data_7QFN # _entry.id 7QFN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QFN pdb_00007qfn 10.2210/pdb7qfn/pdb WWPDB D_1292119289 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QFN _pdbx_database_status.recvd_initial_deposition_date 2021-12-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ling, E.M.' 1 ? 'Basle, A.' 2 ? 'Cowell, I.G.' 3 ? 'Blower, T.R.' 4 ? 'Austin, C.A.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 30 _citation.language ? _citation.page_first 1129 _citation.page_last 1145.e3 _citation.title ;A comprehensive structural analysis of the ATPase domain of human DNA topoisomerase II beta bound to AMPPNP, ADP, and the bisdioxopiperazine, ICRF193. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2022.05.009 _citation.pdbx_database_id_PubMed 35660158 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ling, E.M.' 1 ? primary 'Basle, A.' 2 ? primary 'Cowell, I.G.' 3 ? primary 'van den Berg, B.' 4 ? primary 'Blower, T.R.' 5 ? primary 'Austin, C.A.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7QFN _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.021 _cell.length_a_esd ? _cell.length_b 103.021 _cell.length_b_esd ? _cell.length_c 66.693 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7QFN _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA topoisomerase 2-beta' 45937.906 1 5.6.2.2 ? ? ? 2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DNA topoisomerase II,beta isozyme' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNASVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCI KVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKE YKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVN GFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKN KAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNK KCS ; _entity_poly.pdbx_seq_one_letter_code_can ;SNASVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCI KVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKE YKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVN GFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKN KAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNK KCS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 SER n 1 5 VAL n 1 6 GLU n 1 7 ARG n 1 8 VAL n 1 9 TYR n 1 10 GLN n 1 11 LYS n 1 12 LYS n 1 13 THR n 1 14 GLN n 1 15 LEU n 1 16 GLU n 1 17 HIS n 1 18 ILE n 1 19 LEU n 1 20 LEU n 1 21 ARG n 1 22 PRO n 1 23 ASP n 1 24 THR n 1 25 TYR n 1 26 ILE n 1 27 GLY n 1 28 SER n 1 29 VAL n 1 30 GLU n 1 31 PRO n 1 32 LEU n 1 33 THR n 1 34 GLN n 1 35 PHE n 1 36 MET n 1 37 TRP n 1 38 VAL n 1 39 TYR n 1 40 ASP n 1 41 GLU n 1 42 ASP n 1 43 VAL n 1 44 GLY n 1 45 MET n 1 46 ASN n 1 47 CYS n 1 48 ARG n 1 49 GLU n 1 50 VAL n 1 51 THR n 1 52 PHE n 1 53 VAL n 1 54 PRO n 1 55 GLY n 1 56 LEU n 1 57 TYR n 1 58 LYS n 1 59 ILE n 1 60 PHE n 1 61 ASP n 1 62 GLU n 1 63 ILE n 1 64 LEU n 1 65 VAL n 1 66 ASN n 1 67 ALA n 1 68 ALA n 1 69 ASP n 1 70 ASN n 1 71 LYS n 1 72 GLN n 1 73 ARG n 1 74 ASP n 1 75 LYS n 1 76 ASN n 1 77 MET n 1 78 THR n 1 79 CYS n 1 80 ILE n 1 81 LYS n 1 82 VAL n 1 83 SER n 1 84 ILE n 1 85 ASP n 1 86 PRO n 1 87 GLU n 1 88 SER n 1 89 ASN n 1 90 ILE n 1 91 ILE n 1 92 SER n 1 93 ILE n 1 94 TRP n 1 95 ASN n 1 96 ASN n 1 97 GLY n 1 98 LYS n 1 99 GLY n 1 100 ILE n 1 101 PRO n 1 102 VAL n 1 103 VAL n 1 104 GLU n 1 105 HIS n 1 106 LYS n 1 107 VAL n 1 108 GLU n 1 109 LYS n 1 110 VAL n 1 111 TYR n 1 112 VAL n 1 113 PRO n 1 114 ALA n 1 115 LEU n 1 116 ILE n 1 117 PHE n 1 118 GLY n 1 119 GLN n 1 120 LEU n 1 121 LEU n 1 122 THR n 1 123 SER n 1 124 SER n 1 125 ASN n 1 126 TYR n 1 127 ASP n 1 128 ASP n 1 129 ASP n 1 130 GLU n 1 131 LYS n 1 132 LYS n 1 133 VAL n 1 134 THR n 1 135 GLY n 1 136 GLY n 1 137 ARG n 1 138 ASN n 1 139 GLY n 1 140 TYR n 1 141 GLY n 1 142 ALA n 1 143 LYS n 1 144 LEU n 1 145 CYS n 1 146 ASN n 1 147 ILE n 1 148 PHE n 1 149 SER n 1 150 THR n 1 151 LYS n 1 152 PHE n 1 153 THR n 1 154 VAL n 1 155 GLU n 1 156 THR n 1 157 ALA n 1 158 CYS n 1 159 LYS n 1 160 GLU n 1 161 TYR n 1 162 LYS n 1 163 HIS n 1 164 SER n 1 165 PHE n 1 166 LYS n 1 167 GLN n 1 168 THR n 1 169 TRP n 1 170 MET n 1 171 ASN n 1 172 ASN n 1 173 MET n 1 174 MET n 1 175 LYS n 1 176 THR n 1 177 SER n 1 178 GLU n 1 179 ALA n 1 180 LYS n 1 181 ILE n 1 182 LYS n 1 183 HIS n 1 184 PHE n 1 185 ASP n 1 186 GLY n 1 187 GLU n 1 188 ASP n 1 189 TYR n 1 190 THR n 1 191 CYS n 1 192 ILE n 1 193 THR n 1 194 PHE n 1 195 GLN n 1 196 PRO n 1 197 ASP n 1 198 LEU n 1 199 SER n 1 200 LYS n 1 201 PHE n 1 202 LYS n 1 203 MET n 1 204 GLU n 1 205 LYS n 1 206 LEU n 1 207 ASP n 1 208 LYS n 1 209 ASP n 1 210 ILE n 1 211 VAL n 1 212 ALA n 1 213 LEU n 1 214 MET n 1 215 THR n 1 216 ARG n 1 217 ARG n 1 218 ALA n 1 219 TYR n 1 220 ASP n 1 221 LEU n 1 222 ALA n 1 223 GLY n 1 224 SER n 1 225 CYS n 1 226 ARG n 1 227 GLY n 1 228 VAL n 1 229 LYS n 1 230 VAL n 1 231 MET n 1 232 PHE n 1 233 ASN n 1 234 GLY n 1 235 LYS n 1 236 LYS n 1 237 LEU n 1 238 PRO n 1 239 VAL n 1 240 ASN n 1 241 GLY n 1 242 PHE n 1 243 ARG n 1 244 SER n 1 245 TYR n 1 246 VAL n 1 247 ASP n 1 248 LEU n 1 249 TYR n 1 250 VAL n 1 251 LYS n 1 252 ASP n 1 253 LYS n 1 254 LEU n 1 255 ASP n 1 256 GLU n 1 257 THR n 1 258 GLY n 1 259 VAL n 1 260 ALA n 1 261 LEU n 1 262 LYS n 1 263 VAL n 1 264 ILE n 1 265 HIS n 1 266 GLU n 1 267 LEU n 1 268 ALA n 1 269 ASN n 1 270 GLU n 1 271 ARG n 1 272 TRP n 1 273 ASP n 1 274 VAL n 1 275 CYS n 1 276 LEU n 1 277 THR n 1 278 LEU n 1 279 SER n 1 280 GLU n 1 281 LYS n 1 282 GLY n 1 283 PHE n 1 284 GLN n 1 285 GLN n 1 286 ILE n 1 287 SER n 1 288 PHE n 1 289 VAL n 1 290 ASN n 1 291 SER n 1 292 ILE n 1 