data_7QFU # _entry.id 7QFU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QFU pdb_00007qfu 10.2210/pdb7qfu/pdb WWPDB D_1292119564 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-21 2 'Structure model' 1 1 2024-01-31 3 'Structure model' 1 2 2024-04-03 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_abbrev' 3 3 'Structure model' '_citation.journal_id_ASTM' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' 13 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QFU _pdbx_database_status.recvd_initial_deposition_date 2021-12-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email fvicent.cnrs@univ-amu.fr _pdbx_contact_author.name_first Florence _pdbx_contact_author.name_last Vincent _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8564-4184 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zamboni, V.' 1 ? 'Barelier, S.' 2 ? 'Dixon, R.' 3 ? 'Galley, N.' 4 ? 'Ghanem, A.' 5 ? 'Cahuzac, H.' 6 ? 'Salamaga, B.' 7 ? 'Davis, P.J.' 8 ? 'Mesnage, S.' 9 ? 'Vincent, F.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 298 _citation.language ? _citation.page_first 101915 _citation.page_last 101915 _citation.title 'Molecular basis for substrate recognition and septum cleavage by AtlA, the major N-acetylglucosaminidase of Enterococcus faecalis.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2022.101915 _citation.pdbx_database_id_PubMed 35398351 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Roig-Zamboni, V.' 1 ? primary 'Barelier, S.' 2 ? primary 'Dixon, R.' 3 ? primary 'Galley, N.F.' 4 ? primary 'Ghanem, A.' 5 ? primary 'Nguyen, Q.P.' 6 ? primary 'Cahuzac, H.' 7 ? primary 'Salamaga, B.' 8 ? primary 'Davis, P.J.' 9 ? primary 'Bourne, Y.' 10 ? primary 'Mesnage, S.' 11 ? primary 'Vincent, F.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidoglycan hydrolase' 19696.756 1 ? ? ? 'the C-terminal sequence comprising the residues SHHHHHH is a His-tag' 2 non-polymer syn GLYCEROL 92.094 4 ? ? ? ? 3 water nat water 18.015 186 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSALSPTQSPSEFIAELAR(CSO)AQPIAQANDLYASVMMAQAIVESGWGASTLSKAPNYNLFGIKGSYNGQSVYMDTW EYLNGKWLVKKEPFRKYPSYMESFQDNAHVLKTTSFQAGVYYYAGAWKSNTSSYRDATAWLTGRYATDPSYNAKLNNVIT AYNLTQYDTPSSGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSALSPTQSPSEFIAELARCAQPIAQANDLYASVMMAQAIVESGWGASTLSKAPNYNLFGIKGSYNGQSVYMDTWEYLN GKWLVKKEPFRKYPSYMESFQDNAHVLKTTSFQAGVYYYAGAWKSNTSSYRDATAWLTGRYATDPSYNAKLNNVITAYNL TQYDTPSSGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 ALA n 1 5 LEU n 1 6 SER n 1 7 PRO n 1 8 THR n 1 9 GLN n 1 10 SER n 1 11 PRO n 1 12 SER n 1 13 GLU n 1 14 PHE n 1 15 ILE n 1 16 ALA n 1 17 GLU n 1 18 LEU n 1 19 ALA n 1 20 ARG n 1 21 CSO n 1 22 ALA n 1 23 GLN n 1 24 PRO n 1 25 ILE n 1 26 ALA n 1 27 GLN n 1 28 ALA n 1 29 ASN n 1 30 ASP n 1 31 LEU n 1 32 TYR n 1 33 ALA n 1 34 SER n 1 35 VAL n 1 36 MET n 1 37 MET n 1 38 ALA n 1 39 GLN n 1 40 ALA n 1 41 ILE n 1 42 VAL n 1 43 GLU n 1 44 SER n 1 45 GLY n 1 46 TRP n 1 47 GLY n 1 48 ALA n 1 49 SER n 1 50 THR n 1 51 LEU n 1 52 SER n 1 53 LYS n 1 54 ALA n 1 55 PRO n 1 56 ASN n 1 57 TYR n 1 58 ASN n 1 59 LEU n 1 60 PHE n 1 61 GLY n 1 62 ILE n 1 63 LYS n 1 64 GLY n 1 65 SER n 1 66 TYR n 1 67 ASN n 1 68 GLY n 1 69 GLN n 1 70 SER n 1 71 VAL n 1 72 TYR n 1 73 MET n 1 74 ASP n 1 75 THR n 1 76 TRP n 1 77 GLU n 1 78 TYR n 1 79 LEU n 1 80 ASN n 1 81 GLY n 1 82 LYS n 1 83 TRP n 1 84 LEU n 1 85 VAL n 1 86 LYS n 1 87 LYS n 1 88 GLU n 1 89 PRO n 1 90 PHE n 1 91 ARG n 1 92 LYS n 1 93 TYR n 1 94 PRO n 1 95 SER n 1 96 TYR n 1 97 MET n 1 98 GLU n 1 99 SER n 1 100 PHE n 1 101 GLN n 1 102 ASP n 1 103 ASN n 1 104 ALA n 1 105 HIS n 1 106 VAL n 1 107 LEU n 1 108 LYS n 1 109 THR n 1 110 THR n 1 111 SER n 1 112 PHE n 1 113 GLN n 1 114 ALA n 1 115 GLY n 1 116 VAL n 1 117 TYR n 1 118 TYR n 1 119 TYR n 1 120 ALA