data_7QDT # _entry.id 7QDT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QDT pdb_00007qdt 10.2210/pdb7qdt/pdb WWPDB D_1292119477 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-26 2 'Structure model' 1 1 2022-03-02 3 'Structure model' 2 0 2023-11-15 4 'Structure model' 2 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation.year' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_atom_site.auth_atom_id' 9 3 'Structure model' '_atom_site.label_atom_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QDT _pdbx_database_status.recvd_initial_deposition_date 2021-11-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email js336@leicester.ac.uk _pdbx_contact_author.name_first John _pdbx_contact_author.name_last Schwabe _pdbx_contact_author.name_mi W.R. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2865-4383 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Romartinez-Alonso, B.' 1 0000-0002-3061-6696 'Fairall, L.' 2 0000-0001-9456-3047 'Agostini, M.' 3 0000-0001-5440-9627 'Chatterjee, K.' 4 ? 'Schwabe, J.' 5 0000-0003-2865-4383 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell.Biol. _citation.journal_id_ASTM MCEBD4 _citation.journal_id_CSD 2044 _citation.journal_id_ISSN 1098-5549 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 42 _citation.language ? _citation.page_first e0036321 _citation.page_last e0036321 _citation.title 'Structure-Guided Approach to Relieving Transcriptional Repression in Resistance to Thyroid Hormone alpha.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/MCB.00363-21 _citation.pdbx_database_id_PubMed 34871063 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Romartinez-Alonso, B.' 1 ? primary 'Agostini, M.' 2 ? primary 'Jones, H.' 3 ? primary 'McLellan, J.' 4 ? primary 'Sood, D.E.' 5 ? primary 'Tomkinson, N.' 6 ? primary 'Marelli, F.' 7 ? primary 'Gentile, I.' 8 ? primary 'Visser, W.E.' 9 ? primary 'Schoenmakers, E.' 10 ? primary 'Fairall, L.' 11 ? primary 'Privalsky, M.' 12 ? primary 'Moran, C.' 13 ? primary 'Persani, L.' 14 0000-0003-2068-9581 primary 'Chatterjee, K.' 15 0000-0002-2654-8854 primary 'Schwabe, J.W.R.' 16 0000-0003-2865-4383 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform Alpha-1 of Thyroid hormone receptor alpha' 26725.896 1 ? P393GX ? ? 2 non-polymer nat "3,5,3'TRIIODOTHYRONINE" 650.973 1 ? ? ? ? 3 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nuclear receptor subfamily 1 group A member 1,V-erbA-related protein 7,EAR-7,c-erbA-1,c-erbA-alpha' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKK LPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTE VALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVE ; _entity_poly.pdbx_seq_one_letter_code_can ;QRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKK LPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTE VALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "3,5,3'TRIIODOTHYRONINE" T3 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ARG n 1 3 PRO n 1 4 GLU n 1 5 PRO n 1 6 THR n 1 7 PRO n 1 8 GLU n 1 9 GLU n 1 10 TRP n 1 11 ASP n 1 12 LEU n 1 13 ILE n 1 14 HIS n 1 15 ILE n 1 16 ALA n 1 17 THR n 1 18 GLU n 1 19 ALA n 1 20 HIS n 1 21 ARG n 1 22 SER n 1 23 THR n 1 24 ASN n 1 25 ALA n 1 26 GLN n 1 27 GLY n 1 28 SER n 1 29 HIS n 1 30 TRP n 1 31 LYS n 1 32 GLN n 1 33 ARG n 1 34 