293 ALA n 1 294 THR n 1 295 THR n 1 296 LYS n 1 297 GLY n 1 298 GLY n 1 299 ARG n 1 300 HIS n 1 301 VAL n 1 302 ASP n 1 303 TYR n 1 304 VAL n 1 305 VAL n 1 306 ASP n 1 307 GLN n 1 308 VAL n 1 309 VAL n 1 310 GLY n 1 311 LYS n 1 312 LEU n 1 313 ILE n 1 314 GLU n 1 315 VAL n 1 316 VAL n 1 317 LYS n 1 318 LYS n 1 319 LYS n 1 320 ASN n 1 321 LYS n 1 322 ALA n 1 323 GLY n 1 324 VAL n 1 325 SER n 1 326 VAL n 1 327 LYS n 1 328 PRO n 1 329 PHE n 1 330 GLN n 1 331 VAL n 1 332 LYS n 1 333 ASN n 1 334 HIS n 1 335 ILE n 1 336 TRP n 1 337 VAL n 1 338 PHE n 1 339 ILE n 1 340 ASN n 1 341 CYS n 1 342 LEU n 1 343 ILE n 1 344 GLU n 1 345 ASN n 1 346 PRO n 1 347 THR n 1 348 PHE n 1 349 ASP n 1 350 SER n 1 351 GLN n 1 352 THR n 1 353 LYS n 1 354 GLU n 1 355 ASN n 1 356 MET n 1 357 THR n 1 358 LEU n 1 359 GLN n 1 360 PRO n 1 361 LYS n 1 362 SER n 1 363 PHE n 1 364 GLY n 1 365 SER n 1 366 LYS n 1 367 CYS n 1 368 GLN n 1 369 LEU n 1 370 SER n 1 371 GLU n 1 372 LYS n 1 373 PHE n 1 374 PHE n 1 375 LYS n 1 376 ALA n 1 377 ALA n 1 378 SER n 1 379 ASN n 1 380 CYS n 1 381 GLY n 1 382 ILE n 1 383 VAL n 1 384 GLU n 1 385 SER n 1 386 ILE n 1 387 LEU n 1 388 ASN n 1 389 TRP n 1 390 VAL n 1 391 LYS n 1 392 PHE n 1 393 LYS n 1 394 ALA n 1 395 GLN n 1 396 THR n 1 397 GLN n 1 398 LEU n 1 399 ASN n 1 400 LYS n 1 401 LYS n 1 402 CYS n 1 403 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 403 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TOP2B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TOP2B_HUMAN _struct_ref.pdbx_db_accession Q02880 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVS IDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKH SFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFR SYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAG VSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCS ; _struct_ref.pdbx_align_begin 50 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QFN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 403 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q02880 _struct_ref_seq.db_align_beg 50 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 449 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 45 _struct_ref_seq.pdbx_auth_seq_align_end 444 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QFN SER A 1 ? UNP Q02880 ? ? 'expression tag' 42 1 1 7QFN ASN A 2 ? UNP Q02880 ? ? 'expression tag' 43 2 1 7QFN ALA A 3 ? UNP Q02880 ? ? 'expression tag' 44 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QFN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulphate, 0.1 M bis tris (pH 5.5), 25 % w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-07-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9796 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9796 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7QFN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.62 _reflns.d_resolution_low 89.22 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12596 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.62 _reflns_shell.d_res_low 2.74 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1513 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.78 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.796 _refine.aniso_B[1][2] 0.898 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 1.796 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -5.826 _refine.B_iso_max ? _refine.B_iso_mean 60.189 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.919 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QFN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.621 _refine.ls_d_res_low 89.219 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12583 _refine.ls_number_reflns_R_free 540 _refine.ls_number_reflns_R_work 12043 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.929 _refine.ls_percent_reflns_R_free 4.292 _refine.ls_R_factor_all 0.202 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2588 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1993 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.236 _refine.ls_wR_factor_R_work 0.179 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model D_1292119290 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.673 _refine.pdbx_overall_ESU_R_Free 0.340 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 32.249 _refine.overall_SU_ML 0.300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work 0.9677 _refine.pdbx_average_fsc_free 0.9473 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.621 _refine_hist.d_res_low 89.219 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 2937 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2886 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 2981 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.016 2747 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.935 1.646 4024 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.641 1.570 6419 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 9.256 5.000 357 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 9.812 5.000 11 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.251 10.000 549 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.099 10.000 134 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.083 0.200 448 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 3270 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 579 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.236 0.200 617 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.206 0.200 2689 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.187 