n 1 121 GLY n 1 122 ALA n 1 123 TRP n 1 124 LYS n 1 125 SER n 1 126 ASN n 1 127 THR n 1 128 SER n 1 129 SER n 1 130 TYR n 1 131 ARG n 1 132 ASP n 1 133 ALA n 1 134 THR n 1 135 ALA n 1 136 TRP n 1 137 LEU n 1 138 THR n 1 139 GLY n 1 140 ARG n 1 141 TYR n 1 142 ALA n 1 143 THR n 1 144 ASP n 1 145 PRO n 1 146 SER n 1 147 TYR n 1 148 ASN n 1 149 ALA n 1 150 LYS n 1 151 LEU n 1 152 ASN n 1 153 ASN n 1 154 VAL n 1 155 ILE n 1 156 THR n 1 157 ALA n 1 158 TYR n 1 159 ASN n 1 160 LEU n 1 161 THR n 1 162 GLN n 1 163 TYR n 1 164 ASP n 1 165 THR n 1 166 PRO n 1 167 SER n 1 168 SER n 1 169 GLY n 1 170 SER n 1 171 HIS n 1 172 HIS n 1 173 HIS n 1 174 HIS n 1 175 HIS n 1 176 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 176 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene I5Q89_11155 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus faecalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1351 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant LEMO _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 CSO 21 21 21 CSO CSO A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 TRP 136 136 136 TRP TRP A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 THR 165 165 165 THR ALA A . n A 1 166 PRO 166 166 ? ? ? A . n A 1 167 SER 167 167 ? ? ? A . n A 1 168 SER 168 168 ? ? ? A . n A 1 169 GLY 169 169 ? ? ? A . n A 1 170 SER 170 170 ? ? ? A . n A 1 171 HIS 171 171 ? ? ? A . n A 1 172 HIS 172 172 ? ? ? A . n A 1 173 HIS 173 173 ? ? ? A . n A 1 174 HIS 174 174 ? ? ? A . n A 1 175 HIS 175 175 ? ? ? A . n A 1 176 HIS 176 176 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 2 GOL GOL A . C 2 GOL 1 202 6 GOL GOL A . D 2 GOL 1 203 9 GOL GOL A . E 2 GOL 1 204 12 GOL GOL A . F 3 HOH 1 301 262 HOH HOH A . F 3 HOH 2 302 56 HOH HOH A . F 3 HOH 3 303 189 HOH HOH A . F 3 HOH 4 304 168 HOH HOH A . F 3 HOH 5 305 61 HOH HOH A . F 3 HOH 6 306 19 HOH HOH A . F 3 HOH 7 307 83 HOH HOH A . F 3 HOH 8 308 11 HOH HOH A . F 3 HOH 9 309 99 HOH HOH A . F 3 HOH 10 310 112 HOH HOH A . F 3 HOH 11 311 51 HOH HOH A . F 3 HOH 12 312 3 HOH HOH A . F 3 HOH 13 313 26 HOH HOH A . F 3 HOH 14 314 5 HOH HOH A . F 3 HOH 15 315 68 HOH HOH A . F 3 HOH 16 316 32 HOH HOH A . F 3 HOH 17 317 117 HOH HOH A . F 3 HOH 18 318 40 HOH HOH A . F 3 HOH 19 319 52 HOH HOH A . F 3 HOH 20 320 39 HOH HOH A . F 3 HOH 21 321 23 HOH HOH A . F 3 HOH 22 322 12 HOH HOH A . F 3 HOH 23 323 108 HOH HOH A . F 3 HOH 24 324 81 HOH HOH A . F 3 HOH 25 325 17 HOH HOH A . F 3 HOH 26 326 76 HOH HOH A . F 3 HOH 27 327 279 HOH HOH A . F 3 HOH 28 328 119 HOH HOH A . F 3 HOH 29 329 153 HOH HOH A . F 3 HOH 30 330 98 HOH HOH A . F 3 HOH 31 331 84 HOH HOH A . F 3 HOH 32 332 187 HOH HOH A . F 3 HOH 33 333 80 HOH HOH A . F 3 HOH 34 334 24 HOH HOH A . F 3 HOH 35 335 128 HOH HOH A . F 3 HOH 36 336 28 HOH HOH A . F 3 HOH 37 337 131 HOH HOH A . F 3 HOH 38 338 72 HOH HOH A . F 3 HOH 39 339 47 HOH HOH A . F 3 HOH 40 340 159 HOH HOH A . F 3 HOH 41 341 96 HOH HOH A . F 3 HOH 42 342 21 HOH HOH A . F 3 HOH 43 343 4 HOH HOH A . F 3 HOH 44 344 37 HOH HOH A . F 3 HOH 45 345 59 HOH HOH A . F 3 HOH 46 346 88 HOH HOH A . F 3 HOH 47 347 161 HOH HOH A . F 3 HOH 48 348 92 HOH HOH A . F 3 HOH 49 349 93 HOH HOH A . F 3 HOH 50 350 64 HOH HOH A . F 3 HOH 51 351 6 HOH HOH A . F 3 HOH 52 352 205 HOH HOH A . F 3 HOH 53 353 280 HOH HOH A . F 3 HOH 54 354 67 HOH HOH A . F 3 HOH 55 355 45 HOH HOH A . F 3 HOH 56 356 127 HOH HOH A . F 3 HOH 57 357 192 HOH HOH A . F 3 HOH 58 358 116 HOH HOH A . F 3 HOH 59 359 106 HOH HOH A . F 3 HOH 60 360 49 HOH HOH A . F 3 HOH 61 361 20 HOH HOH A . F 3 HOH 62 362 34 HOH HOH A . F 3 HOH 63 363 35 HOH HOH A . F 3 HOH 64 364 90 HOH HOH A . F 3 HOH 65 365 10 HOH HOH A . F 3 HOH 66 366 29 HOH HOH A . F 3 HOH 67 367 149 HOH HOH A . F 3 HOH 68 368 13 HOH HOH A . F 3 HOH 69 369 15 HOH