data_7QBL # _entry.id 7QBL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QBL pdb_00007qbl 10.2210/pdb7qbl/pdb WWPDB D_1292119286 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-26 2 'Structure model' 1 1 2022-02-23 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QBL _pdbx_database_status.recvd_initial_deposition_date 2021-11-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email michael.mares@uochb.cas.cz _pdbx_contact_author.name_first Michael _pdbx_contact_author.name_last Mares _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0847-5022 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Benysek, J.' 1 0000-0002-2369-0775 'Busa, M.' 2 0000-0002-4750-5992 'Mares, M.' 3 0000-0002-0847-5022 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Enzyme Inhib Med Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1475-6374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 37 _citation.language ? _citation.page_first 515 _citation.page_last 526 _citation.title ;Highly potent inhibitors of cathepsin K with a differently positioned cyanohydrazide warhead: structural analysis of binding mode to mature and zymogen-like enzymes. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1080/14756366.2021.2024527 _citation.pdbx_database_id_PubMed 35144520 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Benysek, J.' 1 ? primary 'Busa, M.' 2 ? primary 'Rubesova, P.' 3 ? primary 'Fanfrlik, J.' 4 ? primary 'Lepsik, M.' 5 ? primary 'Brynda, J.' 6 ? primary 'Matouskova, Z.' 7 ? primary 'Bartz, U.' 8 ? primary 'Horn, M.' 9 ? primary 'Gutschow, M.' 10 ? primary 'Mares, M.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cathepsin K' 23523.480 1 3.4.22.38 ? ? ? 2 non-polymer syn '~{tert}-butyl ~{N}-[iminomethyl-[2-[methyl-(phenylmethyl)amino]-2-oxidanylidene-ethyl]amino]carbamate' 320.387 1 ? ? ? ? 3 water nat water 18.015 47 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cathepsin O,Cathepsin O2,Cathepsin X' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM ; _entity_poly.pdbx_seq_one_letter_code_can ;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{tert}-butyl ~{N}-[iminomethyl-[2-[methyl-(phenylmethyl)amino]-2-oxidanylidene-ethyl]amino]carbamate' A0U 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 ASP n 1 4 SER n 1 5 VAL n 1 6 ASP n 1 7 TYR n 1 8 ARG n 1 9 LYS n 1 10 LYS n 1 11 GLY n 1 12 TYR n 1 13 VAL n 1 14 THR n 1 15 PRO n 1 16 VAL n 1 17 LYS n 1 18 ASN n 1 19 GLN n 1 20 GLY n 1 21 GLN n 1 22 CYS n 1 23 GLY n 1 24 SER n 1 25 CYS n 1 26 TRP n 1 27 ALA n 1 28 PHE n 1 29 SER n 1 30 SER n 1 31 VAL n 1 32 GLY n 1 33 ALA n 1 34 LEU n 1 35 GLU n 1 36 GLY n 1 37 GLN n 1 38 LEU n 1 39 LYS n 1 40 LYS n 1 41 LYS n 1 42 THR n 1 43 GLY n 1 44 LYS n 1 45 LEU n 1 46 LEU n 1 47 ASN n 1 48 LEU n 1 49 SER n 1 50 PRO n 1 51 GLN n 1 52 ASN n 1 53 LEU n 1 54 VAL n 1 55 ASP n 1 56 CYS n 1 57 VAL n 1 58 SER n 1 59 GLU n 1 60 ASN n 1 61 ASP n 1 62 GLY n 1 63 CYS n 1 64 GLY n 1 65 GLY n 1 66 GLY n 1 67 TYR n 1 68 MET n 1 69 THR n 1 70 ASN n 1 71 ALA n 1 72 PHE n 1 73 GLN n 1 74 TYR n 1 75 VAL n 1 76 GLN n 1 77 LYS n 1 78 ASN n 1 79 ARG n 1 80 GLY n 1 81 ILE n 1 82 ASP n 1 83 SER n 1 84 GLU n 1 85 ASP n 1 86 ALA n 1 87 TYR n 1 88 PRO n 1 89 TYR n 1 90 VAL n 1 91 GLY n 1 92 GLN n 1 93 GLU n 1 94 GLU n 1 95 SER n 1 96 CYS n 1 97 MET n 1 98 TYR n 1 99 ASN n 1 100 PRO n 1 101 THR n 1 102 GLY n 1 103 LYS n 1 104 ALA n 1 105 ALA n 1 106 LYS n 1 107 CYS n 1 108 ARG n 1 109 GLY n 1 110 TYR n 1 111 ARG n 1 112 GLU n 1 113 ILE n 1 114 PRO n 1 115 GLU n 1 116 GLY n 1 117 ASN n 1 118 GLU n 1 119 LYS n 1 120 ALA n 1 121 LEU n 1 122 LYS n 1 123 ARG n 1 124 ALA n 1 125 VAL n 1 126 ALA n 1 127 ARG n 1 128 VAL n 1 129 GLY n 1 130 PRO n 1 131 VAL n 1 132 SER n 1 133 VAL n 1 134 ALA n 1 135 ILE n 1 136 ASP n 1 137 ALA n 1 138 SER n 1 139 LEU n 1 140 THR n 1 141 SER