0.200 1443 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.094 0.200 1642 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.167 0.200 89 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.032 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.004 0.200 1 ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 0.148 0.200 16 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.190 0.200 76 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.358 0.200 2 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.398 4.574 1437 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.396 4.575 1436 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.242 6.846 1791 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.243 6.847 1792 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.215 5.050 1544 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.179 5.044 1536 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 7.576 7.362 2233 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.557 7.353 2222 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.424 55.309 3335 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 9.423 55.302 3336 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.621 2.689 913 . 46 865 99.7809 . 0.302 . . 0.301 . . . . . 0.278 . 20 . 0.930 0.924 0.306 'X-RAY DIFFRACTION' 2.689 2.762 891 . 46 843 99.7755 . 0.283 . . 0.279 . . . . . 0.263 . 20 . 0.943 0.919 0.354 'X-RAY DIFFRACTION' 2.762 2.842 876 . 13 862 99.8858 . 0.256 . . 0.255 . . . . . 0.232 . 20 . 0.956 0.936 0.319 'X-RAY DIFFRACTION' 2.842 2.930 857 . 39 817 99.8833 . 0.248 . . 0.243 . . . . . 0.222 . 20 . 0.961 0.896 0.358 'X-RAY DIFFRACTION' 2.930 3.026 809 . 38 771 100.0000 . 0.238 . . 0.233 . . . . . 0.210 . 20 . 0.964 0.934 0.368 'X-RAY DIFFRACTION' 3.026 3.132 795 . 46 749 100.0000 . 0.239 . . 0.236 . . . . . 0.206 . 20 . 0.964 0.947 0.273 'X-RAY DIFFRACTION' 3.132 3.250 754 . 25 729 100.0000 . 0.229 . . 0.225 . . . . . 0.194 . 20 . 0.966 0.934 0.326 'X-RAY DIFFRACTION' 3.250 3.382 734 . 31 703 100.0000 . 0.216 . . 0.212 . . . . . 0.189 . 20 . 0.970 0.928 0.307 'X-RAY DIFFRACTION' 3.382 3.532 728 . 33 695 100.0000 . 0.186 . . 0.185 . . . . . 0.165 . 20 . 0.979 0.966 0.211 'X-RAY DIFFRACTION' 3.532 3.705 677 . 23 654 100.0000 . 0.172 . . 0.170 . . . . . 0.153 . 20 . 0.983 0.968 0.226 'X-RAY DIFFRACTION' 3.705 3.905 643 . 24 619 100.0000 . 0.162 . . 0.158 . . . . . 0.141 . 20 . 0.985 0.961 0.252 'X-RAY DIFFRACTION' 3.905 4.141 618 . 28 590 100.0000 . 0.158 . . 0.155 . . . . . 0.137 . 20 . 0.985 0.971 0.222 'X-RAY DIFFRACTION' 4.141 4.426 577 . 21 556 100.0000 . 0.143 . . 0.140 . . . . . 0.130 . 20 . 0.988 0.972 0.235 'X-RAY DIFFRACTION' 4.426 4.780 551 . 26 525 100.0000 . 0.154 . . 0.152 . . . . . 0.142 . 20 . 0.986 0.981 0.182 'X-RAY DIFFRACTION' 4.780 5.235 494 . 21 473 100.0000 . 0.161 . . 0.161 . . . . . 0.153 . 20 . 0.986 0.980 0.172 'X-RAY DIFFRACTION' 5.235 5.850 463 . 28 433 99.5680 . 0.190 . . 0.183 . . . . . 0.168 . 20 . 0.979 0.966 0.278 'X-RAY DIFFRACTION' 5.850 6.750 411 . 19 392 100.0000 . 0.213 . . 0.212 . . . . . 0.198 . 20 . 0.973 0.986 0.235 'X-RAY DIFFRACTION' 6.750 8.255 347 . 15 332 100.0000 . 0.198 . . 0.194 . . . . . 0.189 . 20 . 0.975 0.951 0.313 'X-RAY DIFFRACTION' 8.255 11.625 280 . 10 270 100.0000 . 0.206 . . 0.203 . . . . . 0.202 . 20 . 0.974 0.971 0.288 'X-RAY DIFFRACTION' 11.625 89.219 174 . 8 165 99.4253 . 0.346 . . 0.350 . . . . . 0.353 . 20 . 0.937 0.980 0.257 # _struct.entry_id 7QFN _struct.title 'Human Topoisomerase II Beta ATPase ADP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QFN _struct_keywords.text 'DNA Topoisomerase II Beta, Human, ATPase Domain, TOP2B, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 13 ? ARG A 21 ? THR A 54 ARG A 62 1 ? 9 HELX_P HELX_P2 AA2 ARG A 21 ? GLY A 27 ? ARG A 62 GLY A 68 1 ? 7 HELX_P HELX_P3 AA3 VAL A 53 ? ASP A 74 ? VAL A 94 ASP A 115 1 ? 22 HELX_P HELX_P4 AA4 VAL A 112 ? GLN A 119 ? VAL A 153 GLN A 160 1 ? 8 HELX_P HELX_P5 AA5 GLY A 141 ? PHE A 148 ? GLY A 182 PHE A 189 1 ? 8 HELX_P HELX_P6 AA6 LYS A 159 ? TYR A 161 ? LYS A 200 TYR A 202 5 ? 3 HELX_P HELX_P7 AA7 LEU A 198 ? LYS A 202 ? LEU A 239 LYS A 243 5 ? 5 HELX_P HELX_P8 AA8 ASP A 207 ? CYS A 225 ? ASP A 248 CYS A 266 1 ? 19 HELX_P HELX_P9 AA9 GLY A 241 ? LYS A 251 ? GLY A 282 LYS A 292 1 ? 11 HELX_P HELX_P10 AB1 ARG A 299 ? GLU A 314 ? ARG A 340 GLU A 355 1 ? 16 HELX_P HELX_P11 AB2 LYS A 327 ? ASN A 333 ? LYS A 368 ASN A 374 1 ? 7 HELX_P HELX_P12 AB3 GLN A 359 ? PHE A 363 ? GLN A 400 PHE A 404 5 ? 5 HELX_P HELX_P13 AB4 SER A 370 ? ALA A 377 ? SER A 411 ALA A 418 1 ? 8 HELX_P HELX_P14 AB5 SER A 378 ? CYS A 380 ? SER A 419 CYS A 421 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 E MG . MG ? ? A GLU 103 A MG 504 1_555 ? ? ? ? ? ? ? 2.871 ? ? metalc2 metalc ? ? A ASN 66 OD1 ? ? ? 1_555 E MG . MG ? ? A ASN 107 A MG 504 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc3 metalc ? ? B ADP . O3B ? ? ? 1_555 E MG . MG ? ? A ADP 501 A MG 504 1_555 ? ? ? ? ? ? ? 2.412 ? ? metalc4 metalc ? ? B ADP . O2A ? ? ? 1_555 E MG . MG ? ? A ADP 501 A MG 504 1_555 ? ? ? ? ? ? ? 1.986 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? AA3 ? 8 ? AA4 ? 2 ? AA5 ? 5 ? AA6 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? parallel AA3 7 8 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? parallel AA5 4 5 ? anti-parallel AA6 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 32 ? ASP A 40 ? LEU A 73 ASP A 81 AA1 2 GLY A 44 ? PHE A 52 ? GLY A 85 PHE A 93 AA2 1 LYS A 175 ? THR A 176 ? LYS A 216 THR A 217 AA2 2 HIS A 163 ? MET A 170 ? HIS A 204 MET A 211 AA2 3 LYS A 180 ? HIS A 183 ? LYS A 221 HIS A 224 AA3 1 LYS A 175 ? THR A 176 ? LYS A 216 THR A 217 AA3 2 HIS A 163 ? MET A 170 ? HIS A 204 MET A 211 AA3 3 SER A 149 ? CYS A 158 ? SER A 190 CYS A 199 AA3 4 TYR A 189 ? PRO A 196 ? TYR A 230 PRO A 237 AA3 5 ILE A 90 ? ASN A 96 ? ILE A 131 ASN A 137 AA3 6 CYS A 79 ? ASP A 85 ? CYS A 120 ASP A 126 AA3 7 LYS A 229 ? PHE A 232 ? LYS A 270 PHE A 273 AA3 8 LYS A 235 ? LYS A 236 ? LYS A 276 LYS A 277 AA4 1 GLU A 104 ? HIS A 105 ? GLU A 145 HIS A 146 AA4 2 VAL A 110 ? TYR A 111 ? VAL A 151 TYR A 152 AA5 1 ILE A 264 ? ASN A 269 ? ILE A 305 ASN A 310 AA5 2 TRP A 272 ? LEU A 278 ? TRP A 313 LEU A 319 AA5 3 ILE A 335 ? CYS A 341 ? ILE A 376 CYS A 382 AA5 4 GLN A 284 ? VAL A 289 ? GLN A 325 VAL A 330 AA5 5 ILE A 292 ? ALA A 293 ? ILE A 333 ALA A 334 AA6 1 GLY A 297 ? GLY A 298 ? GLY A 338 GLY A 339 AA6 2 ASN A 355 ? MET A 356 ? ASN A 396 MET A 397 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 38 ? N VAL A 79 O ASN A 46 ? O ASN A 87 AA2 1 2 O LYS A 175 ? O LYS A 216 N MET A 170 ? N MET A 211 AA2 2 3 N LYS A 166 ? N LYS A 207 O LYS A 180 ? O LYS A 221 AA3 1 2 O LYS A 175 ? O LYS A 216 N MET A 170 ? N MET A 211 AA3 2 3 O PHE A 165 ? O PHE A 206 N THR A 156 ? N THR A 197 AA3 3 4 N THR A 153 ? N THR A 194 O THR A 193 ? O THR A 234 AA3 4 5 O THR A 190 ? O THR A 231 N ASN A 95 ? N ASN A 136 AA3 5 6 O ILE A 90 ? O ILE A 131 N ASP A 85 ? N ASP A 126 AA3 6 7 N VAL A 82 ? N VAL A 123 O MET A 231 ? O MET A 272 AA3 7 8 N PHE A 232 ? N PHE A 273 O LYS A 235 ? O LYS A 276 AA4 1 2 N HIS A 105 ? N HIS A 146 O VAL A 110 ? O VAL A 151 AA5 1 2 N ILE A 264 ? N ILE A 305 O LEU A 276 ? O LEU A 317 AA5 2 3 N CYS A 275 ? N CYS A 316 O PHE A 338 ? O PHE A 379 AA5 3 4 O CYS A 341 ? O CYS A 382 N PHE A 288 ? N PHE A 329 AA5 4 5 N VAL A 289 ? N VAL A 330 O ILE A 292 ? O ILE A 333 AA6 1 2 N GLY A 297 ? N GLY A 338 O MET A 356 ? O MET A 397 # _atom_sites.entry_id 7QFN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009707 _atom_sites.fract_transf_matrix[1][2] 0.005604 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011208 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014994 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 MG 12 12 5.427 2.828 2.176 79.261 1.228 0.381 2.310 7.194 0.935 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 P 15 15 6.435 1.907 4.179 27.157 1.780 0.526 1.491 68.164 1.268 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.050 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 42 ? ? ? A . n A 1 2 ASN 2 43 ? ? ? A . n A 1 3 ALA 3 44 ? ? ? A . n A 1 4 SER 4 45 ? ? ? A . n A 1 5 VAL 5 46 ? ? ? A . n A 1 6 GLU 6 47 47 GLU GLU A . n A 1 7 ARG 7 48 48 ARG ARG A . n A 1 8 VAL 8 49 49 VAL VAL A . n A 1 9 TYR 9 50 50 TYR TYR A . n A 1 10 GLN 10 51 51 GLN GLN A . n A 1 11 LYS 11 52 52 LYS LYS A . n A 1 12 LYS 12 53 53 LYS LYS A . n A 1 13 THR 13 54 54 THR THR A . n A 1 14 GLN 14 55 55 GLN GLN A . n A 1 15 LEU 15 56 56 LEU LEU A . n A 1 16 GLU 16 57 57 GLU GLU A . n A 1 17 HIS 17 58 58 HIS HIS A . n A 1 18 ILE 18 59 59 ILE ILE A . n A 1 19 LEU 19 60 60 LEU LEU A . n A 1 20 LEU 20 61 61 LEU LEU A . n A 1 21 ARG 21 62 62 ARG ARG A . n A 1 22 PRO 22 63 63 PRO PRO A . n A 1 23 ASP 23 64 64 ASP ASP A . n A 1 24 THR 24 65 65 THR THR A . n A 1 25 TYR 25 66 66 TYR TYR A . n A 1 26 ILE 26 67 67 ILE ILE A . n A 1 27 GLY 27 68 68 GLY GLY A . n A 1 28 SER 28 69 69 SER SER A . n A 1 29 VAL 29 70 70 VAL VAL A . n A 1 30 GLU 30 71 71 GLU GLU A . n A 1 31 PRO 31 72 72 PRO PRO A . n A 1 32 LEU 32 73 73 LEU LEU A . n A 1 33 THR 33 74 74 THR THR A . n A 1 34 GLN 34 75 75 GLN GLN A . n A 1 35 PHE 35 76 76 PHE PHE A . n A 1 36 MET 36 77 77 MET MET A . n A 1 37 TRP 37 78 78 TRP TRP A . n A 1 38 VAL 38 79 79 VAL VAL A . n A 1 39 TYR 39 80 80 TYR TYR A . n A 1 40 ASP 40 81 81 ASP ASP A . n A 1 41 GLU 41 82 82 GLU GLU A . n A 1 42 ASP 42 83 83 ASP ASP A . n A 1 43 VAL 43 84 84 VAL VAL A . n A 1 44 GLY 44 85 85 GLY GLY A . n A 1 45 MET 45 86 86 MET MET A . n A 1 46 ASN 46 87 87 ASN ASN A . n A 1 47 CYS 47 88 88 CYS CYS A . n A 1 48 ARG 48 89 89 ARG ARG A . n A 1 49 GLU 49 90 90 GLU GLU A . n A 1 50 VAL 50 91 91 VAL VAL A . n A 1 51 THR 51 92 92 THR THR A . n A 1 52 PHE 52 93 93 PHE PHE A . n A 1 53 VAL 53 94 94 VAL VAL A . n A 1 54 PRO 54 95 95 PRO PRO A . n A 1 55 GLY 55 96 96 GLY GLY A . n A 1 56 LEU 56 97 97 LEU LEU A . n A 1 57 TYR 57 98 98 TYR TYR A . n A 1 58 LYS 58 99 99 LYS LYS A . n A 1 59 ILE 59 100 100 ILE ILE A . n A 1 60 PHE 60 101 101 PHE PHE A . n A 1 61 ASP 61 102 102 ASP ASP A . n A 1 62 GLU 62 103 103 GLU GLU A . n A 1 63 ILE 63 104 104 ILE ILE A . n A 1 64 LEU 64 105 105 LEU LEU A . n A 1 65 VAL 65 106 106 VAL VAL A . n A 1 66 ASN 66 107 107 ASN ASN A . n A 1 67 ALA 67 108 108 ALA ALA A . n A 1 68 ALA 68 109 109 ALA ALA A . n A 1 69 ASP 69 110 110 ASP ASP A . n A 1 70 ASN 70 111 111 ASN ASN A . n A 1 71 LYS 71 112 112 LYS LYS A . n A 1 72 GLN 72 113 113 GLN GLN A . n A 1 73 ARG 73 114 114 ARG ARG A . n A 1 74 ASP 74 115 115 ASP ASP A . n A 1 75 LYS 75 116 116 LYS LYS A . n A 1 76 ASN 76 117 117 ASN ASN A . n A 1 77 MET 77 118 118 MET MET A . n A 1 78 THR 78 119 119 THR THR A . n A 1 79 CYS 79 120 120 CYS CYS A . n A 1 80 ILE 80 121 121 ILE ILE A . n A 1 81 LYS 81 122 122 LYS LYS A . n A 1 82 VAL 82 123 123 VAL VAL A . n A 1 83 SER 83 124 124 SER SER A . n A 1 84 ILE 84 125 125 ILE ILE A . n A 1 85 ASP 85 126 126 ASP ASP A . n A 1 86 PRO 86 127 127 PRO PRO A . n A 1 87 GLU 87 128 128 GLU GLU A . n A 1 88 SER 88 129 129 SER SER A . n A 1 89 ASN 89 130 130 ASN ASN A . n A 1 90 ILE 90 131 131 ILE ILE A . n A 1 91 ILE 91 132 132 ILE ILE A . n A 1 92 SER 92 133 133 SER SER A . n A 1 93 ILE 93 134 134 ILE ILE A . n A 1 94 TRP 94 135 135 TRP TRP A . n A 1 95 ASN 95 136 136 ASN ASN A . n A 1 96 ASN 96 137 137 ASN ASN A . n A 1 97 GLY 97 138 138 GLY GLY A . n A 1 98 LYS 98 139 139 LYS LYS A . n A 1 99 GLY 99 140 140 GLY GLY A . n A 1 100 ILE 100 141 141 ILE ILE A . n A 1 101 PRO 101 142 142 PRO PRO A . n A 1 102 VAL 102 143 143 VAL VAL A . n A 1 103 VAL 103 144 144 VAL VAL A . n A 1 104 GLU 104 145 145 GLU GLU A . n A 1 105 HIS 105 146 146 HIS HIS A . n A 1 106 LYS 106 147 147 LYS LYS A . n A 1 107 VAL 107 148 148 VAL VAL A . n A 1 108 GLU 108 149 149 GLU GLU A . n A 1 109 LYS 109 150 150 LYS LYS A . n A 1 110 VAL 110 151 151 VAL VAL A . n A 1 111 TYR 111 152 152 TYR TYR A . n A 1 112 VAL 112 153 153 VAL VAL A . n A 1 113 PRO 113 154 154 PRO PRO A . n A 1 114 ALA 114 155 155 ALA ALA A . n A 1 115 LEU 115 156 156 LEU LEU A . n A 1 116 ILE 116 157 157 ILE ILE A . n A 1 117 PHE 117 158 158 PHE PHE A . n A 1 118 GLY 118 159 159 GLY GLY A . n A 1 119 GLN 119 160 160 GLN GLN A . n A 1 120 LEU 120 161 161 LEU LEU A . n A 1 121 LEU 121 162 162 LEU LEU A . n A 1 122 THR 122 163 163 THR THR A . n A 1 123 SER 123 164 164 SER SER A . n A 1 124 SER 124 165 165 SER SER A . n A 1 125 ASN 125 166 166 ASN ASN A . n A 1 126 TYR 126 167 167 TYR TYR A . n A 1 127 ASP 127 168 168 ASP ASP A . n A 1 128 ASP 128 169 ? ? ? A . n A 1 129 ASP 129 170 ? ? ? A . n A 1 130 GLU 130 171 ? ? ? A . n A 1 131 LYS 131 172 ? ? ? A . n A 1 132 LYS 132 173 ? ? ? A . n A 1 133 VAL 133 174 174 VAL VAL A . n A 1 134 THR 134 175 175 THR THR A . n A 1 135 GLY 135 176 176 GLY GLY A . n A 1 136 GLY 136 177 177 GLY GLY A . n A 1 137 ARG 137 178 178 ARG ARG A . n A 1 138 ASN 138 179 179 ASN ASN A . n A 1 139 GLY 139 180 180 GLY GLY A . n A 1 140 TYR 140 181 181 TYR TYR A . n A 1 141 GLY 141 182 182 GLY GLY A . n A 1 142 ALA 142 183 183 ALA ALA A . n A 1 143 LYS 143 184 184 LYS LYS A . n A 1 144 LEU 144 185 185 LEU LEU A . n A 1 145 CYS 145 186 186 CYS CYS A . n A 1 146 ASN 146 187 187 ASN ASN A . n A 1 147 ILE 147 188 188 ILE ILE A . n A 1 148 PHE 148 189 189 PHE PHE A . n A 1 149 SER 149 190 190 SER SER A . n A 1 150 THR 150 191 191 THR THR A . n A 1 151 LYS 151 192 192 LYS LYS A . n A 1 152 PHE 152 193 193 PHE PHE A . n A 1 153 THR 153 194 194 THR THR A . n A 1 154 VAL 154 195 195 VAL VAL A . n A 1 155 GLU 155 196 196 GLU GLU A . n A 1 156 THR 156 197 197 THR THR A . n A 1 157 ALA 157 198 198 ALA ALA A . n A 1 158 CYS 158 199 199 CYS CYS A . n A 1 159 LYS 159 200 200 LYS LYS A . n A 1 160 GLU 160 201 201 GLU GLU A . n A 1 161 TYR 161 202 202 TYR TYR A . n A 1 162 LYS 162 203 203 LYS LYS A . n A 1 163 HIS 163 204 204 HIS HIS A . n A 1 164 SER 164 205 205 SER SER A . n A 1 165 PHE 165 206 206 PHE PHE A . n A 1 166 LYS 166 207 207 LYS LYS A . n A 1 167 GLN 167 208 208 GLN GLN A . n A 1 168 THR 168 209 209 THR THR A . n A 1 169 TRP 169 210 210 TRP TRP A . n A 1 170 MET 170 211 211 MET MET A . n A 1 171 ASN 171 212 212 ASN ASN A . n A 1 172 ASN 172 213 213 ASN ASN A . n A 1 173 MET 173 214 214 MET MET A . n A 1 174 MET 174 215 215 MET MET A . n A 1 175 LYS 175 216 216 LYS LYS A . n A 1 176 THR 176 217 217 THR THR A . n A 1 177 SER 177 218 218 SER SER A . n A 1 178 GLU 178 219 219 GLU GLU A . n A 1 179 ALA 179 220 220 ALA ALA A . n A 1 180 LYS 180 221 221 LYS LYS A . n A 1 181 ILE 181 222 222 ILE ILE A . n A 1 182 LYS 182 223 223 LYS LYS A . n A 1 183 HIS 183 224 224 HIS HIS A . n A 1 184 PHE 184 225 225 PHE PHE A . n A 1 185 ASP 185 226 226 ASP ASP A . n A 1 186 GLY 186 227 227 GLY GLY A . n A 1 187 GLU 187 228 228 GLU GLU A . n A 1 188 ASP 188 229 229 ASP ASP A . n A 1 189 TYR 189 230 230 TYR TYR A . n A 1 190 THR 190 231 231 THR THR A . n A 1 191 CYS 191 232 232 CYS CYS A . n A 1 192 ILE 192 233 233 ILE ILE A . n A 1 193 THR 193 234 234 THR THR A . n A 1 194 PHE 194 235 235 PHE PHE A . n A 1 195 GLN 195 236 236 GLN GLN A . n A 1 196 PRO 196 237 237 PRO PRO A . n A 1 197 ASP 197 238 238 ASP ASP A . n A 1 198 LEU 198 239 239 LEU LEU A . n A 1 199 SER 199 240 240 SER SER A . n A 1 200 LYS 200 241 241 LYS LYS A . n A 1 201 PHE 201 242 242 PHE PHE A . n A 1 202 LYS 202 243 243 LYS LYS A . n A 1 203 MET 203 244 244 MET MET A . n A 1 204 GLU 204 245 245 GLU GLU A . n A 1 205 LYS 205 246 246 LYS LYS A . n A 1 206 LEU 206 247 247 LEU LEU A . n A 1 207 ASP 207 248 248 ASP ASP A . n A 1 208 LYS 208 249 249 LYS LYS A . n A 1 209 ASP 209 250 250 ASP ASP A . n A 1 210 ILE 210 251 251 ILE ILE A . n A 1 211 VAL 211 252 252 VAL VAL A . n A 1 212 ALA 212 253 253 ALA ALA A . n A 1 213 LEU 213 254 254 LEU LEU A . n A 1 214 MET 214 255 255 MET MET A . n A 1 215 THR 215 256 256 THR THR A . n A 1 216 ARG 216 257 257 ARG ARG A . n A 1 217 ARG 217 258 258 ARG ARG A . n A 1 218 ALA 218 259 259 ALA ALA A . n A 1 219 TYR 219 260 260 TYR TYR A . n A 1 220 ASP 220 261 261 ASP ASP A . n A 1 221 LEU 221 262 262 LEU LEU A . n A 1 222 ALA 222 263 263 ALA ALA A . n A 1 223 GLY 223 264 264 GLY GLY A . n A 1 224 SER 224 265 265 SER SER A . n A 1 225 CYS 225 266 266 CYS CYS A . n A 1 226 ARG 226 267 267 ARG ARG A . n A 1 227 GLY 227 268 268 GLY GLY A . n A 1 228 VAL 228 269 269 VAL VAL A . n A 1 229 LYS 229 270 270 LYS LYS A . n A 1 230 VAL 230 271 271 VAL VAL A . n A 1 231 MET 231 272 272 MET MET A . n A 1 232 PHE 232 273 273 PHE PHE A . n A 1 233 ASN 233 274 274 ASN ASN A . n A 1 234 GLY 234 275 275 GLY GLY A . n A 1 235 LYS 235 276 276 LYS LYS A . n A 1 236 LYS 236 277 277 LYS LYS A . n A 1 237 LEU 237 278 278 LEU LEU A . n A 1 238 PRO 238 279 279 PRO PRO A . n A 1 239 VAL 239 280 280 VAL VAL A . n A 1 240 ASN 240 281 281 ASN ASN A . n A 1 241 GLY 241 282 282 GLY GLY A . n A 1 242 PHE 242 283 283 PHE PHE A . n A 1 243 ARG 243 284 284 ARG ARG A . n A 1 244 SER 244 285 285 SER SER A . n A 1 245 TYR 245 286 286 TYR TYR A . n A 1 246 VAL 246 287 287 VAL VAL A . n A 1 247 ASP 247 288 288 ASP ASP A . n A 1 248 LEU 248 289 289 LEU LEU A . n A 1 249 TYR 249 290 290 TYR TYR A . n A 1 250 VAL 250 291 291 VAL VAL A . n A 1 251 LYS 251 292 292 LYS LYS A . n A 1 252 ASP 252 293 293 ASP ASP A . n A 1 253 LYS 253 294 294 LYS LYS A . n A 1 254 LEU 254 295 295 LEU LEU A . n A 1 255 ASP 255 296 296 ASP ASP A . n A 1 256 GLU 256 297 297 GLU GLU A . n A 1 257 THR 257 298 298 THR THR A . n A 1 258 GLY 258 299 299 GLY GLY A . n A 1 259 VAL 259 300 300 VAL VAL A . n A 1 260 ALA 260 301 301 ALA ALA A . n A 1 261 LEU 261 302 302 LEU LEU A . n A 1 262 LYS 262 303 303 LYS LYS A . n A 1 263 VAL 263 304 304 VAL VAL A . n A 1 264 ILE 264 305 305 ILE ILE A . n A 1 265 HIS 265 306 306 HIS HIS A . n A 1 266 GLU 266 307 307 GLU GLU A . n A 1 267 LEU 267 308 308 LEU LEU A . n A 1 268 ALA 268 309 309 ALA ALA A . n A 1 269 ASN 269 310 310 ASN ASN A . n A 1 270 GLU 270 311 311 GLU GLU A . n A 1 271 ARG 271 312 312 ARG ARG A . n A 1 272 TRP 272 313 313 TRP TRP A . n A 1 273 ASP 273 314 314 ASP ASP A . n A 1 274 VAL 274 315 315 VAL VAL A . n A 1 275 CYS 275 316 316 CYS CYS A . n A 1 276 LEU 276 317 317 LEU LEU A . n A 1 277 THR 277 318 318 THR THR A . n A 1 278 LEU 278 319 319 LEU LEU A . n A 1 279 SER 279 320 320 SER SER A . n A 1 280 GLU 280 321 321 GLU GLU A . n A 1 281 LYS 281 322 322 LYS LYS A . n A 1 282 GLY 282 323 323 GLY GLY A . n A 1 283 PHE 283 324 324 PHE PHE A . n A 1 284 GLN 284 325 325 GLN GLN A . n A 1 285 GLN 285 326 326 GLN GLN A . n A 1 286 ILE 286 327 327 ILE ILE A . n A 1 287 SER 287 328 328 SER SER A . n A 1 288 PHE 288 329 329 PHE PHE A . n A 1 289 VAL 289 330 330 VAL VAL A . n A 1 290 ASN 290 331 331 ASN ASN A . n A 1 291 SER 291 332 332 SER SER A . n A 1 292 ILE 292 333 333 ILE ILE A . n A 1 293 ALA 293 334 334 ALA ALA A . n A 1 294 THR 294 335 335 THR THR A . n A 1 295 THR 295 336 336 THR THR A . n A 1 296 LYS 296 337 337 LYS LYS A . n A 1 297 GLY 297 338 338 GLY GLY A . n A 1 298 GLY 298 339 339 GLY GLY A . n A 1 299 ARG 299 340 340 ARG ARG A . n A 1 300 HIS 300 341 341 HIS HIS A . n A 1 301 VAL 301 342 342 VAL VAL A . n A 1 302 ASP 302 343 343 ASP ASP A . n A 1 303 TYR 303 344 344 TYR TYR A . n A 1 304 VAL 304 345 345 VAL VAL A . n A 1 305 VAL 305 346 346 VAL VAL A . n A 1 306 ASP 306 347 347 ASP ASP A . n A 1 307 GLN 307 348 348 GLN GLN A . n A 1 308 VAL 308 349 349 VAL VAL A . n A 1 309 VAL 309 350 350 VAL VAL A . n A 1 310 GLY 310 351 351 GLY GLY A . n A 1 311 LYS 311 352 352 LYS LYS A . n A 1 312 LEU 312 353 353 LEU LEU A . n A 1 313 ILE 313 354 354 ILE ILE A . n A 1 314 GLU 314 355 355 GLU GLU A . n A 1 315 VAL 315 356 ? ? ? A . n A 1 316 VAL 316 357 ? ? ? A . n A 1 317 LYS 317 358 ? ? ? A . n A 1 318 LYS 318 359 ? ? ? A . n A 1 319 LYS 319 360 ? ? ? A . n A 1 320 ASN 320 361 ? ? ? A . n A 1 321 LYS 321 362 ? ? ? A . n A 1 322 ALA 322 363 ? ? ? A . n A 1 323 GLY 323 364 ? ? ? A . n A 1 324 VAL 324 365 ? ? ? A . n A 1 325 SER 325 366 ? ? ? A . n A 1 326 VAL 326 367 367 VAL VAL A . n A 1 327 LYS 327 368 368 LYS LYS A . n A 1 328 PRO 328 369 369 PRO PRO A . n A 1 329 PHE 329 370 370 PHE PHE A . n A 1 330 GLN 330 371 371 GLN GLN A . n A 1 331 VAL 331 372 372 VAL VAL A . n A 1 332 LYS 332 373 373 LYS LYS A . n A 1 333 ASN 333 374 374 ASN ASN A . n A 1 334 HIS 334 375 375 HIS HIS A . n A 1 335 ILE 335 376 376 ILE ILE A . n A 1 336 TRP 336 377 377 TRP TRP A . n A 1 337 VAL 337 378 378 VAL VAL A . n A 1 338 PHE 338 379 379 PHE PHE A . n A 1 339 ILE 339 380 380 ILE ILE A . n A 1 340 ASN 340 381 381 ASN ASN A . n A 1 341 CYS 341 382 382 CYS CYS A . n A 1 342 LEU 342 383 383 LEU LEU A . n A 1 343 ILE 343 384 384 ILE ILE A . n A 1 344 GLU 344 385 385 GLU GLU A . n A 1 345 ASN 345 386 386 ASN ASN A . n A 1 346 PRO 346 387 387 PRO PRO A . n A 1 347 THR 347 388 388 THR THR A . n A 1 348 PHE 348 389 389 PHE PHE A . n A 1 349 ASP 349 390 390 ASP ASP A . n A 1 350 SER 350 391 391 SER SER A . n A 1 351 GLN 351 392 392 GLN GLN A . n A 1 352 THR 352 393 393 THR THR A . n A 1 353 LYS 353 394 394 LYS LYS A . n A 1 354 GLU 354 395 395 GLU GLU A . n A 1 355 ASN 355 396 396 ASN ASN A . n A 1 356 MET 356 397 397 MET MET A . n A 1 357 THR 357 398 398 THR THR A . n A 1 358 LEU 358 399 399 LEU LEU A . n A 1 359 GLN 359 400 400 GLN GLN A . n A 1 360 PRO 360 401 401 PRO PRO A . n A 1 361 LYS 361 402 402 LYS LYS A . n A 1 362 SER 362 403 403 SER SER A . n A 1 363 PHE 363 404 404 PHE PHE A . n A 1 364 GLY 364 405 405 GLY GLY A . n A 1 365 SER 365 406 406 SER SER A . n A 1 366 LYS 366 407 407 LYS LYS A . n A 1 367 CYS 367 408 408 CYS CYS A . n A 1 368 GLN 368 409 409 GLN GLN A . n A 1 369 LEU 369 410 410 LEU LEU A . n A 1 370 SER 370 411 411 SER SER A . n A 1 371 GLU 371 412 412 GLU GLU A . n A 1 372 LYS 372 413 413 LYS LYS A . n A 1 373 PHE 373 414 414 PHE PHE A . n A 1 374 PHE 374 415 415 PHE PHE A . n A 1 375 LYS 375 416 416 LYS LYS A . n A 1 376 ALA 376 417 417 ALA ALA A . n A 1 377 ALA 377 418 418 ALA ALA A . n A 1 378 SER 378 419 419 SER SER A . n A 1 379 ASN 379 420 420 ASN ASN A . n A 1 380 CYS 380 421 421 CYS CYS A . n A 1 381 GLY 381 422 422 GLY GLY A . n A 1 382 ILE 382 423 ? ? ? A . n A 1 383 VAL 383 424 ? ? ? A . n A 1 384 GLU 384 425 ? ? ? A . n A 1 385 SER 385 426 ? ? ? A . n A 1 386 ILE 386 427 ? ? ? A . n A 1 387 LEU 387 428 ? ? ? A . n A 1 388 ASN 388 429 ? ? ? A . n A 1 389 TRP 389 430 ? ? ? A . n A 1 390 VAL 390 431 ? ? ? A . n A 1 391 LYS 391 432 ? ? ? A . n A 1 392 PHE 392 433 ? ? ? A . n A 1 393 LYS 393 434 ? ? ? A . n A 1 394 ALA 394 435 ? ? ? A . n A 1 395 GLN 395 436 ? ? ? A . n A 1 396 THR 396 437 ? ? ? A . n A 1 397 GLN 397 438 ? ? ? A . n A 1 398 LEU 398 439 ? ? ? A . n A 1 399 ASN 399 440 ? ? ? A . n A 1 400 LYS 400 441 ? ? ? A . n A 1 401 LYS 401 442 ? ? ? A . n A 1 402 CYS 402 443 ? ? ? A . n A 1 403 SER 403 444 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email caroline.austin@newcastle.ac.uk _pdbx_contact_author.name_first Caroline _pdbx_contact_author.name_last Austin _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1921-5947 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ADP 1 501 501 ADP ADP A . C 3 SO4 1 502 1 SO4 SO4 A . D 3 SO4 1 503 2 SO4 SO4 A . E 4 MG 1 504 1 MG MG A . F 5 HOH 1 601 14 HOH HOH A . F 5 HOH 2 602 3 HOH HOH A . F 5 HOH 3 603 5 HOH HOH A . F 5 HOH 4 604 1 HOH HOH A . F 5 HOH 5 605 11 HOH HOH A . F 5 HOH 6 606 4 HOH HOH A . F 5 HOH 7 607 7 HOH HOH A . F 5 HOH 8 608 8 HOH HOH A . F 5 HOH 9 609 2 HOH HOH A . F 5 HOH 10 610 9 HOH HOH A . F 5 HOH 11 611 13 HOH HOH A . F 5 HOH 12 612 10 HOH HOH A . F 5 HOH 13 613 6 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6800 ? 1 MORE -112 ? 1 'SSA (A^2)' 31210 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 62 ? A GLU 103 ? 1_555 MG ? E MG . ? A MG 504 ? 1_555 OD1 ? A ASN 66 ? A ASN 107 ? 1_555 125.3 ? 2 OE2 ? A GLU 62 ? A GLU 103 ? 1_555 MG ? E MG . ? A MG 504 ? 1_555 O3B ? B ADP . ? A ADP 501 ? 1_555 150.1 ? 3 OD1 ? A ASN 66 ? A ASN 107 ? 1_555 MG ? E MG . ? A MG 504 ? 1_555 O3B ? B ADP . ? A ADP 501 ? 1_555 81.5 ? 4 OE2 ? A GLU 62 ? A GLU 103 ? 1_555 MG ? E MG . ? A MG 504 ? 1_555 O2A ? B ADP . ? A ADP 501 ? 1_555 105.1 ? 5 OD1 ? A ASN 66 ? A ASN 107 ? 1_555 MG ? E MG . ? A MG 504 ? 1_555 O2A ? B ADP . ? A ADP 501 ? 1_555 80.7 ? 6 O3B ? B ADP . ? A ADP 501 ? 1_555 MG ? E MG . ? A MG 504 ? 1_555 O2A ? B ADP . ? A ADP 501 ? 1_555 62.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-05-25 2 'Structure model' 1 1 2022-11-30 3 'Structure model' 2 0 2023-03-01 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' author 'Coordinate replacement' 'Chirality error' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' Advisory 4 3 'Structure model' 'Atomic model' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Derived calculations' 7 3 'Structure model' 'Refinement description' 8 3 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_type 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 3 'Structure model' atom_site 5 3 'Structure model' atom_site_anisotrop 6 3 'Structure model' database_PDB_caveat 7 3 'Structure model' entity_src_gen 8 3 'Structure model' pdbx_initial_refinement_model 9 3 'Structure model' pdbx_nonpoly_scheme 10 3 'Structure model' pdbx_refine_tls 11 3 'Structure model' pdbx_refine_tls_group 12 3 'Structure model' pdbx_struct_assembly 13 3 'Structure model' pdbx_struct_assembly_prop 14 3 'Structure model' pdbx_struct_conn_angle 15 3 'Structure model' pdbx_struct_sheet_hbond 16 3 'Structure model' pdbx_validate_chiral 17 3 'Structure model' pdbx_validate_close_contact 18 3 'Structure model' pdbx_validate_peptide_omega 19 3 'Structure model' pdbx_validate_planes 20 3 'Structure model' pdbx_validate_rmsd_angle 21 3 'Structure model' pdbx_validate_rmsd_bond 22 3 'Structure model' pdbx_validate_torsion 23 3 'Structure model' refine 24 3 'Structure model' refine_ls_restr 25 3 'Structure model' refine_ls_shell 26 3 'Structure model' software 27 3 'Structure model' struct_conf 28 3 'Structure model' struct_conn 29 3 'Structure model' struct_sheet 30 3 'Structure model' struct_sheet_order 31 3 'Structure model' struct_sheet_range # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_type.pdbx_N_electrons' 2 2 'Structure model' '_atom_type.pdbx_scat_Z' 3 2 'Structure model' '_citation.country' 4 2 'Structure model' '_citation.journal_abbrev' 5 2 'Structure model' '_citation.journal_id_ASTM' 6 2 'Structure model' '_citation.journal_id_CSD' 7 2 'Structure model' '_citation.journal_id_ISSN' 8 2 'Structure model' '_citation.journal_volume' 9 2 'Structure model' '_citation.page_first' 10 2 'Structure model' '_citation.page_last' 11 2 'Structure model' '_citation.pdbx_database_id_DOI' 12 2 'Structure model' '_citation.pdbx_database_id_PubMed' 13 2 'Structure model' '_citation.title' 14 2 'Structure model' '_citation.year' 15 3 'Structure model' '_entity_src_gen.gene_src_common_name' 16 3 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 17 3 'Structure model' '_pdbx_struct_assembly.details' 18 3 'Structure model' '_pdbx_struct_assembly.method_details' 19 3 'Structure model' '_pdbx_struct_assembly_prop.value' 20 3 'Structure model' '_pdbx_struct_conn_angle.value' 21 3 'Structure model' '_pdbx_validate_close_contact.dist' 22 3 'Structure model' '_refine.B_iso_mean' 23 3 'Structure model' '_refine.aniso_B[1][1]' 24 3 'Structure model' '_refine.aniso_B[1][2]' 25 3 'Structure model' '_refine.aniso_B[2][2]' 26 3 'Structure model' '_refine.aniso_B[3][3]' 27 3 'Structure model' '_refine.correlation_coeff_Fo_to_Fc' 28 3 'Structure model' '_refine.ls_R_factor_R_free' 29 3 'Structure model' '_refine.ls_R_factor_R_work' 30 3 'Structure model' '_refine.ls_R_factor_all' 31 3 'Structure model' '_refine.ls_wR_factor_R_free' 32 3 'Structure model' '_refine.ls_wR_factor_R_work' 33 3 'Structure model' '_refine.overall_SU_B' 34 3 'Structure model' '_refine.overall_SU_ML' 35 3 'Structure model' '_refine.pdbx_average_fsc_free' 36 3 'Structure model' '_refine.pdbx_average_fsc_work' 37 3 'Structure model' '_refine.pdbx_overall_ESU_R' 38 3 'Structure model' '_refine.pdbx_overall_ESU_R_Free' 39 3 'Structure model' '_refine_ls_shell.R_factor_R_free' 40 3 'Structure model' '_refine_ls_shell.R_factor_R_work' 41 3 'Structure model' '_refine_ls_shell.R_factor_all' 42 3 'Structure model' '_refine_ls_shell.pdbx_fsc_free' 43 3 'Structure model' '_refine_ls_shell.pdbx_fsc_work' 44 3 'Structure model' '_refine_ls_shell.wR_factor_R_work' 45 3 'Structure model' '_software.version' 46 3 'Structure model' '_struct_conn.pdbx_dist_value' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 24.1147 _pdbx_refine_tls.origin_y 28.7573 _pdbx_refine_tls.origin_z 15.0194 _pdbx_refine_tls.T[1][1] 0.0260 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0169 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0095 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0611 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0195 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0424 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.2156 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.6744 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.3695 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.5242 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.1786 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.3959 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0017 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0277 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1795 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0513 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0172 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1169 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1433 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0543 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0155 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 47 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 501 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.selection_details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0352 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? MolProbity ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? pointless ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 7 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 8 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 9 # _pdbx_entry_details.entry_id 7QFN _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 H _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 194 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 234 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 47 ? ? OE1 A GLU 47 ? ? 1.355 1.252 0.103 0.011 N 2 1 CD A GLU 196 ? ? OE2 A GLU 196 ? ? 1.339 1.252 0.087 0.011 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 267 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CD _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 267 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NE _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 267 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 99.12 _pdbx_validate_rmsd_angle.angle_target_value 111.80 _pdbx_validate_rmsd_angle.angle_deviation -12.68 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 64 ? ? -9.80 -60.60 2 1 ASN A 137 ? ? -114.23 -157.66 3 1 ARG A 178 ? ? -168.29 -43.81 4 1 ASN A 310 ? ? -167.10 -165.16 5 1 LYS A 322 ? ? -143.61 47.60 6 1 PHE A 324 ? ? -37.43 123.48 7 1 LYS A 394 ? ? 58.77 14.92 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 SER A 419 ? ? ASN A 420 ? ? -148.64 2 1 ASN A 420 ? ? CYS A 421 ? ? 149.89 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 267 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.130 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 42 ? A SER 1 2 1 Y 1 A ASN 43 ? A ASN 2 3 1 Y 1 A ALA 44 ? A ALA 3 4 1 Y 1 A SER 45 ? A SER 4 5 1 Y 1 A VAL 46 ? A VAL 5 6 1 Y 1 A ASP 169 ? A ASP 128 7 1 Y 1 A ASP 170 ? A ASP 129 8 1 Y 1 A GLU 171 ? A GLU 130 9 1 Y 1 A LYS 172 ? A LYS 131 10 1 Y 1 A LYS 173 ? A LYS 132 11 1 Y 1 A VAL 356 ? A VAL 315 12 1 Y 1 A VAL 357 ? A VAL 316 13 1 Y 1 A LYS 358 ? A LYS 317 14 1 Y 1 A LYS 359 ? A LYS 318 15 1 Y 1 A LYS 360 ? A LYS 319 16 1 Y 1 A ASN 361 ? A ASN 320 17 1 Y 1 A LYS 362 ? A LYS 321 18 1 Y 1 A ALA 363 ? A ALA 322 19 1 Y 1 A GLY 364 ? A GLY 323 20 1 Y 1 A VAL 365 ? A VAL 324 21 1 Y 1 A SER 366 ? A SER 325 22 1 Y 1 A ILE 423 ? A ILE 382 23 1 Y 1 A VAL 424 ? A VAL 383 24 1 Y 1 A GLU 425 ? A GLU 384 25 1 Y 1 A SER 426 ? A SER 385 26 1 Y 1 A ILE 427 ? A ILE 386 27 1 Y 1 A LEU 428 ? A LEU 387 28 1 Y 1 A ASN 429 ? A ASN 388 29 1 Y 1 A TRP 430 ? A TRP 389 30 1 Y 1 A VAL 431 ? A VAL 390 31 1 Y 1 A LYS 432 ? A LYS 391 32 1 Y 1 A PHE 433 ? A PHE 392 33 1 Y 1 A LYS 434 ? A LYS 393 34 1 Y 1 A ALA 435 ? A ALA 394 35 1 Y 1 A GLN 436 ? A GLN 395 36 1 Y 1 A THR 437 ? A THR 396 37 1 Y 1 A GLN 438 ? A GLN 397 38 1 Y 1 A LEU 439 ? A LEU 398 39 1 Y 1 A ASN 440 ? A ASN 399 40 1 Y 1 A LYS 441 ? A LYS 400 41 1 Y 1 A LYS 442 ? A LYS 401 42 1 Y 1 A CYS 443 ? A CYS 402 43 1 Y 1 A SER 444 ? A SER 403 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ADP ? ? ADP ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-DIPHOSPHATE" ADP 3 'SULFATE ION' SO4 4 'MAGNESIUM ION' MG 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code 7QFO _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #