data_7QB2
# 
_entry.id   7QB2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7QB2         pdb_00007qb2 10.2210/pdb7qb2/pdb 
WWPDB D_1292117984 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-11-30 
2 'Structure model' 1 1 2023-02-01 
3 'Structure model' 1 2 2024-02-07 
4 'Structure model' 1 3 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Refinement description' 
4 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' chem_comp_atom                
4 3 'Structure model' chem_comp_bond                
5 3 'Structure model' pdbx_initial_refinement_model 
6 4 'Structure model' pdbx_entry_details            
7 4 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                            
2  2 'Structure model' '_citation.journal_abbrev'                     
3  2 'Structure model' '_citation.journal_id_ASTM'                    
4  2 'Structure model' '_citation.journal_id_CSD'                     
5  2 'Structure model' '_citation.journal_id_ISSN'                    
6  2 'Structure model' '_citation.journal_volume'                     
7  2 'Structure model' '_citation.page_first'                         
8  2 'Structure model' '_citation.page_last'                          
9  2 'Structure model' '_citation.pdbx_database_id_DOI'               
10 2 'Structure model' '_citation.pdbx_database_id_PubMed'            
11 2 'Structure model' '_citation.title'                              
12 2 'Structure model' '_citation.year'                               
13 4 'Structure model' '_pdbx_entry_details.has_protein_modification' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7QB2 
_pdbx_database_status.recvd_initial_deposition_date   2021-11-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              wibke.diederich@staff.uni-marburg.de 
_pdbx_contact_author.name_first         Wibke 
_pdbx_contact_author.name_last          Diederich 
_pdbx_contact_author.name_mi            E. 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0001-5671-6575 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Hochban, P.M.M.' 1 0000-0003-3526-7314 
'Heine, A.'       2 0000-0002-5285-4089 
'Diederich, W.E.' 3 0000-0001-5671-6575 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   FR 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Eur.J.Med.Chem. 
_citation.journal_id_ASTM           EJMCA5 
_citation.journal_id_CSD            0493 
_citation.journal_id_ISSN           0223-5234 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            245 
_citation.language                  ? 
_citation.page_first                114914 
_citation.page_last                 114914 
_citation.title                     
;Pose, duplicate, then elaborate: Steps towards increased affinity for inhibitors targeting the specificity surface of the Pim-1 kinase.
;
_citation.year                      2023 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.ejmech.2022.114914 
_citation.pdbx_database_id_PubMed   36410167 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Heyder, L.'      1  ? 
primary 'Hochban, P.M.M.' 2  ? 
primary 'Taylor, C.'      3  ? 
primary 'Chevillard, F.'  4  ? 
primary 'Siefker, C.'     5  ? 
primary 'Iking, C.'       6  ? 
primary 'Borchardt, H.'   7  ? 
primary 'Aigner, A.'      8  ? 
primary 'Klebe, G.'       9  ? 
primary 'Heine, A.'       10 ? 
primary 'Kolb, P.'        11 ? 
primary 'Diederich, W.E.' 12 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase pim-1'                                         35583.398 1  2.7.11.1 R250G ? ? 
2 polymer     syn Pimtide                                                                         1592.850  1  ?        ?     ? ? 
3 non-polymer syn GLYCEROL                                                                        92.094    1  ?        ?     ? ? 
4 non-polymer syn '4-[(E)-(6-azanyl-1-methyl-2-oxidanylidene-indol-3-ylidene)methyl]benzoic acid' 294.305   1  ?        ?     ? ? 
5 water       nat water                                                                           18.015    87 ?        ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL
PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN
CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
;
;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL
PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN
CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
;
A ? 
2 'polypeptide(L)' no no  ARKRRRHPSGPPTA ARKRRRHPSGPPTA D ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL                                                                        GOL 
4 '4-[(E)-(6-azanyl-1-methyl-2-oxidanylidene-indol-3-ylidene)methyl]benzoic acid' A7X 
5 water                                                                           HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   LEU n 
1 4   SER n 
1 5   LYS n 
1 6   ILE n 
1 7   ASN n 
1 8   SER n 
1 9   LEU n 
1 10  ALA n 
1 11  HIS n 
1 12  LEU n 
1 13  ARG n 
1 14  ALA n 
1 15  ALA n 
1 16  PRO n 
1 17  CYS n 
1 18  ASN n 
1 19  ASP n 
1 20  LEU n 
1 21  HIS n 
1 22  ALA n 
1 23  THR n 
1 24  LYS n 
1 25  LEU n 
1 26  ALA n 
1 27  PRO n 
1 28  GLY n 
1 29  LYS n 
1 30  GLU n 
1 31  LYS n 
1 32  GLU n 
1 33  PRO n 
1 34  LEU n 
1 35  GLU n 
1 36  SER n 
1 37  GLN n 
1 38  TYR n 
1 39  GLN n 
1 40  VAL n 
1 41  GLY n 
1 42  PRO n 
1 43  LEU n 
1 44  LEU n 
1 45  GLY n 
1 46  SER n 
1 47  GLY n 
1 48  GLY n 
1 49  PHE n 
1 50  GLY n 
1 51  SER n 
1 52  VAL n 
1 53  TYR n 
1 54  SER n 
1 55  GLY n 
1 56  ILE n 
1 57  ARG n 
1 58  VAL n 
1 59  SER n 
1 60  ASP n 
1 61  ASN n 
1 62  LEU n 
1 63  PRO n 
1 64  VAL n 
1 65  ALA n 
1 66  ILE n 
1 67  LYS n 
1 68  HIS n 
1 69  VAL n 
1 70  GLU n 
1 71  LYS n 
1 72  ASP n 
1 73  ARG n 
1 74  ILE n 
1 75  SER n 
1 76  ASP n 
1 77  TRP n 
1 78  GLY n 
1 79  GLU n 
1 80  LEU n 
1 81  PRO n 
1 82  ASN n 
1 83  GLY n 
1 84  THR n 
1 85  ARG n 
1 86  VAL n 
1 87  PRO n 
1 88  MET n 
1 89  GLU n 
1 90  VAL n 
1 91  VAL n 
1 92  LEU n 
1 93  LEU n 
1 94  LYS n 
1 95  LYS n 
1 96  VAL n 
1 97  SER n 
1 98  SER n 
1 99  GLY n 
1 100 PHE n 
1 101 SER n 
1 102 GLY n 
1 103 VAL n 
1 104 ILE n 
1 105 ARG n 
1 106 LEU n 
1 107 LEU n 
1 108 ASP n 
1 109 TRP n 
1 110 PHE n 
1 111 GLU n 
1 112 ARG n 
1 113 PRO n 
1 114 ASP n 
1 115 SER n 
1 116 PHE n 
1 117 VAL n 
1 118 LEU n 
1 119 ILE n 
1 120 LEU n 
1 121 GLU n 
1 122 ARG n 
1 123 PRO n 
1 124 GLU n 
1 125 PRO n 
1 126 VAL n 
1 127 GLN n 
1 128 ASP n 
1 129 LEU n 
1 130 PHE n 
1 131 ASP n 
1 132 PHE n 
1 133 ILE n 
1 134 THR n 
1 135 GLU n 
1 136 ARG n 
1 137 GLY n 
1 138 ALA n 
1 139 LEU n 
1 140 GLN n 
1 141 GLU n 
1 142 GLU n 
1 143 LEU n 
1 144 ALA n 
1 145 ARG n 
1 146 SER n 
1 147 PHE n 
1 148 PHE n 
1 149 TRP n 
1 150 GLN n 
1 151 VAL n 
1 152 LEU n 
1 153 GLU n 
1 154 ALA n 
1 155 VAL n 
1 156 ARG n 
1 157 HIS n 
1 158 CYS n 
1 159 HIS n 
1 160 ASN n 
1 161 CYS n 
1 162 GLY n 
1 163 VAL n 
1 164 LEU n 
1 165 HIS n 
1 166 ARG n 
1 167 ASP n 
1 168 ILE n 
1 169 LYS n 
1 170 ASP n 
1 171 GLU n 
1 172 ASN n 
1 173 ILE n 
1 174 LEU n 
1 175 ILE n 
1 176 ASP n 
1 177 LEU n 
1 178 ASN n 
1 179 ARG n 
1 180 GLY n 
1 181 GLU n 
1 182 LEU n 
1 183 LYS n 
1 184 LEU n 
1 185 ILE n 
1 186 ASP n 
1 187 PHE n 
1 188 GLY n 
1 189 SER n 
1 190 GLY n 
1 191 ALA n 
1 192 LEU n 
1 193 LEU n 
1 194 LYS n 
1 195 ASP n 
1 196 THR n 
1 197 VAL n 
1 198 TYR n 
1 199 THR n 
1 200 ASP n 
1 201 PHE n 
1 202 ASP n 
1 203 GLY n 
1 204 THR n 
1 205 ARG n 
1 206 VAL n 
1 207 TYR n 
1 208 SER n 
1 209 PRO n 
1 210 PRO n 
1 211 GLU n 
1 212 TRP n 
1 213 ILE n 
1 214 ARG n 
1 215 TYR n 
1 216 HIS n 
1 217 ARG n 
1 218 TYR n 
1 219 HIS n 
1 220 GLY n 
1 221 ARG n 
1 222 SER n 
1 223 ALA n 
1 224 ALA n 
1 225 VAL n 
1 226 TRP n 
1 227 SER n 
1 228 LEU n 
1 229 GLY n 
1 230 ILE n 
1 231 LEU n 
1 232 LEU n 
1 233 TYR n 
1 234 ASP n 
1 235 MET n 
1 236 VAL n 
1 237 CYS n 
1 238 GLY n 
1 239 ASP n 
1 240 ILE n 
1 241 PRO n 
1 242 PHE n 
1 243 GLU n 
1 244 HIS n 
1 245 ASP n 
1 246 GLU n 
1 247 GLU n 
1 248 ILE n 
1 249 ILE n 
1 250 GLY n 
1 251 GLY n 
1 252 GLN n 
1 253 VAL n 
1 254 PHE n 
1 255 PHE n 
1 256 ARG n 
1 257 GLN n 
1 258 ARG n 
1 259 VAL n 
1 260 SER n 
1 261 SEP n 
1 262 GLU n 
1 263 CYS n 
1 264 GLN n 
1 265 HIS n 
1 266 LEU n 
1 267 ILE n 
1 268 ARG n 
1 269 TRP n 
1 270 CYS n 
1 271 LEU n 
1 272 ALA n 
1 273 LEU n 
1 274 ARG n 
1 275 PRO n 
1 276 SER n 
1 277 ASP n 
1 278 ARG n 
1 279 PRO n 
1 280 THR n 
1 281 PHE n 
1 282 GLU n 
1 283 GLU n 
1 284 ILE n 
1 285 GLN n 
1 286 ASN n 
1 287 HIS n 
1 288 PRO n 
1 289 TRP n 
1 290 MET n 
1 291 GLN n 
1 292 ASP n 
1 293 VAL n 
1 294 LEU n 
1 295 LEU n 
1 296 PRO n 
1 297 GLN n 
1 298 GLU n 
1 299 THR n 
1 300 ALA n 
1 301 GLU n 
1 302 ILE n 
1 303 HIS n 
1 304 LEU n 
1 305 HIS n 
1 306 SER n 
1 307 LEU n 
1 308 SER n 
1 309 PRO n 
1 310 GLY n 
1 311 PRO n 
1 312 SER n 
2 1   ALA n 
2 2   ARG n 
2 3   LYS n 
2 4   ARG n 
2 5   ARG n 
2 6   ARG n 
2 7   HIS n 
2 8   PRO n 
2 9   SER n 
2 10  GLY n 
2 11  PRO n 
2 12  PRO n 
2 13  THR n 
2 14  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   312 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PIM1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pLIC-SGC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       14 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A7X non-polymer         . '4-[(E)-(6-azanyl-1-methyl-2-oxidanylidene-indol-3-ylidene)methyl]benzoic acid' 
'(E)-4-((6-amino-1-methyl-2-oxoindolin-3-ylidene)methyl)benzoic acid' 'C17 H14 N2 O3'  294.305 
ALA 'L-peptide linking' y ALANINE                                                                         ? 'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                                                        ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                      ? 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                 ? 'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                        ? 'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                       ? 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                 ? 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                                         ? 'C2 H5 N O2'     
75.067  
GOL non-polymer         . GLYCEROL                                                                        
'GLYCERIN; PROPANE-1,2,3-TRIOL'                                       'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                       ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                                           ? 'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                      ? 'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                         ? 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                                          ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                      ? 'C5 H11 N O2 S'  
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                   ? 'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                                         ? 'C5 H9 N O2'     
115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE                                                                   PHOSPHONOSERINE 
'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE                                                                          ? 'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                                       ? 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                      ? 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                        ? 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                                          ? 'C5 H11 N O2'    
117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LEU 2   2   ?   ?   ?   A . n 
A 1 3   LEU 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   ILE 6   6   ?   ?   ?   A . n 
A 1 7   ASN 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   LEU 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  HIS 11  11  ?   ?   ?   A . n 
A 1 12  LEU 12  12  ?   ?   ?   A . n 
A 1 13  ARG 13  13  ?   ?   ?   A . n 
A 1 14  ALA 14  14  ?   ?   ?   A . n 
A 1 15  ALA 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  CYS 17  17  ?   ?   ?   A . n 
A 1 18  ASN 18  18  ?   ?   ?   A . n 
A 1 19  ASP 19  19  ?   ?   ?   A . n 
A 1 20  LEU 20  20  ?   ?   ?   A . n 
A 1 21  HIS 21  21  ?   ?   ?   A . n 
A 1 22  ALA 22  22  ?   ?   ?   A . n 
A 1 23  THR 23  23  ?   ?   ?   A . n 
A 1 24  LYS 24  24  ?   ?   ?   A . n 
A 1 25  LEU 25  25  ?   ?   ?   A . n 
A 1 26  ALA 26  26  ?   ?   ?   A . n 
A 1 27  PRO 27  27  ?   ?   ?   A . n 
A 1 28  GLY 28  28  ?   ?   ?   A . n 
A 1 29  LYS 29  29  ?   ?   ?   A . n 
A 1 30  GLU 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  GLU 32  32  ?   ?   ?   A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  HIS 68  68  68  HIS HIS A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  TRP 77  77  77  TRP TRP A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  ASN 82  82  82  ASN ASN A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 TRP 109 109 109 TRP TRP A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 GLN 127 127 127 GLN GLN A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 TRP 149 149 149 TRP TRP A . n 
A 1 150 GLN 150 150 150 GLN GLN A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 HIS 157 157 157 HIS HIS A . n 
A 1 158 CYS 158 158 158 CYS CYS A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 ASN 160 160 160 ASN ASN A . n 
A 1 161 CYS 161 161 161 CYS CYS A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 HIS 165 165 165 HIS HIS A . n 
A 1 166 ARG 166 166 166 ARG ARG A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ASP 176 176 176 ASP ASP A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 ASN 178 178 178 ASN ASN A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 ASP 200 200 200 ASP ASP A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 ARG 217 217 217 ARG ARG A . n 
A 1 218 TYR 218 218 218 TYR TYR A . n 
A 1 219 HIS 219 219 219 HIS HIS A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 TRP 226 226 226 TRP TRP A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 TYR 233 233 233 TYR TYR A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 MET 235 235 235 MET MET A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 CYS 237 237 237 CYS CYS A . n 
A 1 238 GLY 238 238 238 GLY GLY A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 ILE 240 240 240 ILE ILE A . n 
A 1 241 PRO 241 241 241 PRO PRO A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 HIS 244 244 244 HIS HIS A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 ILE 249 249 249 ILE ILE A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 GLN 252 252 252 GLN GLN A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 PHE 254 254 254 PHE PHE A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 GLN 257 257 257 GLN GLN A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 SEP 261 261 261 SEP SEP A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 CYS 263 263 263 CYS CYS A . n 
A 1 264 GLN 264 264 264 GLN GLN A . n 
A 1 265 HIS 265 265 265 HIS HIS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 ARG 268 268 268 ARG ARG A . n 
A 1 269 TRP 269 269 269 TRP TRP A . n 
A 1 270 CYS 270 270 270 CYS CYS A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ALA 272 272 272 ALA ALA A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 PRO 275 275 275 PRO PRO A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 ASP 277 277 277 ASP ASP A . n 
A 1 278 ARG 278 278 278 ARG ARG A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 GLU 282 282 282 GLU GLU A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 ASN 286 286 286 ASN ASN A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 PRO 288 288 288 PRO PRO A . n 
A 1 289 TRP 289 289 289 TRP TRP A . n 
A 1 290 MET 290 290 290 MET MET A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 PRO 296 296 296 PRO PRO A . n 
A 1 297 GLN 297 297 297 GLN GLN A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 ILE 302 302 302 ILE ILE A . n 
A 1 303 HIS 303 303 303 HIS HIS A . n 
A 1 304 LEU 304 304 304 LEU LEU A . n 
A 1 305 HIS 305 305 305 HIS HIS A . n 
A 1 306 SER 306 306 ?   ?   ?   A . n 
A 1 307 LEU 307 307 ?   ?   ?   A . n 
A 1 308 SER 308 308 ?   ?   ?   A . n 
A 1 309 PRO 309 309 ?   ?   ?   A . n 
A 1 310 GLY 310 310 ?   ?   ?   A . n 
A 1 311 PRO 311 311 ?   ?   ?   A . n 
A 1 312 SER 312 312 ?   ?   ?   A . n 
B 2 1   ALA 1   1   ?   ?   ?   D . n 
B 2 2   ARG 2   2   2   ARG ARG D . n 
B 2 3   LYS 3   3   3   LYS LYS D . n 
B 2 4   ARG 4   4   4   ARG ARG D . n 
B 2 5   ARG 5   5   5   ARG ARG D . n 
B 2 6   ARG 6   6   6   ARG ARG D . n 
B 2 7   HIS 7   7   7   HIS HIS D . n 
B 2 8   PRO 8   8   8   PRO PRO D . n 
B 2 9   SER 9   9   9   SER SER D . n 
B 2 10  GLY 10  10  ?   ?   ?   D . n 
B 2 11  PRO 11  11  ?   ?   ?   D . n 
B 2 12  PRO 12  12  ?   ?   ?   D . n 
B 2 13  THR 13  13  ?   ?   ?   D . n 
B 2 14  ALA 14  14  ?   ?   ?   D . n 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        A7X 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   A7X 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GOL 1  401 1   GOL GOL A . 
D 4 A7X 1  402 1   A7X 552 A . 
E 5 HOH 1  501 91  HOH HOH A . 
E 5 HOH 2  502 64  HOH HOH A . 
E 5 HOH 3  503 75  HOH HOH A . 
E 5 HOH 4  504 107 HOH HOH A . 
E 5 HOH 5  505 30  HOH HOH A . 
E 5 HOH 6  506 37  HOH HOH A . 
E 5 HOH 7  507 25  HOH HOH A . 
E 5 HOH 8  508 7   HOH HOH A . 
E 5 HOH 9  509 80  HOH HOH A . 
E 5 HOH 10 510 9   HOH HOH A . 
E 5 HOH 11 511 89  HOH HOH A . 
E 5 HOH 12 512 39  HOH HOH A . 
E 5 HOH 13 513 31  HOH HOH A . 
E 5 HOH 14 514 8   HOH HOH A . 
E 5 HOH 15 515 45  HOH HOH A . 
E 5 HOH 16 516 16  HOH HOH A . 
E 5 HOH 17 517 56  HOH HOH A . 
E 5 HOH 18 518 59  HOH HOH A . 
E 5 HOH 19 519 24  HOH HOH A . 
E 5 HOH 20 520 18  HOH HOH A . 
E 5 HOH 21 521 48  HOH HOH A . 
E 5 HOH 22 522 6   HOH HOH A . 
E 5 HOH 23 523 38  HOH HOH A . 
E 5 HOH 24 524 52  HOH HOH A . 
E 5 HOH 25 525 50  HOH HOH A . 
E 5 HOH 26 526 86  HOH HOH A . 
E 5 HOH 27 527 3   HOH HOH A . 
E 5 HOH 28 528 95  HOH HOH A . 
E 5 HOH 29 529 65  HOH HOH A . 
E 5 HOH 30 530 22  HOH HOH A . 
E 5 HOH 31 531 97  HOH HOH A . 
E 5 HOH 32 532 2   HOH HOH A . 
E 5 HOH 33 533 79  HOH HOH A . 
E 5 HOH 34 534 105 HOH HOH A . 
E 5 HOH 35 535 23  HOH HOH A . 
E 5 HOH 36 536 27  HOH HOH A . 
E 5 HOH 37 537 69  HOH HOH A . 
E 5 HOH 38 538 83  HOH HOH A . 
E 5 HOH 39 539 17  HOH HOH A . 
E 5 HOH 40 540 62  HOH HOH A . 
E 5 HOH 41 541 5   HOH HOH A . 
E 5 HOH 42 542 70  HOH HOH A . 
E 5 HOH 43 543 68  HOH HOH A . 
E 5 HOH 44 544 28  HOH HOH A . 
E 5 HOH 45 545 98  HOH HOH A . 
E 5 HOH 46 546 34  HOH HOH A . 
E 5 HOH 47 547 44  HOH HOH A . 
E 5 HOH 48 548 103 HOH HOH A . 
E 5 HOH 49 549 73  HOH HOH A . 
E 5 HOH 50 550 10  HOH HOH A . 
E 5 HOH 51 551 47  HOH HOH A . 
E 5 HOH 52 552 14  HOH HOH A . 
E 5 HOH 53 553 43  HOH HOH A . 
E 5 HOH 54 554 49  HOH HOH A . 
E 5 HOH 55 555 66  HOH HOH A . 
E 5 HOH 56 556 96  HOH HOH A . 
E 5 HOH 57 557 93  HOH HOH A . 
E 5 HOH 58 558 1   HOH HOH A . 
E 5 HOH 59 559 102 HOH HOH A . 
E 5 HOH 60 560 54  HOH HOH A . 
E 5 HOH 61 561 4   HOH HOH A . 
E 5 HOH 62 562 53  HOH HOH A . 
E 5 HOH 63 563 88  HOH HOH A . 
E 5 HOH 64 564 63  HOH HOH A . 
E 5 HOH 65 565 104 HOH HOH A . 
E 5 HOH 66 566 46  HOH HOH A . 
E 5 HOH 67 567 21  HOH HOH A . 
E 5 HOH 68 568 11  HOH HOH A . 
E 5 HOH 69 569 99  HOH HOH A . 
E 5 HOH 70 570 77  HOH HOH A . 
E 5 HOH 71 571 13  HOH HOH A . 
E 5 HOH 72 572 78  HOH HOH A . 
E 5 HOH 73 573 15  HOH HOH A . 
E 5 HOH 74 574 71  HOH HOH A . 
E 5 HOH 75 575 101 HOH HOH A . 
E 5 HOH 76 576 19  HOH HOH A . 
E 5 HOH 77 577 33  HOH HOH A . 
E 5 HOH 78 578 32  HOH HOH A . 
E 5 HOH 79 579 58  HOH HOH A . 
E 5 HOH 80 580 106 HOH HOH A . 
E 5 HOH 81 581 51  HOH HOH A . 
E 5 HOH 82 582 100 HOH HOH A . 
E 5 HOH 83 583 76  HOH HOH A . 
F 5 HOH 1  101 85  HOH HOH D . 
F 5 HOH 2  102 60  HOH HOH D . 
F 5 HOH 3  103 74  HOH HOH D . 
F 5 HOH 4  104 67  HOH HOH D . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A PRO 33  ? CG  ? A PRO 33  CG  
2  1 Y 1 A PRO 33  ? CD  ? A PRO 33  CD  
3  1 Y 1 A LEU 34  ? CG  ? A LEU 34  CG  
4  1 Y 1 A LEU 34  ? CD1 ? A LEU 34  CD1 
5  1 Y 1 A LEU 34  ? CD2 ? A LEU 34  CD2 
6  1 Y 1 A GLU 35  ? CG  ? A GLU 35  CG  
7  1 Y 1 A GLU 35  ? CD  ? A GLU 35  CD  
8  1 Y 1 A GLU 35  ? OE1 ? A GLU 35  OE1 
9  1 Y 1 A GLU 35  ? OE2 ? A GLU 35  OE2 
10 1 Y 1 A GLN 39  ? CD  ? A GLN 39  CD  
11 1 Y 1 A GLN 39  ? OE1 ? A GLN 39  OE1 
12 1 Y 1 A GLN 39  ? NE2 ? A GLN 39  NE2 
13 1 Y 1 A LEU 43  ? CD2 ? A LEU 43  CD2 
14 1 Y 1 A PHE 49  ? CG  ? A PHE 49  CG  
15 1 Y 1 A PHE 49  ? CD1 ? A PHE 49  CD1 
16 1 Y 1 A PHE 49  ? CD2 ? A PHE 49  CD2 
17 1 Y 1 A PHE 49  ? CE1 ? A PHE 49  CE1 
18 1 Y 1 A PHE 49  ? CE2 ? A PHE 49  CE2 
19 1 Y 1 A PHE 49  ? CZ  ? A PHE 49  CZ  
20 1 Y 1 A ILE 56  ? CG2 ? A ILE 56  CG2 
21 1 Y 1 A ILE 56  ? CD1 ? A ILE 56  CD1 
22 1 Y 1 A VAL 58  ? CG1 ? A VAL 58  CG1 
23 1 Y 1 A SER 59  ? OG  ? A SER 59  OG  
24 1 Y 1 A ASN 61  ? ND2 ? A ASN 61  ND2 
25 1 Y 1 A LEU 62  ? CD2 ? A LEU 62  CD2 
26 1 Y 1 A GLU 70  ? OE2 ? A GLU 70  OE2 
27 1 Y 1 A ASP 72  ? OD1 ? A ASP 72  OD1 
28 1 Y 1 A ARG 73  ? CD  ? A ARG 73  CD  
29 1 Y 1 A ARG 73  ? NE  ? A ARG 73  NE  
30 1 Y 1 A ARG 73  ? CZ  ? A ARG 73  CZ  
31 1 Y 1 A ARG 73  ? NH1 ? A ARG 73  NH1 
32 1 Y 1 A ARG 73  ? NH2 ? A ARG 73  NH2 
33 1 Y 1 A SER 75  ? OG  ? A SER 75  OG  
34 1 Y 1 A ASP 76  ? OD1 ? A ASP 76  OD1 
35 1 Y 1 A ASP 76  ? OD2 ? A ASP 76  OD2 
36 1 Y 1 A GLU 79  ? CG  ? A GLU 79  CG  
37 1 Y 1 A GLU 79  ? CD  ? A GLU 79  CD  
38 1 Y 1 A GLU 79  ? OE1 ? A GLU 79  OE1 
39 1 Y 1 A GLU 79  ? OE2 ? A GLU 79  OE2 
40 1 Y 1 A LEU 80  ? CG  ? A LEU 80  CG  
41 1 Y 1 A LEU 80  ? CD1 ? A LEU 80  CD1 
42 1 Y 1 A LEU 80  ? CD2 ? A LEU 80  CD2 
43 1 Y 1 A PRO 81  ? CG  ? A PRO 81  CG  
44 1 Y 1 A PRO 81  ? CD  ? A PRO 81  CD  
45 1 Y 1 A ASN 82  ? CG  ? A ASN 82  CG  
46 1 Y 1 A ASN 82  ? OD1 ? A ASN 82  OD1 
47 1 Y 1 A ASN 82  ? ND2 ? A ASN 82  ND2 
48 1 Y 1 A THR 84  ? OG1 ? A THR 84  OG1 
49 1 Y 1 A THR 84  ? CG2 ? A THR 84  CG2 
50 1 Y 1 A ARG 85  ? CG  ? A ARG 85  CG  
51 1 Y 1 A ARG 85  ? CD  ? A ARG 85  CD  
52 1 Y 1 A ARG 85  ? NE  ? A ARG 85  NE  
53 1 Y 1 A ARG 85  ? CZ  ? A ARG 85  CZ  
54 1 Y 1 A ARG 85  ? NH1 ? A ARG 85  NH1 
55 1 Y 1 A ARG 85  ? NH2 ? A ARG 85  NH2 
56 1 Y 1 A LYS 94  ? CE  ? A LYS 94  CE  
57 1 Y 1 A LYS 94  ? NZ  ? A LYS 94  NZ  
58 1 Y 1 A SER 101 ? OG  ? A SER 101 OG  
59 1 Y 1 A ARG 105 ? CZ  ? A ARG 105 CZ  
60 1 Y 1 A ARG 105 ? NH1 ? A ARG 105 NH1 
61 1 Y 1 A ARG 105 ? NH2 ? A ARG 105 NH2 
62 1 Y 1 A LEU 107 ? CD1 ? A LEU 107 CD1 
63 1 Y 1 A PHE 110 ? CE1 ? A PHE 110 CE1 
64 1 Y 1 A PHE 110 ? CE2 ? A PHE 110 CE2 
65 1 Y 1 A PHE 110 ? CZ  ? A PHE 110 CZ  
66 1 Y 1 A ASP 114 ? OD1 ? A ASP 114 OD1 
67 1 Y 1 A ASP 114 ? OD2 ? A ASP 114 OD2 
68 1 Y 1 A GLU 124 ? OE1 ? A GLU 124 OE1 
69 1 Y 1 A VAL 126 ? CG1 ? A VAL 126 CG1 
70 1 Y 1 A ARG 179 ? NH1 ? A ARG 179 NH1 
71 1 Y 1 A LEU 184 ? CD2 ? A LEU 184 CD2 
72 1 Y 1 A ASP 202 ? OD1 ? A ASP 202 OD1 
73 1 Y 1 A ASP 202 ? OD2 ? A ASP 202 OD2 
74 1 Y 1 A ARG 214 ? NH1 ? A ARG 214 NH1 
75 1 Y 1 A ARG 214 ? NH2 ? A ARG 214 NH2 
76 1 Y 1 A GLU 246 ? OE1 ? A GLU 246 OE1 
77 1 Y 1 A GLN 252 ? OE1 ? A GLN 252 OE1 
78 1 Y 1 A GLN 252 ? NE2 ? A GLN 252 NE2 
79 1 Y 1 A GLU 262 ? OE1 ? A GLU 262 OE1 
80 1 Y 1 A GLU 262 ? OE2 ? A GLU 262 OE2 
81 1 Y 1 A ARG 274 ? CD  ? A ARG 274 CD  
82 1 Y 1 A ARG 274 ? NE  ? A ARG 274 NE  
83 1 Y 1 A ARG 274 ? CZ  ? A ARG 274 CZ  
84 1 Y 1 A ARG 274 ? NH1 ? A ARG 274 NH1 
85 1 Y 1 A ARG 274 ? NH2 ? A ARG 274 NH2 
86 1 Y 1 A GLN 297 ? CG  ? A GLN 297 CG  
87 1 Y 1 A GLN 297 ? CD  ? A GLN 297 CD  
88 1 Y 1 A GLN 297 ? OE1 ? A GLN 297 OE1 
89 1 Y 1 A GLN 297 ? NE2 ? A GLN 297 NE2 
90 1 Y 1 A GLU 301 ? OE1 ? A GLU 301 OE1 
91 1 Y 1 A GLU 301 ? OE2 ? A GLU 301 OE2 
92 1 Y 1 D LYS 3   ? CD  ? B LYS 3   CD  
93 1 Y 1 D LYS 3   ? CE  ? B LYS 3   CE  
94 1 Y 1 D LYS 3   ? NZ  ? B LYS 3   NZ  
95 1 Y 1 D ARG 5   ? NE  ? B ARG 5   NE  
96 1 Y 1 D ARG 5   ? CZ  ? B ARG 5   CZ  
97 1 Y 1 D ARG 5   ? NH1 ? B ARG 5   NH1 
98 1 Y 1 D ARG 5   ? NH2 ? B ARG 5   NH2 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot   ? ? ? 0.7.1     2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? 1.02      3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? 1.02      4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .         5 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? .         6 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7QB2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     97.785 
_cell.length_a_esd                 ? 
_cell.length_b                     97.785 
_cell.length_b_esd                 ? 
_cell.length_c                     80.188 
_cell.length_c_esd                 ? 
_cell.volume                       664025.096 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7QB2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            'P 65' 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7QB2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.1 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.5 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM bis-tris propane (pH 7.0), 10% ethylene glycol, 0.3% DMSO, 20% PEG3350, 200 mM MgOAc' 
_exptl_crystal_grow.pdbx_pH_range   '6.8 - 7.2' 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      'Sagitally bended Si111-crystal' 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2021-03-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Double crystal' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9184 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9184 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_synchrotron_site       BESSY 
# 
_reflns.B_iso_Wilson_estimate                          39.56 
_reflns.entry_id                                       7QB2 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.53 
_reflns.d_resolution_low                               48.893 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     14667 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           99.9 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                11.3 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                0.08 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          28.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   1.0 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    2.53 
_reflns_shell.d_res_low                                     2.68 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           5.38 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             2355 
_reflns_shell.percent_possible_all                          99.4 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               11.68 
_reflns_shell.pdbx_Rsym_value                               0.526 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.959 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               42.50 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7QB2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.53 
_refine.ls_d_res_low                             48.89 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14662 
_refine.ls_number_reflns_R_free                  734 
_refine.ls_number_reflns_R_work                  13928 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.85 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1593 
_refine.ls_R_factor_R_free                       0.2019 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1571 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.38 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5NDT 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 20.0239 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2101 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.53 
_refine_hist.d_res_low                        48.89 
_refine_hist.number_atoms_solvent             87 
_refine_hist.number_atoms_total               2314 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        2199 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0072  ? 2285 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.8045  ? 3096 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0537  ? 328  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0059  ? 420  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 19.8172 ? 1352 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.53 2.72  . . 145 2747 99.42  . . . 0.2462 . 0.1752 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.72 3.00  . . 146 2767 99.97  . . . 0.1965 . 0.1645 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.00 3.43  . . 146 2786 100.00 . . . 0.2191 . 0.1559 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.43 4.32  . . 147 2790 99.97  . . . 0.1729 . 0.1440 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.32 48.89 . . 150 2838 99.90  . . . 0.2081 . 0.1615 . . . . . . . . . . . 
# 
_struct.entry_id                     7QB2 
_struct.title                        
'Pim1 in complex with (E)-4-((6-amino-1-methyl-2-oxoindolin-3-ylidene)methyl)benzoic acid and Pimtide' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7QB2 
_struct_keywords.text            
;SERINE KINASE, KINASE, COMPLEX, PIM1, PIM, PIM-1, INHIBITOR, TUMORIGENISIS, CANCER, PIMTIDE, PROTO ONCOGEN, ATP, PHOSPHORYLATION, APOPTOSIS, CELL CYCLE, TRANSFERASE
;
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PIM1_HUMAN P11309 ? 1 
;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL
PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN
CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
;
1 
2 PDB 7QB2       7QB2   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7QB2 A 1 ? 312 ? P11309 1 ? 312 ? 1 312 
2 2 7QB2 D 1 ? 14  ? 7QB2   1 ? 14  ? 1 14  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             7QB2 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      250 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P11309 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          250 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            250 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1360  ? 
1 MORE         3     ? 
1 'SSA (A^2)'  12920 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 72  ? ILE A 74  ? ASP A 72  ILE A 74  5 ? 3  
HELX_P HELX_P2  AA2 MET A 88  ? SER A 97  ? MET A 88  SER A 97  1 ? 10 
HELX_P HELX_P3  AA3 LEU A 129 ? GLY A 137 ? LEU A 129 GLY A 137 1 ? 9  
HELX_P HELX_P4  AA4 GLN A 140 ? CYS A 161 ? GLN A 140 CYS A 161 1 ? 22 
HELX_P HELX_P5  AA5 LYS A 169 ? GLU A 171 ? LYS A 169 GLU A 171 5 ? 3  
HELX_P HELX_P6  AA6 THR A 204 ? SER A 208 ? THR A 204 SER A 208 5 ? 5  
HELX_P HELX_P7  AA7 PRO A 209 ? HIS A 216 ? PRO A 209 HIS A 216 1 ? 8  
HELX_P HELX_P8  AA8 HIS A 219 ? GLY A 238 ? HIS A 219 GLY A 238 1 ? 20 
HELX_P HELX_P9  AA9 HIS A 244 ? GLY A 251 ? HIS A 244 GLY A 251 1 ? 8  
HELX_P HELX_P10 AB1 SER A 260 ? LEU A 271 ? SER A 260 LEU A 271 1 ? 12 
HELX_P HELX_P11 AB2 ARG A 274 ? ARG A 278 ? ARG A 274 ARG A 278 5 ? 5  
HELX_P HELX_P12 AB3 THR A 280 ? ASN A 286 ? THR A 280 ASN A 286 1 ? 7  
HELX_P HELX_P13 AB4 HIS A 287 ? GLN A 291 ? HIS A 287 GLN A 291 5 ? 5  
HELX_P HELX_P14 AB5 LEU A 295 ? LEU A 304 ? LEU A 295 LEU A 304 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A SER 260 C ? ? ? 1_555 A SEP 261 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale2 covale both ? A SEP 261 C ? ? ? 1_555 A GLU 262 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      SEP 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       261 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     . 
_pdbx_modification_feature.modified_residue_label_asym_id     . 
_pdbx_modification_feature.modified_residue_label_seq_id      . 
_pdbx_modification_feature.modified_residue_label_alt_id      . 
_pdbx_modification_feature.auth_comp_id                       SEP 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        261 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      . 
_pdbx_modification_feature.modified_residue_auth_asym_id      . 
_pdbx_modification_feature.modified_residue_auth_seq_id       . 
_pdbx_modification_feature.modified_residue_PDB_ins_code      . 
_pdbx_modification_feature.modified_residue_symmetry          . 
_pdbx_modification_feature.comp_id_linking_atom               . 
_pdbx_modification_feature.modified_residue_id_linking_atom   . 
_pdbx_modification_feature.modified_residue_id                SER 
_pdbx_modification_feature.ref_pcm_id                         1 
_pdbx_modification_feature.ref_comp_id                        SEP 
_pdbx_modification_feature.type                               Phosphorylation 
_pdbx_modification_feature.category                           'Named protein modification' 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           124 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            124 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    125 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     125 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.19 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 38  ? LEU A 43  ? TYR A 38  LEU A 43  
AA1 2 SER A 51  ? ARG A 57  ? SER A 51  ARG A 57  
AA1 3 PRO A 63  ? GLU A 70  ? PRO A 63  GLU A 70  
AA1 4 SER A 115 ? GLU A 121 ? SER A 115 GLU A 121 
AA1 5 LEU A 106 ? GLU A 111 ? LEU A 106 GLU A 111 
AA2 1 TRP A 77  ? GLU A 79  ? TRP A 77  GLU A 79  
AA2 2 ARG A 85  ? PRO A 87  ? ARG A 85  PRO A 87  
AA3 1 VAL A 126 ? ASP A 128 ? VAL A 126 ASP A 128 
AA3 2 ILE A 173 ? ASP A 176 ? ILE A 173 ASP A 176 
AA3 3 GLU A 181 ? LEU A 184 ? GLU A 181 LEU A 184 
AA4 1 VAL A 163 ? LEU A 164 ? VAL A 163 LEU A 164 
AA4 2 ALA A 191 ? LEU A 192 ? ALA A 191 LEU A 192 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY A 41  ? N GLY A 41  O SER A 54  ? O SER A 54  
AA1 2 3 N TYR A 53  ? N TYR A 53  O ILE A 66  ? O ILE A 66  
AA1 3 4 N ALA A 65  ? N ALA A 65  O LEU A 120 ? O LEU A 120 
AA1 4 5 O ILE A 119 ? O ILE A 119 N LEU A 107 ? N LEU A 107 
AA2 1 2 N GLY A 78  ? N GLY A 78  O VAL A 86  ? O VAL A 86  
AA3 1 2 N GLN A 127 ? N GLN A 127 O ILE A 175 ? O ILE A 175 
AA3 2 3 N ASP A 176 ? N ASP A 176 O GLU A 181 ? O GLU A 181 
AA4 1 2 N LEU A 164 ? N LEU A 164 O ALA A 191 ? O ALA A 191 
# 
_pdbx_entry_details.entry_id                   7QB2 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.has_ligand_of_interest     Y 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 34  ? ? -130.99 -59.84  
2 1 PHE A 49  ? ? -75.61  25.62   
3 1 ASP A 60  ? ? -147.57 21.40   
4 1 ASN A 82  ? ? -67.63  7.89    
5 1 SER A 98  ? ? 174.77  -179.63 
6 1 ASP A 108 ? ? 178.73  164.28  
7 1 ASP A 167 ? ? -140.07 43.99   
8 1 ASP A 186 ? ? 53.43   82.50   
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     261 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      261 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z         
2 x-y,x,z+5/6   
3 y,-x+y,z+1/6  
4 -y,x-y,z+2/3  
5 -x+y,-x,z+1/3 
6 -x,-y,z+1/2   
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined -36.8303545303 3.23439589139  -2.19848002847 0.544861077235 ? 0.081257813476   ? 0.00240493050425 
? 0.327933380863 ? 0.0494431580933  ? 0.424703071986 ? 0.3899340995    ? 0.575903428941  ? 0.11641438261   ? 1.10536236449   ? 
0.428638295424  ? 1.4367459478    ? -0.302962219862 ? -0.0754445142314 ? 0.152123438613   ? -0.535957883895 ? 0.311920554527   ? 
-0.114193285856  ? -0.612748379249  ? 0.255487101876   ? 0.0256666821291    ? 
2 'X-RAY DIFFRACTION' ? refined -43.1139424613 -3.59311773917 2.88062262852  0.335085128523 ? 0.04150657116    ? 0.00626153280356 
? 0.242093502571 ? 0.0056093381777  ? 0.283442361847 ? 0.167446072355  ? 0.183417279647  ? 0.363632621736  ? 0.807002748885  ? 
0.381030514069  ? 0.918885165261  ? 0.0476110931684 ? -0.0144369317641 ? 0.314509602997   ? 0.141759466481  ? 0.209828216027   ? 
0.317320981436   ? -0.536157836605  ? -0.342304170503  ? 0.0405258278212    ? 
3 'X-RAY DIFFRACTION' ? refined -39.080579739  -20.9246540694 6.80590625764  0.279513102312 ? 0.0219372303457  ? -0.0291101062731 
? 0.257410851398 ? 0.00243671849689 ? 0.277280187421 ? 0.834318102142  ? 0.0959034775249 ? -0.527178560269 ? 1.24406931079   ? 
0.0230770577606 ? 2.25534331067   ? 0.0391127285014 ? 0.0197940467214  ? 0.00311396305971 ? 0.0879836388718 ? -0.0164157829317 ? 
-0.0598319588558 ? 0.206717517677   ? 0.00242252822874 ? -3.24615959097e-05 ? 
4 'X-RAY DIFFRACTION' ? refined -35.7837519333 -11.0825483216 19.1579468576  0.47817402046  ? -0.0157455308812 ? -0.0104482071118 
? 0.402861455947 ? -0.097247440433  ? 0.403675421631 ? 0.0184144385456 ? 0.0114733886275 ? 0.0184031287019 ? 0.0121753374344 ? 
0.0139484314012 ? 0.0149862664163 ? -0.095305930835 ? -0.254295414414  ? -0.0430957327346 ? 0.130594383702  ? 0.205815491809   ? 
-0.129215462363  ? -0.0516819885232 ? 0.247547809544   ? -0.000124019878686 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_PDB_ins_code 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_PDB_ins_code 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 33 through 96 )
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 97 through 140 )
;
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 141 through 305 )
;
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 2 through 9 )
;
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LEU 2   ? A LEU 2   
3  1 Y 1 A LEU 3   ? A LEU 3   
4  1 Y 1 A SER 4   ? A SER 4   
5  1 Y 1 A LYS 5   ? A LYS 5   
6  1 Y 1 A ILE 6   ? A ILE 6   
7  1 Y 1 A ASN 7   ? A ASN 7   
8  1 Y 1 A SER 8   ? A SER 8   
9  1 Y 1 A LEU 9   ? A LEU 9   
10 1 Y 1 A ALA 10  ? A ALA 10  
11 1 Y 1 A HIS 11  ? A HIS 11  
12 1 Y 1 A LEU 12  ? A LEU 12  
13 1 Y 1 A ARG 13  ? A ARG 13  
14 1 Y 1 A ALA 14  ? A ALA 14  
15 1 Y 1 A ALA 15  ? A ALA 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A CYS 17  ? A CYS 17  
18 1 Y 1 A ASN 18  ? A ASN 18  
19 1 Y 1 A ASP 19  ? A ASP 19  
20 1 Y 1 A LEU 20  ? A LEU 20  
21 1 Y 1 A HIS 21  ? A HIS 21  
22 1 Y 1 A ALA 22  ? A ALA 22  
23 1 Y 1 A THR 23  ? A THR 23  
24 1 Y 1 A LYS 24  ? A LYS 24  
25 1 Y 1 A LEU 25  ? A LEU 25  
26 1 Y 1 A ALA 26  ? A ALA 26  
27 1 Y 1 A PRO 27  ? A PRO 27  
28 1 Y 1 A GLY 28  ? A GLY 28  
29 1 Y 1 A LYS 29  ? A LYS 29  
30 1 Y 1 A GLU 30  ? A GLU 30  
31 1 Y 1 A LYS 31  ? A LYS 31  
32 1 Y 1 A GLU 32  ? A GLU 32  
33 1 Y 1 A SER 306 ? A SER 306 
34 1 Y 1 A LEU 307 ? A LEU 307 
35 1 Y 1 A SER 308 ? A SER 308 
36 1 Y 1 A PRO 309 ? A PRO 309 
37 1 Y 1 A GLY 310 ? A GLY 310 
38 1 Y 1 A PRO 311 ? A PRO 311 
39 1 Y 1 A SER 312 ? A SER 312 
40 1 Y 1 D ALA 1   ? B ALA 1   
41 1 Y 1 D GLY 10  ? B GLY 10  
42 1 Y 1 D PRO 11  ? B PRO 11  
43 1 Y 1 D PRO 12  ? B PRO 12  
44 1 Y 1 D THR 13  ? B THR 13  
45 1 Y 1 D ALA 14  ? B ALA 14  
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
A7X C10  C Y N 1   
A7X C12  C Y N 2   
A7X C15  C Y N 3   
A7X C16  C Y N 4   
A7X C14  C N N 5   
A7X C13  C Y N 6   
A7X N    N N N 7   
A7X C    C N N 8   
A7X O    O N N 9   
A7X C1   C N N 10  
A7X C11  C Y N 11  
A7X C2   C N N 12  
A7X C3   C Y N 13  
A7X C4   C Y N 14  
A7X C5   C Y N 15  
A7X C6   C Y N 16  
A7X C7   C Y N 17  
A7X C8   C Y N 18  
A7X C9   C N N 19  
A7X N1   N N N 20  
A7X O1   O N N 21  
A7X O2   O N N 22  
A7X H1   H N N 23  
A7X H2   H N N 24  
A7X H3   H N N 25  
A7X H4   H N N 26  
A7X H5   H N N 27  
A7X H6   H N N 28  
A7X H7   H N N 29  
A7X H8   H N N 30  
A7X H9   H N N 31  
A7X H10  H N N 32  
A7X H11  H N N 33  
A7X H12  H N N 34  
A7X H13  H N N 35  
A7X H14  H N N 36  
ALA N    N N N 37  
ALA CA   C N S 38  
ALA C    C N N 39  
ALA O    O N N 40  
ALA CB   C N N 41  
ALA OXT  O N N 42  
ALA H    H N N 43  
ALA H2   H N N 44  
ALA HA   H N N 45  
ALA HB1  H N N 46  
ALA HB2  H N N 47  
ALA HB3  H N N 48  
ALA HXT  H N N 49  
ARG N    N N N 50  
ARG CA   C N S 51  
ARG C    C N N 52  
ARG O    O N N 53  
ARG CB   C N N 54  
ARG CG   C N N 55  
ARG CD   C N N 56  
ARG NE   N N N 57  
ARG CZ   C N N 58  
ARG NH1  N N N 59  
ARG NH2  N N N 60  
ARG OXT  O N N 61  
ARG H    H N N 62  
ARG H2   H N N 63  
ARG HA   H N N 64  
ARG HB2  H N N 65  
ARG HB3  H N N 66  
ARG HG2  H N N 67  
ARG HG3  H N N 68  
ARG HD2  H N N 69  
ARG HD3  H N N 70  
ARG HE   H N N 71  
ARG HH11 H N N 72  
ARG HH12 H N N 73  
ARG HH21 H N N 74  
ARG HH22 H N N 75  
ARG HXT  H N N 76  
ASN N    N N N 77  
ASN CA   C N S 78  
ASN C    C N N 79  
ASN O    O N N 80  
ASN CB   C N N 81  
ASN CG   C N N 82  
ASN OD1  O N N 83  
ASN ND2  N N N 84  
ASN OXT  O N N 85  
ASN H    H N N 86  
ASN H2   H N N 87  
ASN HA   H N N 88  
ASN HB2  H N N 89  
ASN HB3  H N N 90  
ASN HD21 H N N 91  
ASN HD22 H N N 92  
ASN HXT  H N N 93  
ASP N    N N N 94  
ASP CA   C N S 95  
ASP C    C N N 96  
ASP O    O N N 97  
ASP CB   C N N 98  
ASP CG   C N N 99  
ASP OD1  O N N 100 
ASP OD2  O N N 101 
ASP OXT  O N N 102 
ASP H    H N N 103 
ASP H2   H N N 104 
ASP HA   H N N 105 
ASP HB2  H N N 106 
ASP HB3  H N N 107 
ASP HD2  H N N 108 
ASP HXT  H N N 109 
CYS N    N N N 110 
CYS CA   C N R 111 
CYS C    C N N 112 
CYS O    O N N 113 
CYS CB   C N N 114 
CYS SG   S N N 115 
CYS OXT  O N N 116 
CYS H    H N N 117 
CYS H2   H N N 118 
CYS HA   H N N 119 
CYS HB2  H N N 120 
CYS HB3  H N N 121 
CYS HG   H N N 122 
CYS HXT  H N N 123 
GLN N    N N N 124 
GLN CA   C N S 125 
GLN C    C N N 126 
GLN O    O N N 127 
GLN CB   C N N 128 
GLN CG   C N N 129 
GLN CD   C N N 130 
GLN OE1  O N N 131 
GLN NE2  N N N 132 
GLN OXT  O N N 133 
GLN H    H N N 134 
GLN H2   H N N 135 
GLN HA   H N N 136 
GLN HB2  H N N 137 
GLN HB3  H N N 138 
GLN HG2  H N N 139 
GLN HG3  H N N 140 
GLN HE21 H N N 141 
GLN HE22 H N N 142 
GLN HXT  H N N 143 
GLU N    N N N 144 
GLU CA   C N S 145 
GLU C    C N N 146 
GLU O    O N N 147 
GLU CB   C N N 148 
GLU CG   C N N 149 
GLU CD   C N N 150 
GLU OE1  O N N 151 
GLU OE2  O N N 152 
GLU OXT  O N N 153 
GLU H    H N N 154 
GLU H2   H N N 155 
GLU HA   H N N 156 
GLU HB2  H N N 157 
GLU HB3  H N N 158 
GLU HG2  H N N 159 
GLU HG3  H N N 160 
GLU HE2  H N N 161 
GLU HXT  H N N 162 
GLY N    N N N 163 
GLY CA   C N N 164 
GLY C    C N N 165 
GLY O    O N N 166 
GLY OXT  O N N 167 
GLY H    H N N 168 
GLY H2   H N N 169 
GLY HA2  H N N 170 
GLY HA3  H N N 171 
GLY HXT  H N N 172 
GOL C1   C N N 173 
GOL O1   O N N 174 
GOL C2   C N N 175 
GOL O2   O N N 176 
GOL C3   C N N 177 
GOL O3   O N N 178 
GOL H11  H N N 179 
GOL H12  H N N 180 
GOL HO1  H N N 181 
GOL H2   H N N 182 
GOL HO2  H N N 183 
GOL H31  H N N 184 
GOL H32  H N N 185 
GOL HO3  H N N 186 
HIS N    N N N 187 
HIS CA   C N S 188 
HIS C    C N N 189 
HIS O    O N N 190 
HIS CB   C N N 191 
HIS CG   C Y N 192 
HIS ND1  N Y N 193 
HIS CD2  C Y N 194 
HIS CE1  C Y N 195 
HIS NE2  N Y N 196 
HIS OXT  O N N 197 
HIS H    H N N 198 
HIS H2   H N N 199 
HIS HA   H N N 200 
HIS HB2  H N N 201 
HIS HB3  H N N 202 
HIS HD1  H N N 203 
HIS HD2  H N N 204 
HIS HE1  H N N 205 
HIS HE2  H N N 206 
HIS HXT  H N N 207 
HOH O    O N N 208 
HOH H1   H N N 209 
HOH H2   H N N 210 
ILE N    N N N 211 
ILE CA   C N S 212 
ILE C    C N N 213 
ILE O    O N N 214 
ILE CB   C N S 215 
ILE CG1  C N N 216 
ILE CG2  C N N 217 
ILE CD1  C N N 218 
ILE OXT  O N N 219 
ILE H    H N N 220 
ILE H2   H N N 221 
ILE HA   H N N 222 
ILE HB   H N N 223 
ILE HG12 H N N 224 
ILE HG13 H N N 225 
ILE HG21 H N N 226 
ILE HG22 H N N 227 
ILE HG23 H N N 228 
ILE HD11 H N N 229 
ILE HD12 H N N 230 
ILE HD13 H N N 231 
ILE HXT  H N N 232 
LEU N    N N N 233 
LEU CA   C N S 234 
LEU C    C N N 235 
LEU O    O N N 236 
LEU CB   C N N 237 
LEU CG   C N N 238 
LEU CD1  C N N 239 
LEU CD2  C N N 240 
LEU OXT  O N N 241 
LEU H    H N N 242 
LEU H2   H N N 243 
LEU HA   H N N 244 
LEU HB2  H N N 245 
LEU HB3  H N N 246 
LEU HG   H N N 247 
LEU HD11 H N N 248 
LEU HD12 H N N 249 
LEU HD13 H N N 250 
LEU HD21 H N N 251 
LEU HD22 H N N 252 
LEU HD23 H N N 253 
LEU HXT  H N N 254 
LYS N    N N N 255 
LYS CA   C N S 256 
LYS C    C N N 257 
LYS O    O N N 258 
LYS CB   C N N 259 
LYS CG   C N N 260 
LYS CD   C N N 261 
LYS CE   C N N 262 
LYS NZ   N N N 263 
LYS OXT  O N N 264 
LYS H    H N N 265 
LYS H2   H N N 266 
LYS HA   H N N 267 
LYS HB2  H N N 268 
LYS HB3  H N N 269 
LYS HG2  H N N 270 
LYS HG3  H N N 271 
LYS HD2  H N N 272 
LYS HD3  H N N 273 
LYS HE2  H N N 274 
LYS HE3  H N N 275 
LYS HZ1  H N N 276 
LYS HZ2  H N N 277 
LYS HZ3  H N N 278 
LYS HXT  H N N 279 
MET N    N N N 280 
MET CA   C N S 281 
MET C    C N N 282 
MET O    O N N 283 
MET CB   C N N 284 
MET CG   C N N 285 
MET SD   S N N 286 
MET CE   C N N 287 
MET OXT  O N N 288 
MET H    H N N 289 
MET H2   H N N 290 
MET HA   H N N 291 
MET HB2  H N N 292 
MET HB3  H N N 293 
MET HG2  H N N 294 
MET HG3  H N N 295 
MET HE1  H N N 296 
MET HE2  H N N 297 
MET HE3  H N N 298 
MET HXT  H N N 299 
PHE N    N N N 300 
PHE CA   C N S 301 
PHE C    C N N 302 
PHE O    O N N 303 
PHE CB   C N N 304 
PHE CG   C Y N 305 
PHE CD1  C Y N 306 
PHE CD2  C Y N 307 
PHE CE1  C Y N 308 
PHE CE2  C Y N 309 
PHE CZ   C Y N 310 
PHE OXT  O N N 311 
PHE H    H N N 312 
PHE H2   H N N 313 
PHE HA   H N N 314 
PHE HB2  H N N 315 
PHE HB3  H N N 316 
PHE HD1  H N N 317 
PHE HD2  H N N 318 
PHE HE1  H N N 319 
PHE HE2  H N N 320 
PHE HZ   H N N 321 
PHE HXT  H N N 322 
PRO N    N N N 323 
PRO CA   C N S 324 
PRO C    C N N 325 
PRO O    O N N 326 
PRO CB   C N N 327 
PRO CG   C N N 328 
PRO CD   C N N 329 
PRO OXT  O N N 330 
PRO H    H N N 331 
PRO HA   H N N 332 
PRO HB2  H N N 333 
PRO HB3  H N N 334 
PRO HG2  H N N 335 
PRO HG3  H N N 336 
PRO HD2  H N N 337 
PRO HD3  H N N 338 
PRO HXT  H N N 339 
SEP N    N N N 340 
SEP CA   C N S 341 
SEP CB   C N N 342 
SEP OG   O N N 343 
SEP C    C N N 344 
SEP O    O N N 345 
SEP OXT  O N N 346 
SEP P    P N N 347 
SEP O1P  O N N 348 
SEP O2P  O N N 349 
SEP O3P  O N N 350 
SEP H    H N N 351 
SEP H2   H N N 352 
SEP HA   H N N 353 
SEP HB2  H N N 354 
SEP HB3  H N N 355 
SEP HXT  H N N 356 
SEP HOP2 H N N 357 
SEP HOP3 H N N 358 
SER N    N N N 359 
SER CA   C N S 360 
SER C    C N N 361 
SER O    O N N 362 
SER CB   C N N 363 
SER OG   O N N 364 
SER OXT  O N N 365 
SER H    H N N 366 
SER H2   H N N 367 
SER HA   H N N 368 
SER HB2  H N N 369 
SER HB3  H N N 370 
SER HG   H N N 371 
SER HXT  H N N 372 
THR N    N N N 373 
THR CA   C N S 374 
THR C    C N N 375 
THR O    O N N 376 
THR CB   C N R 377 
THR OG1  O N N 378 
THR CG2  C N N 379 
THR OXT  O N N 380 
THR H    H N N 381 
THR H2   H N N 382 
THR HA   H N N 383 
THR HB   H N N 384 
THR HG1  H N N 385 
THR HG21 H N N 386 
THR HG22 H N N 387 
THR HG23 H N N 388 
THR HXT  H N N 389 
TRP N    N N N 390 
TRP CA   C N S 391 
TRP C    C N N 392 
TRP O    O N N 393 
TRP CB   C N N 394 
TRP CG   C Y N 395 
TRP CD1  C Y N 396 
TRP CD2  C Y N 397 
TRP NE1  N Y N 398 
TRP CE2  C Y N 399 
TRP CE3  C Y N 400 
TRP CZ2  C Y N 401 
TRP CZ3  C Y N 402 
TRP CH2  C Y N 403 
TRP OXT  O N N 404 
TRP H    H N N 405 
TRP H2   H N N 406 
TRP HA   H N N 407 
TRP HB2  H N N 408 
TRP HB3  H N N 409 
TRP HD1  H N N 410 
TRP HE1  H N N 411 
TRP HE3  H N N 412 
TRP HZ2  H N N 413 
TRP HZ3  H N N 414 
TRP HH2  H N N 415 
TRP HXT  H N N 416 
TYR N    N N N 417 
TYR CA   C N S 418 
TYR C    C N N 419 
TYR O    O N N 420 
TYR CB   C N N 421 
TYR CG   C Y N 422 
TYR CD1  C Y N 423 
TYR CD2  C Y N 424 
TYR CE1  C Y N 425 
TYR CE2  C Y N 426 
TYR CZ   C Y N 427 
TYR OH   O N N 428 
TYR OXT  O N N 429 
TYR H    H N N 430 
TYR H2   H N N 431 
TYR HA   H N N 432 
TYR HB2  H N N 433 
TYR HB3  H N N 434 
TYR HD1  H N N 435 
TYR HD2  H N N 436 
TYR HE1  H N N 437 
TYR HE2  H N N 438 
TYR HH   H N N 439 
TYR HXT  H N N 440 
VAL N    N N N 441 
VAL CA   C N S 442 
VAL C    C N N 443 
VAL O    O N N 444 
VAL CB   C N N 445 
VAL CG1  C N N 446 
VAL CG2  C N N 447 
VAL OXT  O N N 448 
VAL H    H N N 449 
VAL H2   H N N 450 
VAL HA   H N N 451 
VAL HB   H N N 452 
VAL HG11 H N N 453 
VAL HG12 H N N 454 
VAL HG13 H N N 455 
VAL HG21 H N N 456 
VAL HG22 H N N 457 
VAL HG23 H N N 458 
VAL HXT  H N N 459 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
A7X O1  C14  doub N N 1   
A7X C12 C11  doub Y N 2   
A7X C12 C13  sing Y N 3   
A7X C14 O2   sing N N 4   
A7X C14 C13  sing N N 5   
A7X C11 C10  sing Y N 6   
A7X C13 C15  doub Y N 7   
A7X C10 C9   sing N N 8   
A7X C10 C16  doub Y N 9   
A7X C15 C16  sing Y N 10  
A7X C9  C2   doub N E 11  
A7X O   C    doub N N 12  
A7X C2  C    sing N N 13  
A7X C2  C3   sing N N 14  
A7X C   N    sing N N 15  
A7X C3  C8   doub Y N 16  
A7X C3  C4   sing Y N 17  
A7X C8  C7   sing Y N 18  
A7X N   C4   sing N N 19  
A7X N   C1   sing N N 20  
A7X C4  C5   doub Y N 21  
A7X C7  C6   doub Y N 22  
A7X C5  C6   sing Y N 23  
A7X C6  N1   sing N N 24  
A7X C12 H1   sing N N 25  
A7X C15 H2   sing N N 26  
A7X C16 H3   sing N N 27  
A7X C1  H4   sing N N 28  
A7X C1  H5   sing N N 29  
A7X C1  H6   sing N N 30  
A7X C11 H7   sing N N 31  
A7X C5  H8   sing N N 32  
A7X C7  H9   sing N N 33  
A7X C8  H10  sing N N 34  
A7X C9  H11  sing N N 35  
A7X N1  H12  sing N N 36  
A7X N1  H13  sing N N 37  
A7X O2  H14  sing N N 38  
ALA N   CA   sing N N 39  
ALA N   H    sing N N 40  
ALA N   H2   sing N N 41  
ALA CA  C    sing N N 42  
ALA CA  CB   sing N N 43  
ALA CA  HA   sing N N 44  
ALA C   O    doub N N 45  
ALA C   OXT  sing N N 46  
ALA CB  HB1  sing N N 47  
ALA CB  HB2  sing N N 48  
ALA CB  HB3  sing N N 49  
ALA OXT HXT  sing N N 50  
ARG N   CA   sing N N 51  
ARG N   H    sing N N 52  
ARG N   H2   sing N N 53  
ARG CA  C    sing N N 54  
ARG CA  CB   sing N N 55  
ARG CA  HA   sing N N 56  
ARG C   O    doub N N 57  
ARG C   OXT  sing N N 58  
ARG CB  CG   sing N N 59  
ARG CB  HB2  sing N N 60  
ARG CB  HB3  sing N N 61  
ARG CG  CD   sing N N 62  
ARG CG  HG2  sing N N 63  
ARG CG  HG3  sing N N 64  
ARG CD  NE   sing N N 65  
ARG CD  HD2  sing N N 66  
ARG CD  HD3  sing N N 67  
ARG NE  CZ   sing N N 68  
ARG NE  HE   sing N N 69  
ARG CZ  NH1  sing N N 70  
ARG CZ  NH2  doub N N 71  
ARG NH1 HH11 sing N N 72  
ARG NH1 HH12 sing N N 73  
ARG NH2 HH21 sing N N 74  
ARG NH2 HH22 sing N N 75  
ARG OXT HXT  sing N N 76  
ASN N   CA   sing N N 77  
ASN N   H    sing N N 78  
ASN N   H2   sing N N 79  
ASN CA  C    sing N N 80  
ASN CA  CB   sing N N 81  
ASN CA  HA   sing N N 82  
ASN C   O    doub N N 83  
ASN C   OXT  sing N N 84  
ASN CB  CG   sing N N 85  
ASN CB  HB2  sing N N 86  
ASN CB  HB3  sing N N 87  
ASN CG  OD1  doub N N 88  
ASN CG  ND2  sing N N 89  
ASN ND2 HD21 sing N N 90  
ASN ND2 HD22 sing N N 91  
ASN OXT HXT  sing N N 92  
ASP N   CA   sing N N 93  
ASP N   H    sing N N 94  
ASP N   H2   sing N N 95  
ASP CA  C    sing N N 96  
ASP CA  CB   sing N N 97  
ASP CA  HA   sing N N 98  
ASP C   O    doub N N 99  
ASP C   OXT  sing N N 100 
ASP CB  CG   sing N N 101 
ASP CB  HB2  sing N N 102 
ASP CB  HB3  sing N N 103 
ASP CG  OD1  doub N N 104 
ASP CG  OD2  sing N N 105 
ASP OD2 HD2  sing N N 106 
ASP OXT HXT  sing N N 107 
CYS N   CA   sing N N 108 
CYS N   H    sing N N 109 
CYS N   H2   sing N N 110 
CYS CA  C    sing N N 111 
CYS CA  CB   sing N N 112 
CYS CA  HA   sing N N 113 
CYS C   O    doub N N 114 
CYS C   OXT  sing N N 115 
CYS CB  SG   sing N N 116 
CYS CB  HB2  sing N N 117 
CYS CB  HB3  sing N N 118 
CYS SG  HG   sing N N 119 
CYS OXT HXT  sing N N 120 
GLN N   CA   sing N N 121 
GLN N   H    sing N N 122 
GLN N   H2   sing N N 123 
GLN CA  C    sing N N 124 
GLN CA  CB   sing N N 125 
GLN CA  HA   sing N N 126 
GLN C   O    doub N N 127 
GLN C   OXT  sing N N 128 
GLN CB  CG   sing N N 129 
GLN CB  HB2  sing N N 130 
GLN CB  HB3  sing N N 131 
GLN CG  CD   sing N N 132 
GLN CG  HG2  sing N N 133 
GLN CG  HG3  sing N N 134 
GLN CD  OE1  doub N N 135 
GLN CD  NE2  sing N N 136 
GLN NE2 HE21 sing N N 137 
GLN NE2 HE22 sing N N 138 
GLN OXT HXT  sing N N 139 
GLU N   CA   sing N N 140 
GLU N   H    sing N N 141 
GLU N   H2   sing N N 142 
GLU CA  C    sing N N 143 
GLU CA  CB   sing N N 144 
GLU CA  HA   sing N N 145 
GLU C   O    doub N N 146 
GLU C   OXT  sing N N 147 
GLU CB  CG   sing N N 148 
GLU CB  HB2  sing N N 149 
GLU CB  HB3  sing N N 150 
GLU CG  CD   sing N N 151 
GLU CG  HG2  sing N N 152 
GLU CG  HG3  sing N N 153 
GLU CD  OE1  doub N N 154 
GLU CD  OE2  sing N N 155 
GLU OE2 HE2  sing N N 156 
GLU OXT HXT  sing N N 157 
GLY N   CA   sing N N 158 
GLY N   H    sing N N 159 
GLY N   H2   sing N N 160 
GLY CA  C    sing N N 161 
GLY CA  HA2  sing N N 162 
GLY CA  HA3  sing N N 163 
GLY C   O    doub N N 164 
GLY C   OXT  sing N N 165 
GLY OXT HXT  sing N N 166 
GOL C1  O1   sing N N 167 
GOL C1  C2   sing N N 168 
GOL C1  H11  sing N N 169 
GOL C1  H12  sing N N 170 
GOL O1  HO1  sing N N 171 
GOL C2  O2   sing N N 172 
GOL C2  C3   sing N N 173 
GOL C2  H2   sing N N 174 
GOL O2  HO2  sing N N 175 
GOL C3  O3   sing N N 176 
GOL C3  H31  sing N N 177 
GOL C3  H32  sing N N 178 
GOL O3  HO3  sing N N 179 
HIS N   CA   sing N N 180 
HIS N   H    sing N N 181 
HIS N   H2   sing N N 182 
HIS CA  C    sing N N 183 
HIS CA  CB   sing N N 184 
HIS CA  HA   sing N N 185 
HIS C   O    doub N N 186 
HIS C   OXT  sing N N 187 
HIS CB  CG   sing N N 188 
HIS CB  HB2  sing N N 189 
HIS CB  HB3  sing N N 190 
HIS CG  ND1  sing Y N 191 
HIS CG  CD2  doub Y N 192 
HIS ND1 CE1  doub Y N 193 
HIS ND1 HD1  sing N N 194 
HIS CD2 NE2  sing Y N 195 
HIS CD2 HD2  sing N N 196 
HIS CE1 NE2  sing Y N 197 
HIS CE1 HE1  sing N N 198 
HIS NE2 HE2  sing N N 199 
HIS OXT HXT  sing N N 200 
HOH O   H1   sing N N 201 
HOH O   H2   sing N N 202 
ILE N   CA   sing N N 203 
ILE N   H    sing N N 204 
ILE N   H2   sing N N 205 
ILE CA  C    sing N N 206 
ILE CA  CB   sing N N 207 
ILE CA  HA   sing N N 208 
ILE C   O    doub N N 209 
ILE C   OXT  sing N N 210 
ILE CB  CG1  sing N N 211 
ILE CB  CG2  sing N N 212 
ILE CB  HB   sing N N 213 
ILE CG1 CD1  sing N N 214 
ILE CG1 HG12 sing N N 215 
ILE CG1 HG13 sing N N 216 
ILE CG2 HG21 sing N N 217 
ILE CG2 HG22 sing N N 218 
ILE CG2 HG23 sing N N 219 
ILE CD1 HD11 sing N N 220 
ILE CD1 HD12 sing N N 221 
ILE CD1 HD13 sing N N 222 
ILE OXT HXT  sing N N 223 
LEU N   CA   sing N N 224 
LEU N   H    sing N N 225 
LEU N   H2   sing N N 226 
LEU CA  C    sing N N 227 
LEU CA  CB   sing N N 228 
LEU CA  HA   sing N N 229 
LEU C   O    doub N N 230 
LEU C   OXT  sing N N 231 
LEU CB  CG   sing N N 232 
LEU CB  HB2  sing N N 233 
LEU CB  HB3  sing N N 234 
LEU CG  CD1  sing N N 235 
LEU CG  CD2  sing N N 236 
LEU CG  HG   sing N N 237 
LEU CD1 HD11 sing N N 238 
LEU CD1 HD12 sing N N 239 
LEU CD1 HD13 sing N N 240 
LEU CD2 HD21 sing N N 241 
LEU CD2 HD22 sing N N 242 
LEU CD2 HD23 sing N N 243 
LEU OXT HXT  sing N N 244 
LYS N   CA   sing N N 245 
LYS N   H    sing N N 246 
LYS N   H2   sing N N 247 
LYS CA  C    sing N N 248 
LYS CA  CB   sing N N 249 
LYS CA  HA   sing N N 250 
LYS C   O    doub N N 251 
LYS C   OXT  sing N N 252 
LYS CB  CG   sing N N 253 
LYS CB  HB2  sing N N 254 
LYS CB  HB3  sing N N 255 
LYS CG  CD   sing N N 256 
LYS CG  HG2  sing N N 257 
LYS CG  HG3  sing N N 258 
LYS CD  CE   sing N N 259 
LYS CD  HD2  sing N N 260 
LYS CD  HD3  sing N N 261 
LYS CE  NZ   sing N N 262 
LYS CE  HE2  sing N N 263 
LYS CE  HE3  sing N N 264 
LYS NZ  HZ1  sing N N 265 
LYS NZ  HZ2  sing N N 266 
LYS NZ  HZ3  sing N N 267 
LYS OXT HXT  sing N N 268 
MET N   CA   sing N N 269 
MET N   H    sing N N 270 
MET N   H2   sing N N 271 
MET CA  C    sing N N 272 
MET CA  CB   sing N N 273 
MET CA  HA   sing N N 274 
MET C   O    doub N N 275 
MET C   OXT  sing N N 276 
MET CB  CG   sing N N 277 
MET CB  HB2  sing N N 278 
MET CB  HB3  sing N N 279 
MET CG  SD   sing N N 280 
MET CG  HG2  sing N N 281 
MET CG  HG3  sing N N 282 
MET SD  CE   sing N N 283 
MET CE  HE1  sing N N 284 
MET CE  HE2  sing N N 285 
MET CE  HE3  sing N N 286 
MET OXT HXT  sing N N 287 
PHE N   CA   sing N N 288 
PHE N   H    sing N N 289 
PHE N   H2   sing N N 290 
PHE CA  C    sing N N 291 
PHE CA  CB   sing N N 292 
PHE CA  HA   sing N N 293 
PHE C   O    doub N N 294 
PHE C   OXT  sing N N 295 
PHE CB  CG   sing N N 296 
PHE CB  HB2  sing N N 297 
PHE CB  HB3  sing N N 298 
PHE CG  CD1  doub Y N 299 
PHE CG  CD2  sing Y N 300 
PHE CD1 CE1  sing Y N 301 
PHE CD1 HD1  sing N N 302 
PHE CD2 CE2  doub Y N 303 
PHE CD2 HD2  sing N N 304 
PHE CE1 CZ   doub Y N 305 
PHE CE1 HE1  sing N N 306 
PHE CE2 CZ   sing Y N 307 
PHE CE2 HE2  sing N N 308 
PHE CZ  HZ   sing N N 309 
PHE OXT HXT  sing N N 310 
PRO N   CA   sing N N 311 
PRO N   CD   sing N N 312 
PRO N   H    sing N N 313 
PRO CA  C    sing N N 314 
PRO CA  CB   sing N N 315 
PRO CA  HA   sing N N 316 
PRO C   O    doub N N 317 
PRO C   OXT  sing N N 318 
PRO CB  CG   sing N N 319 
PRO CB  HB2  sing N N 320 
PRO CB  HB3  sing N N 321 
PRO CG  CD   sing N N 322 
PRO CG  HG2  sing N N 323 
PRO CG  HG3  sing N N 324 
PRO CD  HD2  sing N N 325 
PRO CD  HD3  sing N N 326 
PRO OXT HXT  sing N N 327 
SEP N   CA   sing N N 328 
SEP N   H    sing N N 329 
SEP N   H2   sing N N 330 
SEP CA  CB   sing N N 331 
SEP CA  C    sing N N 332 
SEP CA  HA   sing N N 333 
SEP CB  OG   sing N N 334 
SEP CB  HB2  sing N N 335 
SEP CB  HB3  sing N N 336 
SEP OG  P    sing N N 337 
SEP C   O    doub N N 338 
SEP C   OXT  sing N N 339 
SEP OXT HXT  sing N N 340 
SEP P   O1P  doub N N 341 
SEP P   O2P  sing N N 342 
SEP P   O3P  sing N N 343 
SEP O2P HOP2 sing N N 344 
SEP O3P HOP3 sing N N 345 
SER N   CA   sing N N 346 
SER N   H    sing N N 347 
SER N   H2   sing N N 348 
SER CA  C    sing N N 349 
SER CA  CB   sing N N 350 
SER CA  HA   sing N N 351 
SER C   O    doub N N 352 
SER C   OXT  sing N N 353 
SER CB  OG   sing N N 354 
SER CB  HB2  sing N N 355 
SER CB  HB3  sing N N 356 
SER OG  HG   sing N N 357 
SER OXT HXT  sing N N 358 
THR N   CA   sing N N 359 
THR N   H    sing N N 360 
THR N   H2   sing N N 361 
THR CA  C    sing N N 362 
THR CA  CB   sing N N 363 
THR CA  HA   sing N N 364 
THR C   O    doub N N 365 
THR C   OXT  sing N N 366 
THR CB  OG1  sing N N 367 
THR CB  CG2  sing N N 368 
THR CB  HB   sing N N 369 
THR OG1 HG1  sing N N 370 
THR CG2 HG21 sing N N 371 
THR CG2 HG22 sing N N 372 
THR CG2 HG23 sing N N 373 
THR OXT HXT  sing N N 374 
TRP N   CA   sing N N 375 
TRP N   H    sing N N 376 
TRP N   H2   sing N N 377 
TRP CA  C    sing N N 378 
TRP CA  CB   sing N N 379 
TRP CA  HA   sing N N 380 
TRP C   O    doub N N 381 
TRP C   OXT  sing N N 382 
TRP CB  CG   sing N N 383 
TRP CB  HB2  sing N N 384 
TRP CB  HB3  sing N N 385 
TRP CG  CD1  doub Y N 386 
TRP CG  CD2  sing Y N 387 
TRP CD1 NE1  sing Y N 388 
TRP CD1 HD1  sing N N 389 
TRP CD2 CE2  doub Y N 390 
TRP CD2 CE3  sing Y N 391 
TRP NE1 CE2  sing Y N 392 
TRP NE1 HE1  sing N N 393 
TRP CE2 CZ2  sing Y N 394 
TRP CE3 CZ3  doub Y N 395 
TRP CE3 HE3  sing N N 396 
TRP CZ2 CH2  doub Y N 397 
TRP CZ2 HZ2  sing N N 398 
TRP CZ3 CH2  sing Y N 399 
TRP CZ3 HZ3  sing N N 400 
TRP CH2 HH2  sing N N 401 
TRP OXT HXT  sing N N 402 
TYR N   CA   sing N N 403 
TYR N   H    sing N N 404 
TYR N   H2   sing N N 405 
TYR CA  C    sing N N 406 
TYR CA  CB   sing N N 407 
TYR CA  HA   sing N N 408 
TYR C   O    doub N N 409 
TYR C   OXT  sing N N 410 
TYR CB  CG   sing N N 411 
TYR CB  HB2  sing N N 412 
TYR CB  HB3  sing N N 413 
TYR CG  CD1  doub Y N 414 
TYR CG  CD2  sing Y N 415 
TYR CD1 CE1  sing Y N 416 
TYR CD1 HD1  sing N N 417 
TYR CD2 CE2  doub Y N 418 
TYR CD2 HD2  sing N N 419 
TYR CE1 CZ   doub Y N 420 
TYR CE1 HE1  sing N N 421 
TYR CE2 CZ   sing Y N 422 
TYR CE2 HE2  sing N N 423 
TYR CZ  OH   sing N N 424 
TYR OH  HH   sing N N 425 
TYR OXT HXT  sing N N 426 
VAL N   CA   sing N N 427 
VAL N   H    sing N N 428 
VAL N   H2   sing N N 429 
VAL CA  C    sing N N 430 
VAL CA  CB   sing N N 431 
VAL CA  HA   sing N N 432 
VAL C   O    doub N N 433 
VAL C   OXT  sing N N 434 
VAL CB  CG1  sing N N 435 
VAL CB  CG2  sing N N 436 
VAL CB  HB   sing N N 437 
VAL CG1 HG11 sing N N 438 
VAL CG1 HG12 sing N N 439 
VAL CG1 HG13 sing N N 440 
VAL CG2 HG21 sing N N 441 
VAL CG2 HG22 sing N N 442 
VAL CG2 HG23 sing N N 443 
VAL OXT HXT  sing N N 444 
# 
_pdbx_audit_support.funding_organization   'Not funded' 
_pdbx_audit_support.country                ? 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   5NDT 
_pdbx_initial_refinement_model.details          ? 
# 
_space_group.name_H-M_alt     'P 65' 
_space_group.name_Hall        'P 65' 
_space_group.IT_number        170 
_space_group.crystal_system   hexagonal 
_space_group.id               1 
# 
_atom_sites.entry_id                    7QB2 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010227 
_atom_sites.fract_transf_matrix[1][2]   0.005904 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011809 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012471 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P ? ? 9.51135 5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_