ARG n 1 35 LYS n 1 36 PHE n 1 37 LEU n 1 38 PRO n 1 39 ASP n 1 40 ASP n 1 41 ILE n 1 42 GLY n 1 43 GLN n 1 44 SER n 1 45 PRO n 1 46 ILE n 1 47 VAL n 1 48 SER n 1 49 MET n 1 50 PRO n 1 51 ASP n 1 52 GLY n 1 53 ASP n 1 54 LYS n 1 55 VAL n 1 56 ASP n 1 57 LEU n 1 58 GLU n 1 59 ALA n 1 60 PHE n 1 61 SER n 1 62 GLU n 1 63 PHE n 1 64 THR n 1 65 LYS n 1 66 ILE n 1 67 ILE n 1 68 THR n 1 69 PRO n 1 70 ALA n 1 71 ILE n 1 72 THR n 1 73 ARG n 1 74 VAL n 1 75 VAL n 1 76 ASP n 1 77 PHE n 1 78 ALA n 1 79 LYS n 1 80 LYS n 1 81 LEU n 1 82 PRO n 1 83 MET n 1 84 PHE n 1 85 SER n 1 86 GLU n 1 87 LEU n 1 88 PRO n 1 89 CYS n 1 90 GLU n 1 91 ASP n 1 92 GLN n 1 93 ILE n 1 94 ILE n 1 95 LEU n 1 96 LEU n 1 97 LYS n 1 98 GLY n 1 99 CYS n 1 100 CYS n 1 101 MET n 1 102 GLU n 1 103 ILE n 1 104 MET n 1 105 SER n 1 106 LEU n 1 107 ARG n 1 108 ALA n 1 109 ALA n 1 110 VAL n 1 111 ARG n 1 112 TYR n 1 113 ASP n 1 114 PRO n 1 115 GLU n 1 116 SER n 1 117 ASP n 1 118 THR n 1 119 LEU n 1 120 THR n 1 121 LEU n 1 122 SER n 1 123 GLY n 1 124 GLU n 1 125 MET n 1 126 ALA n 1 127 VAL n 1 128 LYS n 1 129 ARG n 1 130 GLU n 1 131 GLN n 1 132 LEU n 1 133 LYS n 1 134 ASN n 1 135 GLY n 1 136 GLY n 1 137 LEU n 1 138 GLY n 1 139 VAL n 1 140 VAL n 1 141 SER n 1 142 ASP n 1 143 ALA n 1 144 ILE n 1 145 PHE n 1 146 GLU n 1 147 LEU n 1 148 GLY n 1 149 LYS n 1 150 SER n 1 151 LEU n 1 152 SER n 1 153 ALA n 1 154 PHE n 1 155 ASN n 1 156 LEU n 1 157 ASP n 1 158 ASP n 1 159 THR n 1 160 GLU n 1 161 VAL n 1 162 ALA n 1 163 LEU n 1 164 LEU n 1 165 GLN n 1 166 ALA n 1 167 VAL n 1 168 LEU n 1 169 LEU n 1 170 MET n 1 171 SER n 1 172 THR n 1 173 ASP n 1 174 ARG n 1 175 SER n 1 176 GLY n 1 177 LEU n 1 178 LEU n 1 179 CYS n 1 180 VAL n 1 181 ASP n 1 182 LYS n 1 183 ILE n 1 184 GLU n 1 185 LYS n 1 186 SER n 1 187 GLN n 1 188 GLU n 1 189 ALA n 1 190 TYR n 1 191 LEU n 1 192 LEU n 1 193 ALA n 1 194 PHE n 1 195 GLU n 1 196 HIS n 1 197 TYR n 1 198 VAL n 1 199 ASN n 1 200 HIS n 1 201 ARG n 1 202 LYS n 1 203 HIS n 1 204 ASN n 1 205 ILE n 1 206 PRO n 1 207 HIS n 1 208 PHE n 1 209 TRP n 1 210 PRO n 1 211 LYS n 1 212 LEU n 1 213 LEU n 1 214 MET n 1 215 LYS n 1 216 VAL n 1 217 THR n 1 218 ASP n 1 219 LEU n 1 220 ARG n 1 221 MET n 1 222 ILE n 1 223 GLY n 1 224 ALA n 1 225 CYS n 1 226 HIS n 1 227 ALA n 1 228 SER n 1 229 ARG n 1 230 PHE n 1 231 LEU n 1 232 HIS n 1 233 MET n 1 234 LYS n 1 235 VAL n 1 236 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 236 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'THRA, EAR7, ERBA1, NR1A1, THRA1, THRA2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Rosetta _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 T3 non-polymer . "3,5,3'TRIIODOTHYRONINE" 'T3; THYROID HORMONE; LIOTHYRONINE' 'C15 H12 I3 N O4' 650.973 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 156 156 GLN GLN A . n A 1 2 ARG 2 157 157 ARG ARG A . n A 1 3 PRO 3 158 158 PRO PRO A . n A 1 4 GLU 4 159 159 GLU GLU A . n A 1 5 PRO 5 160 160 PRO PRO A . n A 1 6 THR 6 161 161 THR THR A . n A 1 7 PRO 7 162 162 PRO PRO A . n A 1 8 GLU 8 163 163 GLU GLU A . n A 1 9 GLU 9 164 164 GLU GLU A . n A 1 10 TRP 10 165 165 TRP TRP A . n A 1 11 ASP 11 166 166 ASP ASP A . n A 1 12 LEU 12 167 167 LEU LEU A . n A 1 13 ILE 13 168 168 ILE ILE A . n A 1 14 HIS 14 169 169 HIS HIS A . n A 1 15 ILE 15 170 170 ILE ILE A . n A 1 16 ALA 16 171 171 ALA ALA A . n A 1 17 THR 17 172 172 THR THR A . n A 1 18 GLU 18 173 173 GLU GLU A . n A 1 19 ALA 19 174 174 ALA ALA A . n A 1 20 HIS 20 175 175 HIS HIS A . n A 1 21 ARG 21 176 176 ARG ARG A . n A 1 22 SER 22 177 177 SER SER A . n A 1 23 THR 23 178 178 THR THR A . n A 1 24 ASN 24 179 179 ASN ASN A . n A 1 25 ALA 25 180 180 ALA ALA A . n A 1 26 GLN 26 181 181 GLN GLN A . n A 1 27 GLY 27 182 182 GLY GLY A . n A 1 28 SER 28 183 183 SER SER A . n A 1 29 HIS 29 184 184 HIS HIS A . n A 1 30 TRP 30 185 185 TRP TRP A . n A 1 31 LYS 31 186 186 LYS LYS A . n A 1 32 GLN 32 187 187 GLN GLN A . n A 1 33 ARG 33 188 188 ARG ARG A . n A 1 34 ARG 34 189 189 ARG ARG A . n A 1 35 LYS 35 190 190 LYS LYS A . n A 1 36 PHE 36 191 191 PHE PHE A . n A 1 37 LEU 37 192 192 LEU LEU A . n A 1 38 PRO 38 193 193 PRO PRO A . n A 1 39 ASP 39 194 194 ASP ASP A . n A 1 40 ASP 40 195 195 ASP ASP A . n A 1 41 ILE 41 196 196 ILE ILE A . n A 1 42 GLY 42 197 197 GLY GLY A . n A 1 43 GLN 43 198 198 GLN GLN A . n A 1 44 SER 44 199 199 SER SER A . n A 1 45 PRO 45 200 200 PRO PRO A . n A 1 46 ILE 46 201 201 ILE ILE A . n A 1 47 VAL 47 202 202 VAL VAL A . n A 1 48 SER 48 203 203 SER SER A . n A 1 49 MET 49 204 204 MET MET A . n A 1 50 PRO 50 205 205 PRO PRO A . n A 1 51 ASP 51 206 206 ASP ASP A . n A 1 52 GLY 52 207 207 GLY GLY A . n A 1 53 ASP 53 208 208 ASP ASP A . n A 1 54 LYS 54 209 209 LYS LYS A . n A 1 55 VAL 55 210 210 VAL VAL A . n A 1 56 ASP 56 211 211 ASP ASP A . n A 1 57 LEU 57 212 212 LEU LEU A . n A 1 58 GLU 58 213 213 GLU GLU A . n A 1 59 ALA 59 214 214 ALA ALA A . n A 1 60 PHE 60 215 215 PHE PHE A . n A 1 61 SER 61 216 216 SER SER A . n A 1 62 GLU 62 217 217 GLU GLU A . n A 1 63 PHE 63 218 218 PHE PHE A . n A 1 64 THR 64 219 219 THR THR A . n A 1 65 LYS 65 220 220 LYS LYS A . n A 1 66 ILE 66 221 221 ILE ILE A . n A 1 67 ILE 67 222 222 ILE ILE A . n A 1 68 THR 68 223 223 THR THR A . n A 1 69 PRO 69 224 224 PRO PRO A . n A 1 70 ALA 70 225 225 ALA ALA A . n A 1 71 ILE 71 226 226 ILE ILE A . n A 1 72 THR 72 227 227 THR THR A . n A 1 73 ARG 73 228 228 ARG ARG A . n A 1 74 VAL 74 229 229 VAL VAL A . n A 1 75 VAL 75 230 230 VAL VAL A . n A 1 76 ASP 76 231 231 ASP ASP A . n A 1 77 PHE 77 232 232 PHE PHE A . n A 1 78 ALA 78 233 233 ALA ALA A . n A 1 79 LYS 79 234 234 LYS LYS A . n A 1 80 LYS 80 235 235 LYS LYS A . n A 1 81 LEU 81 236 236 LEU LEU A . n A 1 82 PRO 82 237 237 PRO PRO A . n A 1 83 MET 83 238 238 MET MET A . n A 1 84 PHE 84 239 239 PHE PHE A . n A 1 85 SER 85 240 240 SER SER A . n A 1 86 GLU 86 241 241 GLU GLU A . n A 1 87 LEU 87 242 242 LEU LEU A . n A 1 88 PRO 88 243 243 PRO PRO A . n A 1 89 CYS 89 244 244 CYS CYS A . n A 1 90 GLU 90 245 245 GLU GLU A . n A 1 91 ASP 91 246 246 ASP ASP A . n A 1 92 GLN 92 247 247 GLN GLN A . n A 1 93 ILE 93 248 248 ILE ILE A . n A 1 94 ILE 94 249 249 ILE ILE A . n A 1 95 LEU 95 250 250 LEU LEU A . n A 1 96 LEU 96 251 251 LEU LEU A . n A 1 97 LYS 97 252 252 LYS LYS A . n A 1 98 GLY 98 253 253 GLY GLY A . n A 1 99 CYS 99 254 254 CYS CYS A . n A 1 100 CYS 100 255 255 CYS CYS A . n A 1 101 MET 101 256 256 MET MET A . n A 1 102 GLU 102 257 257 GLU GLU A . n A 1 103 ILE 103 258 258 ILE ILE A . n A 1 104 MET 104 259 259 MET MET A . n A 1 105 SER 105 260 260 SER SER A . n A 1 106 LEU 106 261 261 LEU LEU A . n A 1 107 ARG 107 262 262 ARG ARG A . n A 1 108 ALA 108 263 263 ALA ALA A . n A 1 109 ALA 109 264 264 ALA ALA A . n A 1 110 VAL 110 265 265 VAL VAL A . n A 1 111 ARG 111 266 266 ARG ARG A . n A 1 112 TYR 112 267 267 TYR TYR A . n A 1 113 ASP 113 268 268 ASP ASP A . n A 1 114 PRO 114 269 269 PRO PRO A . n A 1 115 GLU 115 270 270 GLU GLU A . n A 1 116 SER 116 271 271 SER SER A . n A 1 117 ASP 117 272 272 ASP ASP A . n A 1 118 THR 118 273 273 THR THR A . n A 1 119 LEU 119 274 274 LEU LEU A . n A 1 120 THR 120 275 275 THR THR A . n A 1 121 LEU 121 276 276 LEU LEU A . n A 1 122 SER 122 277 277 SER SER A . n A 1 123 GLY 123 278 278 GLY GLY A . n A 1 124 GLU 124 279 279 GLU GLU A . n A 1 125 MET 125 280 280 MET MET A . n A 1 126 ALA 126 281 281 ALA ALA A . n A 1 127 VAL 127 282 282 VAL VAL A . n A 1 128 LYS 128 283 283 LYS LYS A . n A 1 129 ARG 129 284 284 ARG ARG A . n A 1 130 GLU 130 285 285 GLU GLU A . n A 1 131 GLN 131 286 286 GLN GLN A . n A 1 132 LEU 132 287 287 LEU LEU A . n A 1 133 LYS 133 288 288 LYS LYS A . n A 1 134 ASN 134 289 289 ASN ASN A . n A 1 135 GLY 135 290 290 GLY GLY A . n A 1 136 GLY 136 291 291 GLY GLY A . n A 1 137 LEU 137 292 292 LEU LEU A . n A 1 138 GLY 138 293 293 GLY GLY A . n A 1 139 VAL 139 294 294 VAL VAL A . n A 1 140 VAL 140 295 295 VAL VAL A . n A 1 141 SER 141 296 296 SER SER A . n A 1 142 ASP 142 297 297 ASP ASP A . n A 1 143 ALA 143 298 298 ALA ALA A . n A 1 144 ILE 144 299 299 ILE ILE A . n A 1 145 PHE 145 300 300 PHE PHE A . n A 1 146 GLU 146 301 301 GLU GLU A . n A 1 147 LEU 147 302 302 LEU LEU A . n A 1 148 GLY 148 303 303 GLY GLY A . n A 1 149 LYS 149 304 304 LYS LYS A . n A 1 150 SER 150 305 305 SER SER A . n A 1 151 LEU 151 306 306 LEU LEU A . n A 1 152 SER 152 307 307 SER SER A . n A 1 153 ALA 153 308 308 ALA ALA A . n A 1 154 PHE 154 309 309 PHE PHE A . n A 1 155 ASN 155 310 310 ASN ASN A . n A 1 156 LEU 156 311 311 LEU LEU A . n A 1 157 ASP 157 312 312 ASP ASP A . n A 1 158 ASP 158 313 313 ASP ASP A . n A 1 159 THR 159 314 314 THR THR A . n A 1 160 GLU 160 315 315 GLU GLU A . n A 1 161 VAL 161 316 316 VAL VAL A . n A 1 162 ALA 162 317 317 ALA ALA A . n A 1 163 LEU 163 318 318 LEU LEU A . n A 1 164 LEU 164 319 319 LEU LEU A . n A 1 165 GLN 165 320 320 GLN GLN A . n A 1 166 ALA 166 321 321 ALA ALA A . n A 1 167 VAL 167 322 322 VAL VAL A . n A 1 168 LEU 168 323 323 LEU LEU A . n A 1 169 LEU 169 324 324 LEU LEU A . n A 1 170 MET 170 325 325 MET MET A . n A 1 171 SER 171 326 326 SER SER A . n A 1 172 THR 172 327 327 THR THR A . n A 1 173 ASP 173 328 328 ASP ASP A . n A 1 174 ARG 174 329 329 ARG ARG A . n A 1 175 SER 175 330 330 SER SER A . n A 1 176 GLY 176 331 331 GLY GLY A . n A 1 177 LEU 177 332 332 LEU LEU A . n A 1 178 LEU 178 333 333 LEU LEU A . n A 1 179 CYS 179 334 334 CYS CYS A . n A 1 180 VAL 180 335 335 VAL VAL A . n A 1 181 ASP 181 336 336 ASP ASP A . n A 1 182 LYS 182 337 337 LYS LYS A . n A 1 183 ILE 183 338 338 ILE ILE A . n A 1 184 GLU 184 339 339 GLU GLU A . n A 1 185 LYS 185 340 340 LYS LYS A . n A 1 186 SER 186 341 341 SER SER A . n A 1 187 GLN 187 342 342 GLN GLN A . n A 1 188 GLU 188 343 343 GLU GLU A . n A 1 189 ALA 189 344 344 ALA ALA A . n A 1 190 TYR 190 345 345 TYR TYR A . n A 1 191 LEU 191 346 346 LEU LEU A . n A 1 192 LEU 192 347 347 LEU LEU A . n A 1 193 ALA 193 348 348 ALA ALA A . n A 1 194 PHE 194 349 349 PHE PHE A . n A 1 195 GLU 195 350 350 GLU GLU A . n A 1 196 HIS 196 351 351 HIS HIS A . n A 1 197 TYR 197 352 352 TYR TYR A . n A 1 198 VAL 198 353 353 VAL VAL A . n A 1 199 ASN 199 354 354 ASN ASN A . n A 1 200 HIS 200 355 355 HIS HIS A . n A 1 201 ARG 201 356 356 ARG ARG A . n A 1 202 LYS 202 357 357 LYS LYS A . n A 1 203 HIS 203 358 358 HIS HIS A . n A 1 204 ASN 204 359 359 ASN ASN A . n A 1 205 ILE 205 360 360 ILE ILE A . n A 1 206 PRO 206 361 361 PRO PRO A . n A 1 207 HIS 207 362 362 HIS HIS A . n A 1 208 PHE 208 363 363 PHE PHE A . n A 1 209 TRP 209 364 364 TRP TRP A . n A 1 210 PRO 210 365 365 PRO PRO A . n A 1 211 LYS 211 366 366 LYS LYS A . n A 1 212 LEU 212 367 367 LEU LEU A . n A 1 213 LEU 213 368 368 LEU LEU A . n A 1 214 MET 214 369 369 MET MET A . n A 1 215 LYS 215 370 370 LYS LYS A . n A 1 216 VAL 216 371 371 VAL VAL A . n A 1 217 THR 217 372 372 THR THR A . n A 1 218 ASP 218 373 373 ASP ASP A . n A 1 219 LEU 219 374 374 LEU LEU A . n A 1 220 ARG 220 375 375 ARG ARG A . n A 1 221 MET 221 376 376 MET MET A . n A 1 222 ILE 222 377 377 ILE ILE A . n A 1 223 GLY 223 378 378 GLY GLY A . n A 1 224 ALA 224 379 379 ALA ALA A . n A 1 225 CYS 225 380 380 CYS CYS A . n A 1 226 HIS 226 381 381 HIS HIS A . n A 1 227 ALA 227 382 382 ALA ALA A . n A 1 228 SER 228 383 383 SER SER A . n A 1 229 ARG 229 384 384 ARG ARG A . n A 1 230 PHE 230 385 385 PHE PHE A . n A 1 231 LEU 231 386 386 LEU LEU A . n A 1 232 HIS 232 387 387 HIS HIS A . n A 1 233 MET 233 388 388 MET MET A . n A 1 234 LYS 234 389 389 LYS LYS A . n A 1 235 VAL 235 390 390 VAL VAL A . n A 1 236 GLU 236 391 391 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 T3 1 401 401 T3 T3 A . C 3 HOH 1 501 501 HOH HOH A . C 3 HOH 2 502 502 HOH HOH A . C 3 HOH 3 503 503 HOH HOH A . C 3 HOH 4 504 504 HOH HOH A . C 3 HOH 5 505 505 HOH HOH A . C 3 HOH 6 506 506 HOH HOH A . C 3 HOH 7 507 507 HOH HOH A . C 3 HOH 8 508 508 HOH HOH A . C 3 HOH 9 509 509 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 357 ? CG ? A LYS 202 CG 2 1 Y 1 A LYS 357 ? CD ? A LYS 202 CD 3 1 Y 1 A LYS 357 ? CE ? A LYS 202 CE 4 1 Y 1 A LYS 357 ? NZ ? A LYS 202 NZ 5 1 Y 1 A ASN 359 ? CG ? A ASN 204 CG 6 1 Y 1 A ASN 359 ? OD1 ? A ASN 204 OD1 7 1 Y 1 A ASN 359 ? ND2 ? A ASN 204 ND2 8 1 Y 1 A HIS 387 ? CG ? A HIS 232 CG 9 1 Y 1 A HIS 387 ? ND1 ? A HIS 232 ND1 10 1 Y 1 A HIS 387 ? CD2 ? A HIS 232 CD2 11 1 Y 1 A HIS 387 ? CE1 ? A HIS 232 CE1 12 1 Y 1 A HIS 387 ? NE2 ? A HIS 232 NE2 13 1 Y 1 A LYS 389 ? CG ? A LYS 234 CG 14 1 Y 1 A LYS 389 ? CD ? A LYS 234 CD 15 1 Y 1 A LYS 389 ? CE ? A LYS 234 CE 16 1 Y 1 A LYS 389 ? NZ ? A LYS 234 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0218 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? 7.2.2 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.32 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 3.16.1 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 7QDT _cell.details ? _cell.formula_units_Z ? _cell.length_a 143.328 _cell.length_a_esd ? _cell.length_b 143.328 _cell.length_b_esd ? _cell.length_c 88.502 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QDT _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QDT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.60 _exptl_crystal.description '200-micrometers tetragonal bipyramids' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium Chloride, 0.1 M Tris pH 8.5, 1.0 M Lithium Sulphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Crystal Monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9690 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9690 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7QDT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.0 _reflns.d_resolution_low 72.06 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11208 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.5 _reflns.pdbx_Rmerge_I_obs 0.135 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.139 _reflns.pdbx_Rpim_I_all 0.034 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1764 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.7 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.721 _reflns_shell.pdbx_Rpim_I_all 0.170 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.948 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.26 _refine.aniso_B[1][2] -1.13 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -2.26 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 7.34 _refine.B_iso_max ? _refine.B_iso_mean 52.545 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.936 _refine.correlation_coeff_Fo_to_Fc_free 0.922 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QDT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 72.06 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11208 _refine.ls_number_reflns_R_free 581 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.86 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18555 _refine.ls_R_factor_R_free 0.22754 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18322 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2h79 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.439 _refine.pdbx_overall_ESU_R_Free 0.293 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.083 _refine.overall_SU_ML 0.204 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 72.06 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1886 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1854 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.016 0.019 1916 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1798 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.059 1.986 2593 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.977 3.000 4176 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.194 5.000 235 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.475 24.146 82 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.853 15.000 343 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.251 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.103 0.200 292 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 2096 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 372 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.324 5.126 943 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.295 5.126 942 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.394 7.690 1177 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.393 7.692 1178 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.276 5.560 973 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.273 5.559 974 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.948 8.148 1416 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.603 60.018 2173 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 9.604 60.009 2174 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.000 _refine_ls_shell.d_res_low 3.078 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 34 _refine_ls_shell.number_reflns_R_work 769 _refine_ls_shell.percent_reflns_obs 99.88 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.306 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.254 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7QDT _struct.title ;Crystal structure of a mutant (P393GX) Thyroid Receptor Alpha ligand binding domain designed to model dominant negative human mutations. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QDT _struct_keywords.text 'Nuclear receptor, Thyroid hormone, Mutation, NUCLEAR PROTEIN' _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THA_HUMAN _struct_ref.pdbx_db_accession P10827 _struct_ref.pdbx_db_isoform P10827-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKK LPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTE VALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVE ; _struct_ref.pdbx_align_begin 156 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QDT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10827 _struct_ref_seq.db_align_beg 156 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 391 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 156 _struct_ref_seq.pdbx_auth_seq_align_end 391 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 840 ? 1 MORE -1 ? 1 'SSA (A^2)' 11770 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'It is a single molecule. There is not macromolecular assembly.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? SER A 22 ? THR A 161 SER A 177 1 ? 17 HELX_P HELX_P2 AA2 GLN A 26 ? ARG A 33 ? GLN A 181 ARG A 188 5 ? 8 HELX_P HELX_P3 AA3 ASP A 56 ? LYS A 80 ? ASP A 211 LYS A 235 1 ? 25 HELX_P HELX_P4 AA4 LEU A 81 ? GLU A 86 ? LEU A 236 GLU A 241 1 ? 6 HELX_P HELX_P5 AA5 PRO A 88 ? VAL A 110 ? PRO A 243 VAL A 265 1 ? 23 HELX_P HELX_P6 AA6 LYS A 128 ? GLY A 135 ? LYS A 283 GLY A 290 1 ? 8 HELX_P HELX_P7 AA7 GLY A 138 ? ALA A 153 ? GLY A 293 ALA A 308 1 ? 16 HELX_P HELX_P8 AA8 ASP A 157 ? MET A 170 ? ASP A 312 MET A 325 1 ? 14 HELX_P HELX_P9 AA9 CYS A 179 ? ARG A 201 ? CYS A 334 ARG A 356 1 ? 23 HELX_P HELX_P10 AB1 HIS A 207 ? HIS A 226 ? HIS A 362 HIS A 381 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 35 ? PHE A 36 ? LYS A 190 PHE A 191 AA1 2 MET A 125 ? VAL A 127 ? MET A 280 VAL A 282 AA1 3 LEU A 119 ? LEU A 121 ? LEU A 274 LEU A 276 AA2 1 VAL A 47 ? SER A 48 ? VAL A 202 SER A 203 AA2 2 LYS A 54 ? VAL A 55 ? LYS A 209 VAL A 210 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 35 ? N LYS A 190 O ALA A 126 ? O ALA A 281 AA1 2 3 O MET A 125 ? O MET A 280 N LEU A 121 ? N LEU A 276 AA2 1 2 N VAL A 47 ? N VAL A 202 O VAL A 55 ? O VAL A 210 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id T3 _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'binding site for residue T3 A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 PHE A 63 ? PHE A 218 . ? 1_555 ? 2 AC1 14 ARG A 73 ? ARG A 228 . ? 1_555 ? 3 AC1 14 MET A 104 ? MET A 259 . ? 1_555 ? 4 AC1 14 ARG A 107 ? ARG A 262 . ? 1_555 ? 5 AC1 14 THR A 120 ? THR A 275 . ? 1_555 ? 6 AC1 14 LEU A 121 ? LEU A 276 . ? 1_555 ? 7 AC1 14 SER A 122 ? SER A 277 . ? 1_555 ? 8 AC1 14 GLY A 135 ? GLY A 290 . ? 1_555 ? 9 AC1 14 LEU A 137 ? LEU A 292 . ? 1_555 ? 10 AC1 14 HIS A 226 ? HIS A 381 . ? 1_555 ? 11 AC1 14 ARG A 229 ? ARG A 384 . ? 1_555 ? 12 AC1 14 HOH C . ? HOH A 502 . ? 1_555 ? 13 AC1 14 HOH C . ? HOH A 503 . ? 1_555 ? 14 AC1 14 HOH C . ? HOH A 506 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A LEU 386 ? ? CB A LEU 386 ? ? CG A LEU 386 ? ? 95.49 115.30 -19.81 2.30 N 2 1 CB A LEU 386 ? ? CG A LEU 386 ? ? CD2 A LEU 386 ? ? 124.59 111.00 13.59 1.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 160 ? ? -37.33 130.33 2 1 ASP A 194 ? ? -29.96 -55.05 3 1 ASN A 310 ? ? 62.96 61.20 4 1 ASN A 359 ? ? -77.46 44.35 5 1 PHE A 385 ? ? -111.28 74.88 6 1 LEU A 386 ? ? -117.13 57.78 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PHE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 385 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LEU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 386 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 147.99 # _pdbx_entry_details.entry_id 7QDT _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 T3 C1 C Y N 304 T3 C2 C Y N 305 T3 C3 C Y N 306 T3 C4 C Y N 307 T3 C5 C Y N 308 T3 C6 C Y N 309 T3 C7 C Y N 310 T3 C8 C Y N 311 T3 C9 C Y N 312 T3 C10 C Y N 313 T3 C11 C Y N 314 T3 C12 C Y N 315 T3 C13 C N N 316 T3 CA C N S 317 T3 C C N N 318 T3 I1 I N N 319 T3 I2 I N N 320 T3 I3 I N N 321 T3 N N N N 322 T3 O1 O N N 323 T3 O2 O N N 324 T3 OXT O N N 325 T3 O O N N 326 T3 HC3 H N N 327 T3 HC4 H N N 328 T3 HC10 H N N 329 T3 HC11 H N N 330 T3 HC12 H N N 331 T3 H131 H N N 332 T3 H132 H N N 333 T3 HA H N N 334 T3 H2 H N N 335 T3 H H N N 336 T3 HO1 H N N 337 T3 HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 T3 C1 C3 doub Y N 290 T3 C1 C11 sing Y N 291 T3 C1 C13 sing N N 292 T3 C2 C4 doub Y N 293 T3 C2 C12 sing Y N 294 T3 C2 O2 sing N N 295 T3 C3 C5 sing Y N 296 T3 C3 HC3 sing N N 297 T3 C4 C6 sing Y N 298 T3 C4 HC4 sing N N 299 T3 C5 C7 doub Y N 300 T3 C5 I1 sing N N 301 T3 C6 C8 doub Y N 302 T3 C6 I2 sing N N 303 T3 C7 C9 sing Y N 304 T3 C7 O2 sing N N 305 T3 C8 C10 sing Y N 306 T3 C8 O1 sing N N 307 T3 C9 C11 doub Y N 308 T3 C9 I3 sing N N 309 T3 C10 C12 doub Y N 310 T3 C10 HC10 sing N N 311 T3 C11 HC11 sing N N 312 T3 C12 HC12 sing N N 313 T3 C13 CA sing N N 314 T3 C13 H131 sing N N 315 T3 C13 H132 sing N N 316 T3 CA C sing N N 317 T3 CA N sing N N 318 T3 CA HA sing N N 319 T3 C OXT sing N N 320 T3 C O doub N N 321 T3 N H2 sing N N 322 T3 N H sing N N 323 T3 O1 HO1 sing N N 324 T3 OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'European Communitys Seventh Framework Programme' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number PITN-GA-2013-606806 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id T3 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id T3 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2H79 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7QDT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006977 _atom_sites.fract_transf_matrix[1][2] 0.004028 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008056 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011299 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C I N O S # loop_