HOH A . F 3 HOH 70 370 62 HOH HOH A . F 3 HOH 71 371 58 HOH HOH A . F 3 HOH 72 372 50 HOH HOH A . F 3 HOH 73 373 9 HOH HOH A . F 3 HOH 74 374 265 HOH HOH A . F 3 HOH 75 375 1 HOH HOH A . F 3 HOH 76 376 38 HOH HOH A . F 3 HOH 77 377 114 HOH HOH A . F 3 HOH 78 378 18 HOH HOH A . F 3 HOH 79 379 30 HOH HOH A . F 3 HOH 80 380 172 HOH HOH A . F 3 HOH 81 381 89 HOH HOH A . F 3 HOH 82 382 102 HOH HOH A . F 3 HOH 83 383 54 HOH HOH A . F 3 HOH 84 384 27 HOH HOH A . F 3 HOH 85 385 44 HOH HOH A . F 3 HOH 86 386 25 HOH HOH A . F 3 HOH 87 387 42 HOH HOH A . F 3 HOH 88 388 158 HOH HOH A . F 3 HOH 89 389 111 HOH HOH A . F 3 HOH 90 390 169 HOH HOH A . F 3 HOH 91 391 82 HOH HOH A . F 3 HOH 92 392 105 HOH HOH A . F 3 HOH 93 393 282 HOH HOH A . F 3 HOH 94 394 201 HOH HOH A . F 3 HOH 95 395 63 HOH HOH A . F 3 HOH 96 396 216 HOH HOH A . F 3 HOH 97 397 57 HOH HOH A . F 3 HOH 98 398 146 HOH HOH A . F 3 HOH 99 399 85 HOH HOH A . F 3 HOH 100 400 113 HOH HOH A . F 3 HOH 101 401 55 HOH HOH A . F 3 HOH 102 402 36 HOH HOH A . F 3 HOH 103 403 46 HOH HOH A . F 3 HOH 104 404 138 HOH HOH A . F 3 HOH 105 405 7 HOH HOH A . F 3 HOH 106 406 8 HOH HOH A . F 3 HOH 107 407 75 HOH HOH A . F 3 HOH 108 408 53 HOH HOH A . F 3 HOH 109 409 124 HOH HOH A . F 3 HOH 110 410 31 HOH HOH A . F 3 HOH 111 411 16 HOH HOH A . F 3 HOH 112 412 41 HOH HOH A . F 3 HOH 113 413 22 HOH HOH A . F 3 HOH 114 414 101 HOH HOH A . F 3 HOH 115 415 77 HOH HOH A . F 3 HOH 116 416 60 HOH HOH A . F 3 HOH 117 417 103 HOH HOH A . F 3 HOH 118 418 145 HOH HOH A . F 3 HOH 119 419 115 HOH HOH A . F 3 HOH 120 420 110 HOH HOH A . F 3 HOH 121 421 2 HOH HOH A . F 3 HOH 122 422 66 HOH HOH A . F 3 HOH 123 423 144 HOH HOH A . F 3 HOH 124 424 260 HOH HOH A . F 3 HOH 125 425 43 HOH HOH A . F 3 HOH 126 426 74 HOH HOH A . F 3 HOH 127 427 70 HOH HOH A . F 3 HOH 128 428 122 HOH HOH A . F 3 HOH 129 429 180 HOH HOH A . F 3 HOH 130 430 175 HOH HOH A . F 3 HOH 131 431 129 HOH HOH A . F 3 HOH 132 432 137 HOH HOH A . F 3 HOH 133 433 202 HOH HOH A . F 3 HOH 134 434 86 HOH HOH A . F 3 HOH 135 435 237 HOH HOH A . F 3 HOH 136 436 143 HOH HOH A . F 3 HOH 137 437 78 HOH HOH A . F 3 HOH 138 438 73 HOH HOH A . F 3 HOH 139 439 197 HOH HOH A . F 3 HOH 140 440 132 HOH HOH A . F 3 HOH 141 441 251 HOH HOH A . F 3 HOH 142 442 91 HOH HOH A . F 3 HOH 143 443 14 HOH HOH A . F 3 HOH 144 444 194 HOH HOH A . F 3 HOH 145 445 152 HOH HOH A . F 3 HOH 146 446 142 HOH HOH A . F 3 HOH 147 447 164 HOH HOH A . F 3 HOH 148 448 276 HOH HOH A . F 3 HOH 149 449 107 HOH HOH A . F 3 HOH 150 450 69 HOH HOH A . F 3 HOH 151 451 87 HOH HOH A . F 3 HOH 152 452 150 HOH HOH A . F 3 HOH 153 453 230 HOH HOH A . F 3 HOH 154 454 277 HOH HOH A . F 3 HOH 155 455 183 HOH HOH A . F 3 HOH 156 456 240 HOH HOH A . F 3 HOH 157 457 212 HOH HOH A . F 3 HOH 158 458 203 HOH HOH A . F 3 HOH 159 459 275 HOH HOH A . F 3 HOH 160 460 224 HOH HOH A . F 3 HOH 161 461 238 HOH HOH A . F 3 HOH 162 462 252 HOH HOH A . F 3 HOH 163 463 118 HOH HOH A . F 3 HOH 164 464 162 HOH HOH A . F 3 HOH 165 465 210 HOH HOH A . F 3 HOH 166 466 95 HOH HOH A . F 3 HOH 167 467 266 HOH HOH A . F 3 HOH 168 468 246 HOH HOH A . F 3 HOH 169 469 79 HOH HOH A . F 3 HOH 170 470 133 HOH HOH A . F 3 HOH 171 471 261 HOH HOH A . F 3 HOH 172 472 130 HOH HOH A . F 3 HOH 173 473 160 HOH HOH A . F 3 HOH 174 474 232 HOH HOH A . F 3 HOH 175 475 104 HOH HOH A . F 3 HOH 176 476 244 HOH HOH A . F 3 HOH 177 477 278 HOH HOH A . F 3 HOH 178 478 156 HOH HOH A . F 3 HOH 179 479 196 HOH HOH A . F 3 HOH 180 480 134 HOH HOH A . F 3 HOH 181 481 208 HOH HOH A . F 3 HOH 182 482 121 HOH HOH A . F 3 HOH 183 483 174 HOH HOH A . F 3 HOH 184 484 181 HOH HOH A . F 3 HOH 185 485 109 HOH HOH A . F 3 HOH 186 486 248 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 165 ? OG1 ? A THR 165 OG1 2 1 Y 1 A THR 165 ? CG2 ? A THR 165 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0230 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7QFU _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.549 _cell.length_a_esd ? _cell.length_b 62.549 _cell.length_b_esd ? _cell.length_c 93.219 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QFU _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QFU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Magnesium chloride, 10% polyethylene glycol (PEG) 3000 and 0.1M Na-Cacodylate pH 6.5.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 120 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9762 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9762 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7QFU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.45 _reflns.d_resolution_low 54 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 38042 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.89 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.45 _reflns_shell.d_res_low 1.47 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1849 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.76 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.3700 _refine.aniso_B[1][2] -0.1900 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -0.3700 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 1.2100 _refine.B_iso_max 110.310 _refine.B_iso_mean 26.0720 _refine.B_iso_min 15.140 _refine.correlation_coeff_Fo_to_Fc 0.9820 _refine.correlation_coeff_Fo_to_Fc_free 0.9760 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QFU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4500 _refine.ls_d_res_low 46.8800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36010 _refine.ls_number_reflns_R_free 1991 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8900 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1326 _refine.ls_R_factor_R_free 0.1677 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1306 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3FI7 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0510 _refine.pdbx_overall_ESU_R_Free 0.0510 _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.7000 _refine.pdbx_solvent_shrinkage_radii 0.7000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.7550 _refine.overall_SU_ML 0.0440 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.4500 _refine_hist.d_res_low 46.8800 _refine_hist.number_atoms_solvent 186 _refine_hist.number_atoms_total 1497 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 162 _refine_hist.pdbx_B_iso_mean_ligand 52.22 _refine_hist.pdbx_B_iso_mean_solvent 43.62 _refine_hist.pdbx_number_atoms_protein 1281 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.014 1397 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 1203 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.861 1.680 1901 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.169 1.681 2824 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.865 5.000 177 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.741 23.088 68 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.354 15.000 212 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.851 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.094 0.200 183 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1560 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 288 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 3.697 3.000 2600 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 31.903 5.000 128 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 20.493 5.000 2618 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.4500 _refine_ls_shell.d_res_low 1.4880 _refine_ls_shell.number_reflns_all 2778 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 115 _refine_ls_shell.number_reflns_R_work 2663 _refine_ls_shell.percent_reflns_obs 99.7800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2710 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2650 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7QFU _struct.title 'Crystal Structure of AtlA catalytic domain from Enterococcus feacalis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QFU _struct_keywords.text 'peptidoglycan hydrolysis, mutants, modelling, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A7T8WFA6_ENTFL _struct_ref.pdbx_db_accession A0A7T8WFA6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SALSPTQSPSEFIAELARCAQPIAQANDLYASVMMAQAIVESGWGASTLSKAPNYNLFGIKGSYNGQSVYMDTWEYLNGK WLVKKEPFRKYPSYMESFQDNAHVLKTTSFQAGVYYYAGAWKSNTSSYRDATAWLTGRYATDPSYNAKLNNVITAYNLTQ YDTPSSG ; _struct_ref.pdbx_align_begin 172 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QFU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A7T8WFA6 _struct_ref_seq.db_align_beg 172 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 338 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 169 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QFU MET A 1 ? UNP A0A7T8WFA6 ? ? 'initiating methionine' 1 1 1 7QFU GLY A 2 ? UNP A0A7T8WFA6 ? ? 'expression tag' 2 2 1 7QFU SER A 170 ? UNP A0A7T8WFA6 ? ? 'expression tag' 170 3 1 7QFU HIS A 171 ? UNP A0A7T8WFA6 ? ? 'expression tag' 171 4 1 7QFU HIS A 172 ? UNP A0A7T8WFA6 ? ? 'expression tag' 172 5 1 7QFU HIS A 173 ? UNP A0A7T8WFA6 ? ? 'expression tag' 173 6 1 7QFU HIS A 174 ? UNP A0A7T8WFA6 ? ? 'expression tag' 174 7 1 7QFU HIS A 175 ? UNP A0A7T8WFA6 ? ? 'expression tag' 175 8 1 7QFU HIS A 176 ? UNP A0A7T8WFA6 ? ? 'expression tag' 176 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 730 ? 1 MORE -3 ? 1 'SSA (A^2)' 8200 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 10 ? ASN A 29 ? SER A 10 ASN A 29 1 ? 20 HELX_P HELX_P2 AA2 TYR A 32 ? GLY A 45 ? TYR A 32 GLY A 45 1 ? 14 HELX_P HELX_P3 AA3 SER A 95 ? THR A 110 ? SER A 95 THR A 110 1 ? 16 HELX_P HELX_P4 AA4 TYR A 119 ? THR A 127 ? TYR A 119 THR A 127 5 ? 9 HELX_P HELX_P5 AA5 SER A 129 ? THR A 138 ? SER A 129 THR A 138 1 ? 10 HELX_P HELX_P6 AA6 SER A 146 ? TYR A 158 ? SER A 146 TYR A 158 1 ? 13 HELX_P HELX_P7 AA7 ASN A 159 ? ASP A 164 ? ASN A 159 ASP A 164 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ARG 20 C ? ? ? 1_555 A CSO 21 N ? ? A ARG 20 A CSO 21 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? A CSO 21 C ? ? ? 1_555 A ALA 22 N ? ? A CSO 21 A ALA 22 1_555 ? ? ? ? ? ? ? 1.327 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CSO _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 21 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id CSO _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 21 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CSO _pdbx_modification_feature.type Hydroxylation _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 6 A . ? SER 6 A PRO 7 A ? PRO 7 A 1 -10.88 2 ALA 54 A . ? ALA 54 A PRO 55 A ? PRO 55 A 1 10.29 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 70 ? LEU A 79 ? SER A 70 LEU A 79 AA1 2 LYS A 82 ? ARG A 91 ? LYS A 82 ARG A 91 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 77 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 77 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 84 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 84 # _pdbx_entry_details.entry_id 7QFU _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 393 ? ? O A HOH 443 ? ? 1.25 2 1 O A HOH 427 ? ? O A HOH 459 ? ? 1.86 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 20 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.113 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSO _pdbx_struct_mod_residue.label_seq_id 21 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSO _pdbx_struct_mod_residue.auth_seq_id 21 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _phasing.method MR # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 486 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.40 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A PRO 166 ? A PRO 166 5 1 Y 1 A SER 167 ? A SER 167 6 1 Y 1 A SER 168 ? A SER 168 7 1 Y 1 A GLY 169 ? A GLY 169 8 1 Y 1 A SER 170 ? A SER 170 9 1 Y 1 A HIS 171 ? A HIS 171 10 1 Y 1 A HIS 172 ? A HIS 172 11 1 Y 1 A HIS 173 ? A HIS 173 12 1 Y 1 A HIS 174 ? A HIS 174 13 1 Y 1 A HIS 175 ? A HIS 175 14 1 Y 1 A HIS 176 ? A HIS 176 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSO N N N N 74 CSO CA C N R 75 CSO CB C N N 76 CSO SG S N N 77 CSO C C N N 78 CSO O O N N 79 CSO OXT O N N 80 CSO OD O N N 81 CSO H H N N 82 CSO H2 H N N 83 CSO HA H N N 84 CSO HB2 H N N 85 CSO HB3 H N N 86 CSO HXT H N N 87 CSO HD H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 GOL C1 C N N 138 GOL O1 O N N 139 GOL C2 C N N 140 GOL O2 O N N 141 GOL C3 C N N 142 GOL O3 O N N 143 GOL H11 H N N 144 GOL H12 H N N 145 GOL HO1 H N N 146 GOL H2 H N N 147 GOL HO2 H N N 148 GOL H31 H N N 149 GOL H32 H N N 150 GOL HO3 H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 PHE N N N N 265 PHE CA C N S 266 PHE C C N N 267 PHE O O N N 268 PHE CB C N N 269 PHE CG C Y N 270 PHE CD1 C Y N 271 PHE CD2 C Y N 272 PHE CE1 C Y N 273 PHE CE2 C Y N 274 PHE CZ C Y N 275 PHE OXT O N N 276 PHE H H N N 277 PHE H2 H N N 278 PHE HA H N N 279 PHE HB2 H N N 280 PHE HB3 H N N 281 PHE HD1 H N N 282 PHE HD2 H N N 283 PHE HE1 H N N 284 PHE HE2 H N N 285 PHE HZ H N N 286 PHE HXT H N N 287 PRO N N N N 288 PRO CA C N S 289 PRO C C N N 290 PRO O O N N 291 PRO CB C N N 292 PRO CG C N N 293 PRO CD C N N 294 PRO OXT O N N 295 PRO H H N N 296 PRO HA H N N 297 PRO HB2 H N N 298 PRO HB3 H N N 299 PRO HG2 H N N 300 PRO HG3 H N N 301 PRO HD2 H N N 302 PRO HD3 H N N 303 PRO HXT H N N 304 SER N N N N 305 SER CA C N S 306 SER C C N N 307 SER O O N N 308 SER CB C N N 309 SER OG O N N 310 SER OXT O N N 311 SER H H N N 312 SER H2 H N N 313 SER HA H N N 314 SER HB2 H N N 315 SER HB3 H N N 316 SER HG H N N 317 SER HXT H N N 318 THR N N N N 319 THR CA C N S 320 THR C C N N 321 THR O O N N 322 THR CB C N R 323 THR OG1 O N N 324 THR CG2 C N N 325 THR OXT O N N 326 THR H H N N 327 THR H2 H N N 328 THR HA H N N 329 THR HB H N N 330 THR HG1 H N N 331 THR HG21 H N N 332 THR HG22 H N N 333 THR HG23 H N N 334 THR HXT H N N 335 TRP N N N N 336 TRP CA C N S 337 TRP C C N N 338 TRP O O N N 339 TRP CB C N N 340 TRP CG C Y N 341 TRP CD1 C Y N 342 TRP CD2 C Y N 343 TRP NE1 N Y N 344 TRP CE2 C Y N 345 TRP CE3 C Y N 346 TRP CZ2 C Y N 347 TRP CZ3 C Y N 348 TRP CH2 C Y N 349 TRP OXT O N N 350 TRP H H N N 351 TRP H2 H N N 352 TRP HA H N N 353 TRP HB2 H N N 354 TRP HB3 H N N 355 TRP HD1 H N N 356 TRP HE1 H N N 357 TRP HE3 H N N 358 TRP HZ2 H N N 359 TRP HZ3 H N N 360 TRP HH2 H N N 361 TRP HXT H N N 362 TYR N N N N 363 TYR CA C N S 364 TYR C C N N 365 TYR O O N N 366 TYR CB C N N 367 TYR CG C Y N 368 TYR CD1 C Y N 369 TYR CD2 C Y N 370 TYR CE1 C Y N 371 TYR CE2 C Y N 372 TYR CZ C Y N 373 TYR OH O N N 374 TYR OXT O N N 375 TYR H H N N 376 TYR H2 H N N 377 TYR HA H N N 378 TYR HB2 H N N 379 TYR HB3 H N N 380 TYR HD1 H N N 381 TYR HD2 H N N 382 TYR HE1 H N N 383 TYR HE2 H N N 384 TYR HH H N N 385 TYR HXT H N N 386 VAL N N N N 387 VAL CA C N S 388 VAL C C N N 389 VAL O O N N 390 VAL CB C N N 391 VAL CG1 C N N 392 VAL CG2 C N N 393 VAL OXT O N N 394 VAL H H N N 395 VAL H2 H N N 396 VAL HA H N N 397 VAL HB H N N 398 VAL HG11 H N N 399 VAL HG12 H N N 400 VAL HG13 H N N 401 VAL HG21 H N N 402 VAL HG22 H N N 403 VAL HG23 H N N 404 VAL HXT H N N 405 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 GLN N