 LYS HZ3 H N N 146 LYS HXT H N N 147 PHE N N N N 148 PHE CA C N S 149 PHE C C N N 150 PHE O O N N 151 PHE CB C N N 152 PHE CG C Y N 153 PHE CD1 C Y N 154 PHE CD2 C Y N 155 PHE CE1 C Y N 156 PHE CE2 C Y N 157 PHE CZ C Y N 158 PHE OXT O N N 159 PHE H H N N 160 PHE H2 H N N 161 PHE HA H N N 162 PHE HB2 H N N 163 PHE HB3 H N N 164 PHE HD1 H N N 165 PHE HD2 H N N 166 PHE HE1 H N N 167 PHE HE2 H N N 168 PHE HZ H N N 169 PHE HXT H N N 170 PRO N N N N 171 PRO CA C N S 172 PRO C C N N 173 PRO O O N N 174 PRO CB C N N 175 PRO CG C N N 176 PRO CD C N N 177 PRO OXT O N N 178 PRO H H N N 179 PRO HA H N N 180 PRO HB2 H N N 181 PRO HB3 H N N 182 PRO HG2 H N N 183 PRO HG3 H N N 184 PRO HD2 H N N 185 PRO HD3 H N N 186 PRO HXT H N N 187 SER N N N N 188 SER CA C N S 189 SER C C N N 190 SER O O N N 191 SER CB C N N 192 SER OG O N N 193 SER OXT O N N 194 SER H H N N 195 SER H2 H N N 196 SER HA H N N 197 SER HB2 H N N 198 SER HB3 H N N 199 SER HG H N N 200 SER HXT H N N 201 VAL N N N N 202 VAL CA C N S 203 VAL C C N N 204 VAL O O N N 205 VAL CB C N N 206 VAL CG1 C N N 207 VAL CG2 C N N 208 VAL OXT O N N 209 VAL H H N N 210 VAL H2 H N N 211 VAL HA H N N 212 VAL HB H N N 213 VAL HG11 H N N 214 VAL HG12 H N N 215 VAL HG13 H N N 216 VAL HG21 H N N 217 VAL HG22 H N N 218 VAL HG23 H N N 219 VAL HXT H N N 220 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLY N CA sing N N 86 GLY N H sing N N 87 GLY N H2 sing N N 88 GLY CA C sing N N 89 GLY CA HA2 sing N N 90 GLY CA HA3 sing N N 91 GLY C O doub N N 92 GLY C OXT sing N N 93 GLY OXT HXT sing N N 94 LEU N CA sing N N 95 LEU N H sing N N 96 LEU N H2 sing N N 97 LEU CA C sing N N 98 LEU CA CB sing N N 99 LEU CA HA sing N N 100 LEU C O doub N N 101 LEU C OXT sing N N 102 LEU CB CG sing N N 103 LEU CB HB2 sing N N 104 LEU CB HB3 sing N N 105 LEU CG CD1 sing N N 106 LEU CG CD2 sing N N 107 LEU CG HG sing N N 108 LEU CD1 HD11 sing N N 109 LEU CD1 HD12 sing N N 110 LEU CD1 HD13 sing N N 111 LEU CD2 HD21 sing N N 112 LEU CD2 HD22 sing N N 113 LEU CD2 HD23 sing N N 114 LEU OXT HXT sing N N 115 LYS N CA sing N N 116 LYS N H sing N N 117 LYS N H2 sing N N 118 LYS CA C sing N N 119 LYS CA CB sing N N 120 LYS CA HA sing N N 121 LYS C O doub N N 122 LYS C OXT sing N N 123 LYS CB CG sing N N 124 LYS CB HB2 sing N N 125 LYS CB HB3 sing N N 126 LYS CG CD sing N N 127 LYS CG HG2 sing N N 128 LYS CG HG3 sing N N 129 LYS CD CE sing N N 130 LYS CD HD2 sing N N 131 LYS CD HD3 sing N N 132 LYS CE NZ sing N N 133 LYS CE HE2 sing N N 134 LYS CE HE3 sing N N 135 LYS NZ HZ1 sing N N 136 LYS NZ HZ2 sing N N 137 LYS NZ HZ3 sing N N 138 LYS OXT HXT sing N N 139 PHE N CA sing N N 140 PHE N H sing N N 141 PHE N H2 sing N N 142 PHE CA C sing N N 143 PHE CA CB sing N N 144 PHE CA HA sing N N 145 PHE C O doub N N 146 PHE C OXT sing N N 147 PHE CB CG sing N N 148 PHE CB HB2 sing N N 149 PHE CB HB3 sing N N 150 PHE CG CD1 doub Y N 151 PHE CG CD2 sing Y N 152 PHE CD1 CE1 sing Y N 153 PHE CD1 HD1 sing N N 154 PHE CD2 CE2 doub Y N 155 PHE CD2 HD2 sing N N 156 PHE CE1 CZ doub Y N 157 PHE CE1 HE1 sing N N 158 PHE CE2 CZ sing Y N 159 PHE CE2 HE2 sing N N 160 PHE CZ HZ sing N N 161 PHE OXT HXT sing N N 162 PRO N CA sing N N 163 PRO N CD sing N N 164 PRO N H sing N N 165 PRO CA C sing N N 166 PRO CA CB sing N N 167 PRO CA HA sing N N 168 PRO C O doub N N 169 PRO C OXT sing N N 170 PRO CB CG sing N N 171 PRO CB HB2 sing N N 172 PRO CB HB3 sing N N 173 PRO CG CD sing N N 174 PRO CG HG2 sing N N 175 PRO CG HG3 sing N N 176 PRO CD HD2 sing N N 177 PRO CD HD3 sing N N 178 PRO OXT HXT sing N N 179 SER N CA sing N N 180 SER N H sing N N 181 SER N H2 sing N N 182 SER CA C sing N N 183 SER CA CB sing N N 184 SER CA HA sing N N 185 SER C O doub N N 186 SER C OXT sing N N 187 SER CB OG sing N N 188 SER CB HB2 sing N N 189 SER CB HB3 sing N N 190 SER OG HG sing N N 191 SER OXT HXT sing N N 192 VAL N CA sing N N 193 VAL N H sing N N 194 VAL N H2 sing N N 195 VAL CA C sing N N 196 VAL CA CB sing N N 197 VAL CA HA sing N N 198 VAL C O doub N N 199 VAL C OXT sing N N 200 VAL CB CG1 sing N N 201 VAL CB CG2 sing N N 202 VAL CB HB sing N N 203 VAL CG1 HG11 sing N N 204 VAL CG1 HG12 sing N N 205 VAL CG1 HG13 sing N N 206 VAL CG2 HG21 sing N N 207 VAL CG2 HG22 sing N N 208 VAL CG2 HG23 sing N N 209 VAL OXT HXT sing N N 210 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 263531414/FOR2290 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7QAP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_