n 1 142 PHE n 1 143 GLN n 1 144 PHE n 1 145 TYR n 1 146 SER n 1 147 LYS n 1 148 GLY n 1 149 VAL n 1 150 TYR n 1 151 TYR n 1 152 ASP n 1 153 GLU n 1 154 SER n 1 155 CYS n 1 156 ASN n 1 157 SER n 1 158 ASP n 1 159 ASN n 1 160 LEU n 1 161 ASN n 1 162 HIS n 1 163 ALA n 1 164 VAL n 1 165 LEU n 1 166 ALA n 1 167 VAL n 1 168 GLY n 1 169 TYR n 1 170 GLY n 1 171 ILE n 1 172 GLN n 1 173 LYS n 1 174 GLY n 1 175 ASN n 1 176 LYS n 1 177 HIS n 1 178 TRP n 1 179 ILE n 1 180 ILE n 1 181 LYS n 1 182 ASN n 1 183 SER n 1 184 TRP n 1 185 GLY n 1 186 GLU n 1 187 ASN n 1 188 TRP n 1 189 GLY n 1 190 ASN n 1 191 LYS n 1 192 GLY n 1 193 TYR n 1 194 ILE n 1 195 LEU n 1 196 MET n 1 197 ALA n 1 198 ARG n 1 199 ASN n 1 200 LYS n 1 201 ASN n 1 202 ASN n 1 203 ALA n 1 204 CYS n 1 205 GLY n 1 206 ILE n 1 207 ALA n 1 208 ASN n 1 209 LEU n 1 210 ALA n 1 211 SER n 1 212 PHE n 1 213 PRO n 1 214 LYS n 1 215 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 215 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CTSK, CTSO, CTSO2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella phaffii GS115' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 644223 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A0U non-polymer . '~{tert}-butyl ~{N}-[iminomethyl-[2-[methyl-(phenylmethyl)amino]-2-oxidanylidene-ethyl]amino]carbamate' ? 'C16 H24 N4 O3' 320.387 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 CYS 155 155 155 CYS CYS A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 HIS 162 162 162 HIS HIS A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 TRP 178 178 178 TRP TRP A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 TRP 184 184 184 TRP TRP A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 TRP 188 188 188 TRP TRP A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 MET 196 196 196 MET MET A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 ASN 208 208 208 ASN ASN A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 MET 215 215 215 MET MET A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A0U 1 301 301 A0U DRG A . C 3 HOH 1 401 32 HOH HOH A . C 3 HOH 2 402 24 HOH HOH A . C 3 HOH 3 403 26 HOH HOH A . C 3 HOH 4 404 67 HOH HOH A . C 3 HOH 5 405 31 HOH HOH A . C 3 HOH 6 406 55 HOH HOH A . C 3 HOH 7 407 49 HOH HOH A . C 3 HOH 8 408 33 HOH HOH A . C 3 HOH 9 409 66 HOH HOH A . C 3 HOH 10 410 11 HOH HOH A . C 3 HOH 11 411 27 HOH HOH A . C 3 HOH 12 412 1 HOH HOH A . C 3 HOH 13 413 18 HOH HOH A . C 3 HOH 14 414 40 HOH HOH A . C 3 HOH 15 415 20 HOH HOH A . C 3 HOH 16 416 60 HOH HOH A . C 3 HOH 17 417 12 HOH HOH A . C 3 HOH 18 418 51 HOH HOH A . C 3 HOH 19 419 37 HOH HOH A . C 3 HOH 20 420 29 HOH HOH A . C 3 HOH 21 421 17 HOH HOH A . C 3 HOH 22 422 10 HOH HOH A . C 3 HOH 23 423 4 HOH HOH A . C 3 HOH 24 424 14 HOH HOH A . C 3 HOH 25 425 62 HOH HOH A . C 3 HOH 26 426 2 HOH HOH A . C 3 HOH 27 427 16 HOH HOH A . C 3 HOH 28 428 65 HOH HOH A . C 3 HOH 29 429 48 HOH HOH A . C 3 HOH 30 430 5 HOH HOH A . C 3 HOH 31 431 30 HOH HOH A . C 3 HOH 32 432 6 HOH HOH A . C 3 HOH 33 433 15 HOH HOH A . C 3 HOH 34 434 46 HOH HOH A . C 3 HOH 35 435 61 HOH HOH A . C 3 HOH 36 436 23 HOH HOH A . C 3 HOH 37 437 8 HOH HOH A . C 3 HOH 38 438 9 HOH HOH A . C 3 HOH 39 439 25 HOH HOH A . C 3 HOH 40 440 68 HOH HOH A . C 3 HOH 41 441 56 HOH HOH A . C 3 HOH 42 442 36 HOH HOH A . C 3 HOH 43 443 64 HOH HOH A . C 3 HOH 44 444 45 HOH HOH A . C 3 HOH 45 445 13 HOH HOH A . C 3 HOH 46 446 7 HOH HOH A . C 3 HOH 47 447 63 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7QBL _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.737 _cell.length_a_esd ? _cell.length_b 78.753 _cell.length_b_esd ? _cell.length_c 31.070 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QBL _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QBL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;10% PEG 8000, 20% ethylene glycol, 0.02 M sodium formate, 0.02 M ammonium acetate, 0.02 M trisodium citrate, 0.02 M sodium potassium L-tartrate, 0.02 M sodium oxamate, 0.1 M MES/imidazole pH 6.5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-05-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.541870 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.541870 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 35.064 _reflns.entry_id 7QBL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 28.900 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11829 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.117 _reflns.pdbx_Rmerge_I_obs 0.078 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.390 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.824 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.089 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 48700 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.000 2.120 ? 2.530 ? 7588 1923 ? 1880 97.800 ? ? ? ? 0.592 ? ? ? ? ? ? ? ? 4.036 ? ? ? ? 0.674 ? ? 1 1 0.889 ? ? ? ? ? ? ? ? ? ? 2.120 2.270 ? 4.190 ? 7603 1816 ? 1781 98.100 ? ? ? ? 0.356 ? ? ? ? ? ? ? ? 4.269 ? ? ? ? 0.404 ? ? 2 1 0.963 ? ? ? ? ? ? ? ? ? ? 2.270 2.450 ? 5.520 ? 7421 1708 ? 1698 99.400 ? ? ? ? 0.260 ? ? ? ? ? ? ? ? 4.370 ? ? ? ? 0.294 ? ? 3 1 0.952 ? ? ? ? ? ? ? ? ? ? 2.450 2.680 ? 7.410 ? 6647 1562 ? 1544 98.800 ? ? ? ? 0.184 ? ? ? ? ? ? ? ? 4.305 ? ? ? ? 0.208 ? ? 4 1 0.977 ? ? ? ? ? ? ? ? ? ? 2.680 3.000 ? 11.530 ? 5992 1440 ? 1412 98.100 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 4.244 ? ? ? ? 0.127 ? ? 5 1 0.992 ? ? ? ? ? ? ? ? ? ? 3.000 3.450 ? 18.790 ? 4870 1300 ? 1220 93.800 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 3.992 ? ? ? ? 0.077 ? ? 6 1 0.996 ? ? ? ? ? ? ? ? ? ? 3.450 4.220 ? 26.780 ? 2798 1086 ? 979 90.100 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 2.858 ? ? ? ? 0.050 ? ? 7 1 0.997 ? ? ? ? ? ? ? ? ? ? 4.220 5.910 ? 34.860 ? 3575 882 ? 824 93.400 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 4.339 ? ? ? ? 0.043 ? ? 8 1 0.997 ? ? ? ? ? ? ? ? ? ? 5.910 28.900 ? 39.600 ? 2206 545 ? 491 90.100 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 4.493 ? ? ? ? 0.032 ? ? 9 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -2.6900 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 2.0400 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 0.6600 _refine.B_iso_max 80.790 _refine.B_iso_mean 34.9500 _refine.B_iso_min 19.140 _refine.correlation_coeff_Fo_to_Fc 0.9490 _refine.correlation_coeff_Fo_to_Fc_free 0.9000 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QBL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0000 _refine.ls_d_res_low 28.9000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11344 _refine.ls_number_reflns_R_free 598 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.8500 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2207 _refine.ls_R_factor_R_free 0.2858 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2173 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7NXM _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2790 _refine.pdbx_overall_ESU_R_Free 0.2290 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.1560 _refine.overall_SU_ML 0.2090 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0000 _refine_hist.d_res_low 28.9000 _refine_hist.number_atoms_solvent 47 _refine_hist.number_atoms_total 1719 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 215 _refine_hist.pdbx_B_iso_mean_ligand 43.28 _refine_hist.pdbx_B_iso_mean_solvent 32.98 _refine_hist.pdbx_number_atoms_protein 1649 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.013 1720 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1537 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.594 1.645 2322 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.311 1.585 3582 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.194 5.000 216 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.895 22.967 91 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.299 15.000 286 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 9.623 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.070 0.200 206 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1974 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 358 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0000 _refine_ls_shell.d_res_low 2.0520 _refine_ls_shell.number_reflns_all 880 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 44 _refine_ls_shell.number_reflns_R_work 836 _refine_ls_shell.percent_reflns_obs 99.6600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3450 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3550 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7QBL _struct.title 'Structure of cathepsin K in complex with the 3-cyano-3-aza-beta-amino acid inhibitor Gu2602' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QBL _struct_keywords.text 'Cathepsin K, Protease inhibitor, Cyanohydrazide warhead, Azadipeptide nitrile, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CATK_HUMAN _struct_ref.pdbx_db_accession P43235 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM ; _struct_ref.pdbx_align_begin 115 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QBL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 215 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P43235 _struct_ref_seq.db_align_beg 115 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 329 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 215 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9770 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 24 ? GLY A 43 ? SER A 24 GLY A 43 1 ? 20 HELX_P HELX_P2 AA2 SER A 49 ? VAL A 57 ? SER A 49 VAL A 57 1 ? 9 HELX_P HELX_P3 AA3 ASP A 61 ? GLY A 65 ? ASP A 61 GLY A 65 5 ? 5 HELX_P HELX_P4 AA4 TYR A 67 ? ARG A 79 ? TYR A 67 ARG A 79 1 ? 13 HELX_P HELX_P5 AA5 ASN A 99 ? THR A 101 ? ASN A 99 THR A 101 5 ? 3 HELX_P HELX_P6 AA6 ASN A 117 ? VAL A 128 ? ASN A 117 VAL A 128 1 ? 12 HELX_P HELX_P7 AA7 LEU A 139 ? PHE A 144 ? LEU A 139 PHE A 144 1 ? 6 HELX_P HELX_P8 AA8 ASN A 202 ? ILE A 206 ? ASN A 202 ILE A 206 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 63 SG ? ? A CYS 22 A CYS 63 1_555 ? ? ? ? ? ? ? 2.064 ? ? disulf2 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 96 SG ? ? A CYS 56 A CYS 96 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 155 SG ? ? ? 1_555 A CYS 204 SG ? ? A CYS 155 A CYS 204 1_555 ? ? ? ? ? ? ? 2.067 ? ? covale1 covale none ? A CYS 25 SG ? ? ? 1_555 B A0U . C11 ? ? A CYS 25 A A0U 301 1_555 ? ? ? ? ? ? ? 1.761 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 5 ? ASP A 6 ? VAL A 5 ASP A 6 AA1 2 HIS A 162 ? GLN A 172 ? HIS A 162 GLN A 172 AA1 3 VAL A 131 ? ILE A 135 ? VAL A 131 ILE A 135 AA2 1 VAL A 5 ? ASP A 6 ? VAL A 5 ASP A 6 AA2 2 HIS A 162 ? GLN A 172 ? HIS A 162 GLN A 172 AA2 3 ASN A 175 ? LYS A 181 ? ASN A 175 LYS A 181 AA2 4 TYR A 193 ? ALA A 197 ? TYR A 193 ALA A 197 AA2 5 VAL A 149 ? TYR A 150 ? VAL A 149 TYR A 150 AA3 1 ILE A 81 ? ASP A 82 ? ILE A 81 ASP A 82 AA3 2 LYS A 103 ? ALA A 105 ? LYS A 103 ALA A 105 AA4 1 GLY A 109 ? GLU A 112 ? GLY A 109 GLU A 112 AA4 2 SER A 211 ? LYS A 214 ? SER A 211 LYS A 214 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 5 ? N VAL A 5 O TYR A 169 ? O TYR A 169 AA1 2 3 O VAL A 164 ? O VAL A 164 N VAL A 133 ? N VAL A 133 AA2 1 2 N VAL A 5 ? N VAL A 5 O TYR A 169 ? O TYR A 169 AA2 2 3 N GLY A 168 ? N GLY A 168 O ILE A 179 ? O ILE A 179 AA2 3 4 N ILE A 180 ? N ILE A 180 O ILE A 194 ? O ILE A 194 AA2 4 5 O LEU A 195 ? O LEU A 195 N TYR A 150 ? N TYR A 150 AA3 1 2 N ILE A 81 ? N ILE A 81 O ALA A 104 ? O ALA A 104 AA4 1 2 N GLY A 109 ? N GLY A 109 O LYS A 214 ? O LYS A 214 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 159 ? ? -116.32 67.22 2 1 LYS A 200 ? ? -118.57 56.00 3 1 LEU A 209 ? ? -151.49 58.65 # _pdbx_entry_details.entry_id 7QBL _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A0U C4 C Y N 1 A0U C14 C N N 2 A0U C5 C Y N 3 A0U C6 C Y N 4 A0U C11 C N N 5 A0U C7 C Y N 6 A0U C8 C Y N 7 A0U C9 C N N 8 A0U C10 C N N 9 A0U C12 C N N 10 A0U C13 C N N 11 A0U N1 N N N 12 A0U N2 N N N 13 A0U C3 C Y N 14 A0U N3 N N N 15 A0U C1 C N N 16 A0U C2 C N N 17 A0U O1 O N N 18 A0U N4 N N N 19 A0U O2 O N N 20 A0U O3 O N N 21 A0U C15 C N N 22 A0U C16 C N N 23 A0U H1 H N N 24 A0U H2 H N N 25 A0U H3 H N N 26 A0U H4 H N N 27 A0U H5 H N N 28 A0U H6 H N N 29 A0U H7 H N N 30 A0U H8 H N N 31 A0U H9 H N N 32 A0U H10 H N N 33 A0U H11 H N N 34 A0U H12 H N N 35 A0U H13 H N N 36 A0U H14 H N N 37 A0U H15 H N N 38 A0U H16 H N N 39 A0U H17 H N N 40 A0U H18 H N N 41 A0U H19 H N N 42 A0U H20 H N N 43 A0U H21 H N N 44 A0U H22 H N N 45 A0U H23 H N N 46 A0U H24 H N N 47 ALA N N N N 48 ALA CA C N S 49 ALA C C N N 50 ALA O O N N 51 ALA CB C N N 52 ALA OXT O N N 53 ALA H H N N 54 ALA H2 H N N 55 ALA HA H N N 56 ALA HB1 H N N 57 ALA HB2 H N N 58 ALA HB3 H N N 59 ALA HXT H N N 60 ARG N N N N 61 ARG CA C N S 62 ARG C C N N 63 ARG O O N N 64 ARG CB C N N 65 ARG CG C N N 66 ARG CD C N N 67 ARG NE N N N 68 ARG CZ C N N 69 ARG NH1 N N N 70 ARG NH2 N N N 71 ARG OXT O N N 72 ARG H H N N 73 ARG H2 H N N 74 ARG HA H N N 75 ARG HB2 H N N 76 ARG HB3 H N N 77 ARG HG2 H N N 78 ARG HG3 H N N 79 ARG HD2 H N N 80 ARG HD3 H N N 81 ARG HE H N N 82 ARG HH11 H N N 83 ARG HH12 H N N 84 ARG HH21 H N N 85 ARG HH22 H N N 86 ARG HXT H N N 87 ASN N N N N 88 ASN CA C N S 89 ASN C C N N 90 ASN O O N N 91 ASN CB C N N 92 ASN CG C N N 93 ASN OD1 O N N 94 ASN ND2 N N N 95 ASN OXT O N N 96 ASN H H N N 97 ASN H2 H N N 98 ASN HA H N N 99 ASN HB2 H N N 100 ASN HB3 H N N 101 ASN HD21 H N N 102 ASN HD22 H N N 103 ASN HXT H N N 104 ASP N N N N 105 ASP CA C N S 106 ASP C C N N 107 ASP O O N N 108 ASP CB C N N 109 ASP CG C N N 110 ASP OD1 O N N 111 ASP OD2 O N N 112 ASP OXT O N N 113 ASP H H N N 114 ASP H2 H N N 115 ASP HA H N N 116 ASP HB2 H N N 117 ASP HB3 H N N 118 ASP HD2 H N N 119 ASP HXT H N N 120 CYS N N N N 121 CYS CA C N R 122 CYS C C N N 123 CYS O O N N 124 CYS CB C N N 125 CYS SG S N N 126 CYS OXT O N N 127 CYS H H N N 128 CYS H2 H N N 129 CYS HA H N N 130 CYS HB2 H N N 131 CYS HB3 H N N 132 CYS HG H N N 133 CYS HXT H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 PHE N N N N 297 PHE CA C N S 298 PHE C C N N 299 PHE O O N N 300 PHE CB C N N 301 PHE CG C Y N 302 PHE CD1 C Y N 303 PHE CD2 C Y N 304 PHE CE1 C Y N 305 PHE CE2 C Y N 306 PHE CZ C Y N 307 PHE OXT O N N 308 PHE H H N N 309 PHE H2 H N N 310 PHE HA H N N 311 PHE HB2 H N N 312 PHE HB3 H N N 313 PHE HD1 H N N 314 PHE HD2 H N N 315 PHE HE1 H N N 316 PHE HE2 H N N 317 PHE HZ H N N 318 PHE HXT H N N 319 PRO N N N N 320 PRO CA C N S 321 PRO C C N N 322 PRO O O N N 323 PRO CB C N N 324 PRO CG C N N 325 PRO CD C N N 326 PRO OXT O N N 327 PRO H H N N 328 PRO HA H N N 329 PRO HB2 H N N 330 PRO HB3 H N N 331 PRO HG2 H N N 332 PRO HG3 H N N 333 PRO HD2 H N N 334 PRO HD3 H N N 335 PRO HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 THR N N N N 351 THR CA C N S 352 THR C C N N 353 THR O O N N 354 THR CB C N R 355 THR OG1 O N N 356 THR CG2 C N N 357 THR OXT O N N 358 THR H H N N 359 THR H2 H N N 360 THR HA H N N 361 THR HB H N N 362 THR HG1 H N N 363 THR HG21 H N N 364 THR HG22 H N N 365 THR HG23 H N N 366 THR HXT H N N 367 TRP N N N N 368 TRP CA C N S 369 TRP C C N N 370 TRP O O N N 371 TRP CB C N N 372 TRP CG C Y N 373 TRP CD1 C Y N 374 TRP CD2 C Y N 375 TRP NE1 N Y N 376 TRP CE2 C Y N 377 TRP CE3 C Y N 378 TRP CZ2 C Y N 379 TRP CZ3 C Y N 380 TRP CH2 C Y N 381 TRP OXT O N N 382 TRP H H N N 383 TRP H2 H N N 384 TRP HA H N N 385 TRP HB2 H N N 386 TRP HB3 H N N 387 TRP HD1 H N N 388 TRP HE1 H N N 389 TRP HE3 H N N 390 TRP HZ2 H N N 391 TRP HZ3 H N N 392 TRP HH2 H N N 393 TRP HXT H N N 394 TYR N N N N 395 TYR CA C N S 396 TYR C C N N 397 TYR O O N N 398 TYR CB C N N 399 TYR CG C Y N 400 TYR CD1 C Y N 401 TYR CD2 C Y N 402 TYR CE1 C Y N 403 TYR CE2 C Y N 404 TYR CZ C Y N 405 TYR OH O N N 406 TYR OXT O N N 407 TYR H H N N 408 TYR H2 H N N 409 TYR HA H N N 410 TYR HB2 H N N 411 TYR HB3 H N N 412 TYR HD1 H N N 413 TYR HD2 H N N 414 TYR HE1 H N N 415 TYR HE2 H N N 416 TYR HH H N N 417 TYR HXT H N N 418 VAL N N N N 419 VAL CA C N S 420 VAL C C N N 421 VAL O O N N 422 VAL CB C N N 423 VAL CG1 C N N 424 VAL CG2 C N N 425 VAL OXT O N N 426 VAL H H N N 427 VAL H2 H N N 428 VAL HA H N N 429 VAL HB H N N 430 VAL HG11 H N N 431 VAL HG12 H N N 432 VAL HG13 H N N 433 VAL HG21 H N N 434 VAL HG22 H N N 435 VAL HG23 H N N 436 VAL HXT H N N 437 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A0U C15 C13 sing N N 1 A0U C6 C7 doub Y N 2 A0U C6 C5 sing Y N 3 A0U C7 C8 sing Y N 4 A0U O3 C13 sing N N 5 A0U O3 C12 sing N N 6 A0U C13 C16 sing N N 7 A0U C13 C14 sing N N 8 A0U C5 C4 doub Y N 9 A0U N4 C12 sing N N 10 A0U N4 N2 sing N N 11 A0U C8 C3 doub Y N 12 A0U C4 C3 sing Y N 13 A0U C3 C2 sing N N 14 A0U C12 O2 doub N N 15 A0U O1 C9 doub N N 16 A0U C11 N2 sing N N 17 A0U C11 N3 doub N N 18 A0U N2 C10 sing N N 19 A0U C2 N1 sing N N 20 A0U C9 N1 sing N N 21 A0U C9 C10 sing N N 22 A0U N1 C1 sing N N 23 A0U C4 H1 sing N N 24 A0U C14 H2 sing N N 25 A0U C14 H3 sing N N 26 A0U C14 H4 sing N N 27 A0U C5 H5 sing N N 28 A0U C6 H6 sing N N 29 A0U C11 H7 sing N N 30 A0U C7 H8 sing N N 31 A0U C8 H9 sing N N 32 A0U C10 H10 sing N N 33 A0U C10 H11 sing N N 34 A0U N3 H12 sing N N 35 A0U C1 H13 sing N N 36 A0U C1 H14 sing N N 37 A0U C1 H15 sing N N 38 A0U C2 H16 sing N N 39 A0U C2 H17 sing N N 40 A0U N4 H18 sing N N 41 A0U C15 H19 sing N N 42 A0U C15 H20 sing N N 43 A0U C15 H21 sing N N 44 A0U C16 H22 sing N N 45 A0U C16 H23 sing N N 46 A0U C16 H24 sing N N 47 ALA N CA sing N N 48 ALA N H sing N N 49 ALA N H2 sing N N 50 ALA CA C sing N N 51 ALA CA CB sing N N 52 ALA CA HA sing N N 53 ALA C O doub N N 54 ALA C OXT sing N N 55 ALA CB HB1 sing N N 56 ALA CB HB2 sing N N 57 ALA CB HB3 sing N N 58 ALA OXT HXT sing N N 59 ARG N CA sing N N 60 ARG N H sing N N 61 ARG N H2 sing N N 62 ARG CA C sing N N 63 ARG CA CB sing N N 64 ARG CA HA sing N N 65 ARG C O doub N N 66 ARG C OXT sing N N 67 ARG CB CG sing N N 68 ARG CB HB2 sing N N 69 ARG CB HB3 sing N N 70 ARG CG CD sing N N 71 ARG CG HG2 sing N N 72 ARG CG HG3 sing N N 73 ARG CD NE sing N N 74 ARG CD HD2 sing N N 75 ARG CD HD3 sing N N 76 ARG NE CZ sing N N 77 ARG NE HE sing N N 78 ARG CZ NH1 sing N N 79 ARG CZ NH2 doub N N 80 ARG NH1 HH11 sing N N 81 ARG NH1 HH12 sing N N 82 ARG NH2 HH21 sing N N 83 ARG NH2 HH22 sing N N 84 ARG OXT HXT sing N N 85 ASN N CA sing N N 86 ASN N H sing N N 87 ASN N H2 sing N N 88 ASN CA C sing N N 89 ASN CA CB sing N N 90 ASN CA HA sing N N 91 ASN C O doub N N 92 ASN C OXT sing N N 93 ASN CB CG sing N N 94 ASN CB HB2 sing N N 95 ASN CB HB3 sing N N 96 ASN CG OD1 doub N N 97 ASN CG ND2 sing N N 98 ASN ND2 HD21 sing N N 99 ASN ND2 HD22 sing N N 100 ASN OXT HXT sing N N 101 ASP N CA sing N N 102 ASP N H sing N N 103 ASP N H2 sing N N 104 ASP CA C sing N N 105 ASP CA CB sing N N 106 ASP CA HA sing N N 107 ASP C O doub N N 108 ASP C OXT sing N N 109 ASP CB CG sing N N 110 ASP CB HB2 sing N N 111 ASP CB HB3 sing N N 112 ASP CG OD1 doub N N 113 ASP CG OD2 sing N N 114 ASP OD2 HD2 sing N N 115 ASP OXT HXT sing N N 116 CYS N CA sing N N 117 CYS N H sing N N 118 CYS N H2 sing N N 119 CYS CA C sing N N 120 CYS CA CB sing N N 121 CYS CA HA sing N N 122 CYS C O doub N N 123 CYS C OXT sing N N 124 CYS CB SG sing N N 125 CYS CB HB2 sing N N 126 CYS CB HB3 sing N N 127 CYS SG HG sing N N 128 CYS OXT HXT sing N N 129 GLN N CA sing N N 130 GLN N H sing N N 131 GLN N H2 sing N N 132 GLN CA C sing N N 133 GLN CA CB sing N N 134 GLN CA HA sing N N 135 GLN C O doub N N 136 GLN C OXT sing N N 137 GLN CB CG sing N N 138 GLN CB HB2 sing N N 139 GLN CB HB3 sing N N 140 GLN CG CD sing N N 141 GLN CG HG2 sing N N 142 GLN CG HG3 sing N N 143 GLN CD OE1 doub N N 144 GLN CD NE2 sing N N 145 GLN NE2 HE21 sing N N 146 GLN NE2 HE22 sing N N 147 GLN OXT HXT sing N N 148 GLU N CA sing N N 149 GLU N H sing N N 150 GLU N H2 sing N N 151 GLU CA C sing N N 152 GLU CA CB sing N N 153 GLU CA HA sing N N 154 GLU C O doub N N 155 GLU C OXT sing N N 156 GLU CB CG sing N N 157 GLU CB HB2 sing N N 158 GLU CB HB3 sing N N 159 GLU CG CD sing N N 160 GLU CG HG2 sing N N 161 GLU CG HG3 sing N N 162 GLU CD OE1 doub N N 163 GLU CD OE2 sing N N 164 GLU OE2 HE2 sing N N 165 GLU OXT HXT sing N N 166 GLY N CA sing N N 167 GLY N H sing N N 168 GLY N H2 sing N N 169 GLY CA C sing N N 170 GLY CA HA2 sing N N 171 GLY CA HA3 sing N N 172 GLY C O doub N N 173 GLY C OXT sing N N 174 GLY OXT HXT sing N N 175 HIS N CA sing N N 176 HIS N H sing N N 177 HIS N H2 sing N N 178 HIS CA C sing N N 179 HIS CA CB sing N N 180 HIS CA HA sing N N 181 HIS C O doub N N 182 HIS C OXT sing N N 183 HIS CB CG sing N N 184 HIS CB HB2 sing N N 185 HIS CB HB3 sing N N 186 HIS CG ND1 sing Y N 187 HIS CG CD2 doub Y N 188 HIS ND1 CE1 doub Y N 189 HIS ND1 HD1 sing N N 190 HIS CD2 NE2 sing Y N 191 HIS CD2 HD2 sing N N 192 HIS CE1 NE2 sing Y N 193 HIS CE1 HE1 sing N N 194 HIS NE2 HE2 sing N N 195 HIS OXT HXT sing N N 196 HOH O H1 sing N N 197 HOH O H2 sing N N 198 ILE N CA sing N N 199 ILE N H sing N N 200 ILE N H2 sing N N 201 ILE CA C sing N N 202 ILE CA CB sing N N 203 ILE CA HA sing N N 204 ILE C O doub N N 205 ILE C OXT sing N N 206 ILE CB CG1 sing N N 207 ILE CB CG2 sing N N 208 ILE CB HB sing N N 209 ILE CG1 CD1 sing N N 210 ILE CG1 HG12 sing N N 211 ILE CG1 HG13 sing N N 212 ILE CG2 HG21 sing N N 213 ILE CG2 HG22 sing N N 214 ILE CG2 HG23 sing N N 215 ILE CD1 HD11 sing N N 216 ILE CD1 HD12 sing N N 217 ILE CD1 HD13 sing N N 218 ILE OXT HXT sing N N 219 LEU N CA sing N N 220 LEU N H sing N N 221 LEU N H2 sing N N 222 LEU CA C sing N N 223 LEU CA CB sing N N 224 LEU CA HA sing N N 225 LEU C O doub N N 226 LEU C OXT sing N N 227 LEU CB CG sing N N 228 LEU CB HB2 sing N N 229 LEU CB HB3 sing N N 230 LEU CG CD1 sing N N 231 LEU CG CD2 sing N N 232 LEU CG HG sing N N 233 LEU CD1 HD11 sing N N 234 LEU CD1 HD12 sing N N 235 LEU CD1 HD13 sing N N 236 LEU CD2 HD21 sing N N 237 LEU CD2 HD22 sing N N 238 LEU CD2 HD23 sing N N 239 LEU OXT HXT sing N N 240 LYS N CA sing N N 241 LYS N H sing N N 242 LYS N H2 sing N N 243 LYS CA C sing N N 244 LYS CA CB sing N N 245 LYS CA HA sing N N 246 LYS C O doub N N 247 LYS C OXT sing N N 248 LYS CB CG sing N N 249 LYS CB HB2 sing N N 250 LYS CB HB3 sing N N 251 LYS CG CD sing N N 252 LYS CG HG2 sing N N 253 LYS CG HG3 sing N N 254 LYS CD CE sing N N 255 LYS CD HD2 sing N N 256 LYS CD HD3 sing N N 257 LYS CE NZ sing N N 258 LYS CE HE2 sing N N 259 LYS CE HE3 sing N N 260 LYS NZ HZ1 sing N N 261 LYS NZ HZ2 sing N N 262 LYS NZ HZ3 sing N N 263 LYS OXT HXT sing N N 264 MET N CA sing N N 265 MET N H sing N N 266 MET N H2 sing N N 267 MET CA C sing N N 268 MET CA CB sing N N 269 MET CA HA sing N N 270 MET C O doub N N 271 MET C OXT sing N N 272 MET CB CG sing N N 273 MET CB HB2 sing N N 274 MET CB HB3 sing N N 275 MET CG SD sing N N 276 MET CG HG2 sing N N 277 MET CG HG3 sing N N 278 MET SD CE sing N N 279 MET CE HE1 sing N N 280 MET CE HE2 sing N N 281 MET CE HE3 sing N N 282 MET OXT HXT sing N N 283 PHE N CA sing N N 284 PHE N H sing N N 285 PHE N H2 sing N N 286 PHE CA C sing N N 287 PHE CA CB sing N N 288 PHE CA HA sing N N 289 PHE C O doub N N 290 PHE C OXT sing N N 291 PHE CB CG sing N N 292 PHE CB HB2 sing N N 293 PHE CB HB3 sing N N 294 PHE CG CD1 doub Y N 295 PHE CG CD2 sing Y N 296 PHE CD1 CE1 sing Y N 297 PHE CD1 HD1 sing N N 298 PHE CD2 CE2 doub Y N 299 PHE CD2 HD2 sing N N 300 PHE CE1 CZ doub Y N 301 PHE CE1 HE1 sing N N 302 PHE CE2 CZ sing Y N 303 PHE CE2 HE2 sing N N 304 PHE CZ HZ sing N N 305 PHE OXT HXT sing N N 306 PRO N CA sing N N 307 PRO N CD sing N N 308 PRO N H sing N N 309 PRO CA C sing N N 310 PRO CA CB sing N N 311 PRO CA HA sing N N 312 PRO C O doub N N 313 PRO C OXT sing N N 314 PRO CB CG sing N N 315 PRO CB HB2 sing N N 316 PRO CB HB3 sing N N 317 PRO CG CD sing N N 318 PRO CG HG2 sing N N 319 PRO CG HG3 sing N N 320 PRO CD HD2 sing N N 321 PRO CD HD3 sing N N 322 PRO OXT HXT sing N N 323 SER N CA sing N N 324 SER N H sing N N 325 SER N H2 sing N N 326 SER CA C sing N N 327 SER CA CB sing N N 328 SER CA HA sing N N 329 SER C O doub N N 330 SER C OXT sing N N 331 SER CB OG sing N N 332 SER CB HB2 sing N N 333 SER CB HB3 sing N N 334 SER OG HG sing N N 335 SER OXT HXT sing N N 336 THR N CA sing N N 337 THR N H sing N N 338 THR N H2 sing N N 339 THR CA C sing N N 340 THR CA CB sing N N 341 THR CA HA sing N N 342 THR C O doub N N 343 THR C OXT sing N N 344 THR CB OG1 sing N N 345 THR CB CG2 sing N N 346 THR CB HB sing N N 347 THR OG1 HG1 sing N N 348 THR CG2 HG21 sing N N 349 THR CG2 HG22 sing N N 350 THR CG2 HG23 sing N N 351 THR OXT HXT sing N N 352 TRP N CA sing N N 353 TRP N H sing N N 354 TRP N H2 sing N N 355 TRP CA C sing N N 356 TRP CA CB sing N N 357 TRP CA HA sing N N 358 TRP C O doub N N 359 TRP C OXT sing N N 360 TRP CB CG sing N N 361 TRP CB HB2 sing N N 362 TRP CB HB3 sing N N 363 TRP CG CD1 doub Y N 364 TRP CG CD2 sing Y N 365 TRP CD1 NE1 sing Y N 366 TRP CD1 HD1 sing N N 367 TRP CD2 CE2 doub Y N 368 TRP CD2 CE3 sing Y N 369 TRP NE1 CE2 sing Y N 370 TRP NE1 HE1 sing N N 371 TRP CE2 CZ2 sing Y N 372 TRP CE3 CZ3 doub Y N 373 TRP CE3 HE3 sing N N 374 TRP CZ2 CH2 doub Y N 375 TRP CZ2 HZ2 sing N N 376 TRP CZ3 CH2 sing Y N 377 TRP CZ3 HZ3 sing N N 378 TRP CH2 HH2 sing N N 379 TRP OXT HXT sing N N 380 TYR N CA sing N N 381 TYR N H sing N N 382 TYR N H2 sing N N 383 TYR CA C sing N N 384 TYR CA CB sing N N 385 TYR CA HA sing N N 386 TYR C O doub N N 387 TYR C OXT sing N N 388 TYR CB CG sing N N 389 TYR CB HB2 sing N N 390 TYR CB HB3 sing N N 391 TYR CG CD1 doub Y N 392 TYR CG CD2 sing Y N 393 TYR CD1 CE1 sing Y N 394 TYR CD1 HD1 sing N N 395 TYR CD2 CE2 doub Y N 396 TYR CD2 HD2 sing N N 397 TYR CE1 CZ doub Y N 398 TYR CE1 HE1 sing N N 399 TYR CE2 CZ sing Y N 400 TYR CE2 HE2 sing N N 401 TYR CZ OH sing N N 402 TYR OH HH sing N N 403 TYR OXT HXT sing N N 404 VAL N CA sing N N 405 VAL N H sing N N 406 VAL N H2 sing N N 407 VAL CA C sing N N 408 VAL CA CB sing N N 409 VAL CA HA sing N N 410 VAL C O doub N N 411 VAL C OXT sing N N 412 VAL CB CG1 sing N N 413 VAL CB CG2 sing N N 414 VAL CB HB sing N N 415 VAL CG1 HG11 sing N N 416 VAL CG1 HG12 sing N N 417 VAL CG1 HG13 sing N N 418 VAL CG2 HG21 sing N N 419 VAL CG2 HG22 sing N N 420 VAL CG2 HG23 sing N N 421 VAL OXT HXT sing N N 422 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Regional Development Fund' 'Czech Republic' 'ChemBioDrug CZ.02.1.01/0.0/0.0/16_019/0000729' 1 'Czech Academy of Sciences' 'Czech Republic' 'RVO 61388963' 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A0U _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A0U _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7NXM _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7QBL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014137 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012698 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.032185 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_