CA sing N N 84 GLN N H sing N N 85 GLN N H2 sing N N 86 GLN CA C sing N N 87 GLN CA CB sing N N 88 GLN CA HA sing N N 89 GLN C O doub N N 90 GLN C OXT sing N N 91 GLN CB CG sing N N 92 GLN CB HB2 sing N N 93 GLN CB HB3 sing N N 94 GLN CG CD sing N N 95 GLN CG HG2 sing N N 96 GLN CG HG3 sing N N 97 GLN CD OE1 doub N N 98 GLN CD NE2 sing N N 99 GLN NE2 HE21 sing N N 100 GLN NE2 HE22 sing N N 101 GLN OXT HXT sing N N 102 GLU N CA sing N N 103 GLU N H sing N N 104 GLU N H2 sing N N 105 GLU CA C sing N N 106 GLU CA CB sing N N 107 GLU CA HA sing N N 108 GLU C O doub N N 109 GLU C OXT sing N N 110 GLU CB CG sing N N 111 GLU CB HB2 sing N N 112 GLU CB HB3 sing N N 113 GLU CG CD sing N N 114 GLU CG HG2 sing N N 115 GLU CG HG3 sing N N 116 GLU CD OE1 doub N N 117 GLU CD OE2 sing N N 118 GLU OE2 HE2 sing N N 119 GLU OXT HXT sing N N 120 GLY N CA sing N N 121 GLY N H sing N N 122 GLY N H2 sing N N 123 GLY CA C sing N N 124 GLY CA HA2 sing N N 125 GLY CA HA3 sing N N 126 GLY C O doub N N 127 GLY C OXT sing N N 128 GLY OXT HXT sing N N 129 GOL C1 O1 sing N N 130 GOL C1 C2 sing N N 131 GOL C1 H11 sing N N 132 GOL C1 H12 sing N N 133 GOL O1 HO1 sing N N 134 GOL C2 O2 sing N N 135 GOL C2 C3 sing N N 136 GOL C2 H2 sing N N 137 GOL O2 HO2 sing N N 138 GOL C3 O3 sing N N 139 GOL C3 H31 sing N N 140 GOL C3 H32 sing N N 141 GOL O3 HO3 sing N N 142 HIS N CA sing N N 143 HIS N H sing N N 144 HIS N H2 sing N N 145 HIS CA C sing N N 146 HIS CA CB sing N N 147 HIS CA HA sing N N 148 HIS C O doub N N 149 HIS C OXT sing N N 150 HIS CB CG sing N N 151 HIS CB HB2 sing N N 152 HIS CB HB3 sing N N 153 HIS CG ND1 sing Y N 154 HIS CG CD2 doub Y N 155 HIS ND1 CE1 doub Y N 156 HIS ND1 HD1 sing N N 157 HIS CD2 NE2 sing Y N 158 HIS CD2 HD2 sing N N 159 HIS CE1 NE2 sing Y N 160 HIS CE1 HE1 sing N N 161 HIS NE2 HE2 sing N N 162 HIS OXT HXT sing N N 163 HOH O H1 sing N N 164 HOH O H2 sing N N 165 ILE N CA sing N N 166 ILE N H sing N N 167 ILE N H2 sing N N 168 ILE CA C sing N N 169 ILE CA CB sing N N 170 ILE CA HA sing N N 171 ILE C O doub N N 172 ILE C OXT sing N N 173 ILE CB CG1 sing N N 174 ILE CB CG2 sing N N 175 ILE CB HB sing N N 176 ILE CG1 CD1 sing N N 177 ILE CG1 HG12 sing N N 178 ILE CG1 HG13 sing N N 179 ILE CG2 HG21 sing N N 180 ILE CG2 HG22 sing N N 181 ILE CG2 HG23 sing N N 182 ILE CD1 HD11 sing N N 183 ILE CD1 HD12 sing N N 184 ILE CD1 HD13 sing N N 185 ILE OXT HXT sing N N 186 LEU N CA sing N N 187 LEU N H sing N N 188 LEU N H2 sing N N 189 LEU CA C sing N N 190 LEU CA CB sing N N 191 LEU CA HA sing N N 192 LEU C O doub N N 193 LEU C OXT sing N N 194 LEU CB CG sing N N 195 LEU CB HB2 sing N N 196 LEU CB HB3 sing N N 197 LEU CG CD1 sing N N 198 LEU CG CD2 sing N N 199 LEU CG HG sing N N 200 LEU CD1 HD11 sing N N 201 LEU CD1 HD12 sing N N 202 LEU CD1 HD13 sing N N 203 LEU CD2 HD21 sing N N 204 LEU CD2 HD22 sing N N 205 LEU CD2 HD23 sing N N 206 LEU OXT HXT sing N N 207 LYS N CA sing N N 208 LYS N H sing N N 209 LYS N H2 sing N N 210 LYS CA C sing N N 211 LYS CA CB sing N N 212 LYS CA HA sing N N 213 LYS C O doub N N 214 LYS C OXT sing N N 215 LYS CB CG sing N N 216 LYS CB HB2 sing N N 217 LYS CB HB3 sing N N 218 LYS CG CD sing N N 219 LYS CG HG2 sing N N 220 LYS CG HG3 sing N N 221 LYS CD CE sing N N 222 LYS CD HD2 sing N N 223 LYS CD HD3 sing N N 224 LYS CE NZ sing N N 225 LYS CE HE2 sing N N 226 LYS CE HE3 sing N N 227 LYS NZ HZ1 sing N N 228 LYS NZ HZ2 sing N N 229 LYS NZ HZ3 sing N N 230 LYS OXT HXT sing N N 231 MET N CA sing N N 232 MET N H sing N N 233 MET N H2 sing N N 234 MET CA C sing N N 235 MET CA CB sing N N 236 MET CA HA sing N N 237 MET C O doub N N 238 MET C OXT sing N N 239 MET CB CG sing N N 240 MET CB HB2 sing N N 241 MET CB HB3 sing N N 242 MET CG SD sing N N 243 MET CG HG2 sing N N 244 MET CG HG3 sing N N 245 MET SD CE sing N N 246 MET CE HE1 sing N N 247 MET CE HE2 sing N N 248 MET CE HE3 sing N N 249 MET OXT HXT sing N N 250 PHE N CA sing N N 251 PHE N H sing N N 252 PHE N H2 sing N N 253 PHE CA C sing N N 254 PHE CA CB sing N N 255 PHE CA HA sing N N 256 PHE C O doub N N 257 PHE C OXT sing N N 258 PHE CB CG sing N N 259 PHE CB HB2 sing N N 260 PHE CB HB3 sing N N 261 PHE CG CD1 doub Y N 262 PHE CG CD2 sing Y N 263 PHE CD1 CE1 sing Y N 264 PHE CD1 HD1 sing N N 265 PHE CD2 CE2 doub Y N 266 PHE CD2 HD2 sing N N 267 PHE CE1 CZ doub Y N 268 PHE CE1 HE1 sing N N 269 PHE CE2 CZ sing Y N 270 PHE CE2 HE2 sing N N 271 PHE CZ HZ sing N N 272 PHE OXT HXT sing N N 273 PRO N CA sing N N 274 PRO N CD sing N N 275 PRO N H sing N N 276 PRO CA C sing N N 277 PRO CA CB sing N N 278 PRO CA HA sing N N 279 PRO C O doub N N 280 PRO C OXT sing N N 281 PRO CB CG sing N N 282 PRO CB HB2 sing N N 283 PRO CB HB3 sing N N 284 PRO CG CD sing N N 285 PRO CG HG2 sing N N 286 PRO CG HG3 sing N N 287 PRO CD HD2 sing N N 288 PRO CD HD3 sing N N 289 PRO OXT HXT sing N N 290 SER N CA sing N N 291 SER N H sing N N 292 SER N H2 sing N N 293 SER CA C sing N N 294 SER CA CB sing N N 295 SER CA HA sing N N 296 SER C O doub N N 297 SER C OXT sing N N 298 SER CB OG sing N N 299 SER CB HB2 sing N N 300 SER CB HB3 sing N N 301 SER OG HG sing N N 302 SER OXT HXT sing N N 303 THR N CA sing N N 304 THR N H sing N N 305 THR N H2 sing N N 306 THR CA C sing N N 307 THR CA CB sing N N 308 THR CA HA sing N N 309 THR C O doub N N 310 THR C OXT sing N N 311 THR CB OG1 sing N N 312 THR CB CG2 sing N N 313 THR CB HB sing N N 314 THR OG1 HG1 sing N N 315 THR CG2 HG21 sing N N 316 THR CG2 HG22 sing N N 317 THR CG2 HG23 sing N N 318 THR OXT HXT sing N N 319 TRP N CA sing N N 320 TRP N H sing N N 321 TRP N H2 sing N N 322 TRP CA C sing N N 323 TRP CA CB sing N N 324 TRP CA HA sing N N 325 TRP C O doub N N 326 TRP C OXT sing N N 327 TRP CB CG sing N N 328 TRP CB HB2 sing N N 329 TRP CB HB3 sing N N 330 TRP CG CD1 doub Y N 331 TRP CG CD2 sing Y N 332 TRP CD1 NE1 sing Y N 333 TRP CD1 HD1 sing N N 334 TRP CD2 CE2 doub Y N 335 TRP CD2 CE3 sing Y N 336 TRP NE1 CE2 sing Y N 337 TRP NE1 HE1 sing N N 338 TRP CE2 CZ2 sing Y N 339 TRP CE3 CZ3 doub Y N 340 TRP CE3 HE3 sing N N 341 TRP CZ2 CH2 doub Y N 342 TRP CZ2 HZ2 sing N N 343 TRP CZ3 CH2 sing Y N 344 TRP CZ3 HZ3 sing N N 345 TRP CH2 HH2 sing N N 346 TRP OXT HXT sing N N 347 TYR N CA sing N N 348 TYR N H sing N N 349 TYR N H2 sing N N 350 TYR CA C sing N N 351 TYR CA CB sing N N 352 TYR CA HA sing N N 353 TYR C O doub N N 354 TYR C OXT sing N N 355 TYR CB CG sing N N 356 TYR CB HB2 sing N N 357 TYR CB HB3 sing N N 358 TYR CG CD1 doub Y N 359 TYR CG CD2 sing Y N 360 TYR CD1 CE1 sing Y N 361 TYR CD1 HD1 sing N N 362 TYR CD2 CE2 doub Y N 363 TYR CD2 HD2 sing N N 364 TYR CE1 CZ doub Y N 365 TYR CE1 HE1 sing N N 366 TYR CE2 CZ sing Y N 367 TYR CE2 HE2 sing N N 368 TYR CZ OH sing N N 369 TYR OH HH sing N N 370 TYR OXT HXT sing N N 371 VAL N CA sing N N 372 VAL N H sing N N 373 VAL N H2 sing N N 374 VAL CA C sing N N 375 VAL CA CB sing N N 376 VAL CA HA sing N N 377 VAL C O doub N N 378 VAL C OXT sing N N 379 VAL CB CG1 sing N N 380 VAL CB CG2 sing N N 381 VAL CB HB sing N N 382 VAL CG1 HG11 sing N N 383 VAL CG1 HG12 sing N N 384 VAL CG1 HG13 sing N N 385 VAL CG2 HG21 sing N N 386 VAL CG2 HG22 sing N N 387 VAL CG2 HG23 sing N N 388 VAL OXT HXT sing N N 389 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3FI7 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7QFU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015987 _atom_sites.fract_transf_matrix[1][2] 0.009230 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018461 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010727 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #