data_7QU7 # _entry.id 7QU7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QU7 pdb_00007qu7 10.2210/pdb7qu7/pdb WWPDB D_1292120293 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2022-12-07 3 'Structure model' 1 2 2023-01-11 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QU7 _pdbx_database_status.recvd_initial_deposition_date 2022-01-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email martin.noble@ncl.ac.uk _pdbx_contact_author.name_first Martin _pdbx_contact_author.name_last Noble _pdbx_contact_author.name_mi E.M _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3595-9807 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Turberville, S.' 1 0000-0003-2173-9675 'Martin, M.P.' 2 0000-0003-4810-3351 'Hope, I.' 3 ? 'Noble, M.E.M.' 4 0000-0002-3595-9807 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 15416 _citation.page_last 15432 _citation.title ;Mapping Ligand Interactions of Bromodomains BRD4 and ATAD2 with FragLites and PepLites─Halogenated Probes of Druglike and Peptide-like Molecular Interactions. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01357 _citation.pdbx_database_id_PubMed 36367089 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Davison, G.' 1 0000-0001-5466-2702 primary 'Martin, M.P.' 2 ? primary 'Turberville, S.' 3 ? primary 'Dormen, S.' 4 ? primary 'Heath, R.' 5 ? primary 'Heptinstall, A.B.' 6 ? primary 'Lawson, M.' 7 ? primary 'Miller, D.C.' 8 0000-0001-6846-2007 primary 'Ng, Y.M.' 9 ? primary 'Sanderson, J.N.' 10 0000-0003-1000-2897 primary 'Hope, I.' 11 0000-0002-8002-5026 primary 'Wood, D.J.' 12 ? primary 'Cano, C.' 13 0000-0002-2032-2272 primary 'Endicott, J.A.' 14 ? primary 'Hardcastle, I.R.' 15 0000-0001-7495-3769 primary 'Noble, M.E.M.' 16 ? primary 'Waring, M.J.' 17 0000-0002-9110-8783 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATPase family AAA domain-containing protein 2' 15453.514 1 3.6.1.3 ? bromodomain ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 4 ? ? ? ? 5 non-polymer syn 4-bromanyl-1,8-naphthyridine 209.043 1 ? ? ? ? 6 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AAA nuclear coregulator cancer-associated protein,ANCCA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_seq_one_letter_code_can ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'CHLORIDE ION' CL 4 1,2-ETHANEDIOL EDO 5 4-bromanyl-1,8-naphthyridine HH8 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLN n 1 4 GLU n 1 5 GLU n 1 6 ASP n 1 7 THR n 1 8 PHE n 1 9 ARG n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 PHE n 1 15 LEU n 1 16 ARG n 1 17 ASN n 1 18 VAL n 1 19 THR n 1 20 HIS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ILE n 1 25 ASP n 1 26 LYS n 1 27 ARG n 1 28 PHE n 1 29 ARG n 1 30 VAL n 1 31 PHE n 1 32 THR n 1 33 LYS n 1 34 PRO n 1 35 VAL n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 GLU n 1 40 VAL n 1 41 PRO n 1 42 ASP n 1 43 TYR n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 PRO n 1 51 MET n 1 52 ASP n 1 53 LEU n 1 54 SER n 1 55 SER n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 ILE n 1 61 ASP n 1 62 LEU n 1 63 HIS n 1 64 LYS n 1 65 TYR n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 LYS n 1 70 ASP n 1 71 TYR n 1 72 LEU n 1 73 ARG n 1 74 ASP n 1 75 ILE n 1 76 ASP n 1 77 LEU n 1 78 ILE n 1 79 CYS n 1 80 SER n 1 81 ASN n 1 82 ALA n 1 83 LEU n 1 84 GLU n 1 85 TYR n 1 86 ASN n 1 87 PRO n 1 88 ASP n 1 89 ARG n 1 90 ASP n 1 91 PRO n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 LEU n 1 96 ILE n 1 97 ARG n 1 98 HIS n 1 99 ARG n 1 100 ALA n 1 101 CYS n 1 102 ALA n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 THR n 1 107 ALA n 1 108 TYR n 1 109 ALA n 1 110 ILE n 1 111 ILE n 1 112 LYS n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 ASP n 1 117 GLU n 1 118 ASP n 1 119 PHE n 1 120 GLU n 1 121 GLN n 1 122 LEU n 1 123 CYS n 1 124 GLU n 1 125 GLU n 1 126 ILE n 1 127 GLN n 1 128 GLU n 1 129 SER n 1 130 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATAD2, L16, PRO2000' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HH8 non-polymer . 4-bromanyl-1,8-naphthyridine ? 'C8 H5 Br N2' 209.043 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 979 979 SER SER AAA . n A 1 2 MET 2 980 980 MET MET AAA . n A 1 3 GLN 3 981 981 GLN GLN AAA . n A 1 4 GLU 4 982 982 GLU GLU AAA . n A 1 5 GLU 5 983 983 GLU GLU AAA . n A 1 6 ASP 6 984 984 ASP ASP AAA . n A 1 7 THR 7 985 985 THR THR AAA . n A 1 8 PHE 8 986 986 PHE PHE AAA . n A 1 9 ARG 9 987 987 ARG ARG AAA . n A 1 10 GLU 10 988 988 GLU GLU AAA . n A 1 11 LEU 11 989 989 LEU LEU AAA . n A 1 12 ARG 12 990 990 ARG ARG AAA . n A 1 13 ILE 13 991 991 ILE ILE AAA . n A 1 14 PHE 14 992 992 PHE PHE AAA . n A 1 15 LEU 15 993 993 LEU LEU AAA . n A 1 16 ARG 16 994 994 ARG ARG AAA . n A 1 17 ASN 17 995 995 ASN ASN AAA . n A 1 18 VAL 18 996 996 VAL VAL AAA . n A 1 19 THR 19 997 997 THR THR AAA . n A 1 20 HIS 20 998 998 HIS HIS AAA . n A 1 21 ARG 21 999 999 ARG ARG AAA . n A 1 22 LEU 22 1000 1000 LEU LEU AAA . n A 1 23 ALA 23 1001 1001 ALA ALA AAA . n A 1 24 ILE 24 1002 1002 ILE ILE AAA . n A 1 25 ASP 25 1003 1003 ASP ASP AAA . n A 1 26 LYS 26 1004 1004 LYS LYS AAA . n A 1 27 ARG 27 1005 1005 ARG ARG AAA . n A 1 28 PHE 28 1006 1006 PHE PHE AAA . n A 1 29 ARG 29 1007 1007 ARG ARG AAA . n A 1 30 VAL 30 1008 1008 VAL VAL AAA . n A 1 31 PHE 31 1009 1009 PHE PHE AAA . n A 1 32 THR 32 1010 1010 THR THR AAA . n A 1 33 LYS 33 1011 1011 LYS LYS AAA . n A 1 34 PRO 34 1012 1012 PRO PRO AAA . n A 1 35 VAL 35 1013 1013 VAL VAL AAA . n A 1 36 ASP 36 1014 1014 ASP ASP AAA . n A 1 37 PRO 37 1015 1015 PRO PRO AAA . n A 1 38 ASP 38 1016 1016 ASP ASP AAA . n A 1 39 GLU 39 1017 1017 GLU GLU AAA . n A 1 40 VAL 40 1018 1018 VAL VAL AAA . n A 1 41 PRO 41 1019 1019 PRO PRO AAA . n A 1 42 ASP 42 1020 1020 ASP ASP AAA . n A 1 43 TYR 43 1021 1021 TYR TYR AAA . n A 1 44 VAL 44 1022 1022 VAL VAL AAA . n A 1 45 THR 45 1023 1023 THR THR AAA . n A 1 46 VAL 46 1024 1024 VAL VAL AAA . n A 1 47 ILE 47 1025 1025 ILE ILE AAA . n A 1 48 LYS 48 1026 1026 LYS LYS AAA . n A 1 49 GLN 49 1027 1027 GLN GLN AAA . n A 1 50 PRO 50 1028 1028 PRO PRO AAA . n A 1 51 MET 51 1029 1029 MET MET AAA . n A 1 52 ASP 52 1030 1030 ASP ASP AAA . n A 1 53 LEU 53 1031 1031 LEU LEU AAA . n A 1 54 SER 54 1032 1032 SER SER AAA . n A 1 55 SER 55 1033 1033 SER SER AAA . n A 1 56 VAL 56 1034 1034 VAL VAL AAA . n A 1 57 ILE 57 1035 1035 ILE ILE AAA . n A 1 58 SER 58 1036 1036 SER SER AAA . n A 1 59 LYS 59 1037 1037 LYS LYS AAA . n A 1 60 ILE 60 1038 1038 ILE ILE AAA . n A 1 61 ASP 61 1039 1039 ASP ASP AAA . n A 1 62 LEU 62 1040 1040 LEU LEU AAA . n A 1 63 HIS 63 1041 1041 HIS HIS AAA . n A 1 64 LYS 64 1042 1042 LYS LYS AAA . n A 1 65 TYR 65 1043 1043 TYR TYR AAA . n A 1 66 LEU 66 1044 1044 LEU LEU AAA . n A 1 67 THR 67 1045 1045 THR THR AAA . n A 1 68 VAL 68 1046 1046 VAL VAL AAA . n A 1 69 LYS 69 1047 1047 LYS LYS AAA . n A 1 70 ASP 70 1048 1048 ASP ASP AAA . n A 1 71 TYR 71 1049 1049 TYR TYR AAA . n A 1 72 LEU 72 1050 1050 LEU LEU AAA . n A 1 73 ARG 73 1051 1051 ARG ARG AAA . n A 1 74 ASP 74 1052 1052 ASP ASP AAA . n A 1 75 ILE 75 1053 1053 ILE ILE AAA . n A 1 76 ASP 76 1054 1054 ASP ASP AAA . n A 1 77 LEU 77 1055 1055 LEU LEU AAA . n A 1 78 ILE 78 1056 1056 ILE ILE AAA . n A 1 79 CYS 79 1057 1057 CYS CYS AAA . n A 1 80 SER 80 1058 1058 SER SER AAA . n A 1 81 ASN 81 1059 1059 ASN ASN AAA . n A 1 82 ALA 82 1060 1060 ALA ALA AAA . n A 1 83 LEU 83 1061 1061 LEU LEU AAA . n A 1 84 GLU 84 1062 1062 GLU GLU AAA . n A 1 85 TYR 85 1063 1063 TYR TYR AAA . n A 1 86 ASN 86 1064 1064 ASN ASN AAA . n A 1 87 PRO 87 1065 1065 PRO PRO AAA . n A 1 88 ASP 88 1066 1066 ASP ASP AAA . n A 1 89 ARG 89 1067 1067 ARG ARG AAA . n A 1 90 ASP 90 1068 1068 ASP ASP AAA . n A 1 91 PRO 91 1069 1069 PRO PRO AAA . n A 1 92 GLY 92 1070 1070 GLY GLY AAA . n A 1 93 ASP 93 1071 1071 ASP ASP AAA . n A 1 94 ARG 94 1072 1072 ARG ARG AAA . n A 1 95 LEU 95 1073 1073 LEU LEU AAA . n A 1 96 ILE 96 1074 1074 ILE ILE AAA . n A 1 97 ARG 97 1075 1075 ARG ARG AAA . n A 1 98 HIS 98 1076 1076 HIS HIS AAA . n A 1 99 ARG 99 1077 1077 ARG ARG AAA . n A 1 100 ALA 100 1078 1078 ALA ALA AAA . n A 1 101 CYS 101 1079 1079 CYS CYS AAA . n A 1 102 ALA 102 1080 1080 ALA ALA AAA . n A 1 103 LEU 103 1081 1081 LEU LEU AAA . n A 1 104 ARG 104 1082 1082 ARG ARG AAA . n A 1 105 ASP 105 1083 1083 ASP ASP AAA . n A 1 106 THR 106 1084 1084 THR THR AAA . n A 1 107 ALA 107 1085 1085 ALA ALA AAA . n A 1 108 TYR 108 1086 1086 TYR TYR AAA . n A 1 109 ALA 109 1087 1087 ALA ALA AAA . n A 1 110 ILE 110 1088 1088 ILE ILE AAA . n A 1 111 ILE 111 1089 1089 ILE ILE AAA . n A 1 112 LYS 112 1090 1090 LYS LYS AAA . n A 1 113 GLU 113 1091 1091 GLU GLU AAA . n A 1 114 GLU 114 1092 1092 GLU GLU AAA . n A 1 115 LEU 115 1093 1093 LEU LEU AAA . n A 1 116 ASP 116 1094 1094 ASP ASP AAA . n A 1 117 GLU 117 1095 1095 GLU GLU AAA . n A 1 118 ASP 118 1096 1096 ASP ASP AAA . n A 1 119 PHE 119 1097 1097 PHE PHE AAA . n A 1 120 GLU 120 1098 1098 GLU GLU AAA . n A 1 121 GLN 121 1099 1099 GLN GLN AAA . n A 1 122 LEU 122 1100 1100 LEU LEU AAA . n A 1 123 CYS 123 1101 1101 CYS CYS AAA . n A 1 124 GLU 124 1102 1102 GLU GLU AAA . n A 1 125 GLU 125 1103 1103 GLU GLU AAA . n A 1 126 ILE 126 1104 1104 ILE ILE AAA . n A 1 127 GLN 127 1105 1105 GLN GLN AAA . n A 1 128 GLU 128 1106 1106 GLU GLU AAA . n A 1 129 SER 129 1107 1107 SER SER AAA . n A 1 130 ARG 130 1108 1108 ARG ARG AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1201 1 SO4 SO4 AAA . C 3 CL 1 1202 1109 CL CL AAA . D 4 EDO 1 1203 1 EDO EDO AAA . E 4 EDO 1 1204 2 EDO EDO AAA . F 4 EDO 1 1205 3 EDO EDO AAA . G 4 EDO 1 1206 4 EDO EDO AAA . H 2 SO4 1 1207 1 SO4 SO4 AAA . I 5 HH8 1 1208 1 HH8 DRG AAA . J 6 HOH 1 1301 21 HOH HOH AAA . J 6 HOH 2 1302 13 HOH HOH AAA . J 6 HOH 3 1303 59 HOH HOH AAA . J 6 HOH 4 1304 14 HOH HOH AAA . J 6 HOH 5 1305 12 HOH HOH AAA . J 6 HOH 6 1306 33 HOH HOH AAA . J 6 HOH 7 1307 46 HOH HOH AAA . J 6 HOH 8 1308 37 HOH HOH AAA . J 6 HOH 9 1309 57 HOH HOH AAA . J 6 HOH 10 1310 30 HOH HOH AAA . J 6 HOH 11 1311 2 HOH HOH AAA . J 6 HOH 12 1312 34 HOH HOH AAA . J 6 HOH 13 1313 1 HOH HOH AAA . J 6 HOH 14 1314 20 HOH HOH AAA . J 6 HOH 15 1315 11 HOH HOH AAA . J 6 HOH 16 1316 35 HOH HOH AAA . J 6 HOH 17 1317 38 HOH HOH AAA . J 6 HOH 18 1318 42 HOH HOH AAA . J 6 HOH 19 1319 25 HOH HOH AAA . J 6 HOH 20 1320 58 HOH HOH AAA . J 6 HOH 21 1321 26 HOH HOH AAA . J 6 HOH 22 1322 17 HOH HOH AAA . J 6 HOH 23 1323 18 HOH HOH AAA . J 6 HOH 24 1324 10 HOH HOH AAA . J 6 HOH 25 1325 4 HOH HOH AAA . J 6 HOH 26 1326 3 HOH HOH AAA . J 6 HOH 27 1327 8 HOH HOH AAA . J 6 HOH 28 1328 16 HOH HOH AAA . J 6 HOH 29 1329 28 HOH HOH AAA . J 6 HOH 30 1330 27 HOH HOH AAA . J 6 HOH 31 1331 49 HOH HOH AAA . J 6 HOH 32 1332 43 HOH HOH AAA . J 6 HOH 33 1333 41 HOH HOH AAA . J 6 HOH 34 1334 29 HOH HOH AAA . J 6 HOH 35 1335 23 HOH HOH AAA . J 6 HOH 36 1336 19 HOH HOH AAA . J 6 HOH 37 1337 64 HOH HOH AAA . J 6 HOH 38 1338 32 HOH HOH AAA . J 6 HOH 39 1339 52 HOH HOH AAA . J 6 HOH 40 1340 39 HOH HOH AAA . J 6 HOH 41 1341 47 HOH HOH AAA . J 6 HOH 42 1342 6 HOH HOH AAA . J 6 HOH 43 1343 9 HOH HOH AAA . J 6 HOH 44 1344 51 HOH HOH AAA . J 6 HOH 45 1345 61 HOH HOH AAA . J 6 HOH 46 1346 48 HOH HOH AAA . J 6 HOH 47 1347 31 HOH HOH AAA . J 6 HOH 48 1348 63 HOH HOH AAA . J 6 HOH 49 1349 40 HOH HOH AAA . J 6 HOH 50 1350 24 HOH HOH AAA . J 6 HOH 51 1351 56 HOH HOH AAA . J 6 HOH 52 1352 22 HOH HOH AAA . J 6 HOH 53 1353 15 HOH HOH AAA . J 6 HOH 54 1354 7 HOH HOH AAA . J 6 HOH 55 1355 5 HOH HOH AAA . J 6 HOH 56 1356 62 HOH HOH AAA . J 6 HOH 57 1357 50 HOH HOH AAA . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7QU7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.783 _cell.length_a_esd ? _cell.length_b 78.783 _cell.length_b_esd ? _cell.length_c 137.078 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QU7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QU7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M BisTris pH 6-7, 1.7-2.1M Ammonium sulphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.898 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.898 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7QU7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.13 _reflns.d_resolution_low 68.321 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14759 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 38.9 _reflns.pdbx_Rmerge_I_obs 0.194 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.198 _reflns.pdbx_Rpim_I_all 0.043 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 9.04 68.23 ? ? ? ? ? ? 7730 ? ? ? ? ? 0.021 ? ? ? ? ? ? ? ? 29.8 ? ? ? ? 0.022 0.005 ? 1 1 1.000 ? ? ? ? ? ? ? ? ? ? 2.13 2.19 ? ? ? ? ? ? 47966 ? ? ? ? ? 6.584 ? ? ? ? ? ? ? ? 41.0 ? ? ? ? 6.739 1.435 ? 2 1 0.365 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -1.073 _refine.aniso_B[1][2] -0.537 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -1.073 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 3.482 _refine.B_iso_max ? _refine.B_iso_mean 59.121 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.911 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QU7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.130 _refine.ls_d_res_low 68.321 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14706 _refine.ls_number_reflns_R_free 738 _refine.ls_number_reflns_R_work 13968 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.966 _refine.ls_percent_reflns_R_free 5.018 _refine.ls_R_factor_all 0.221 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2806 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2183 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3DAI _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.173 _refine.pdbx_overall_ESU_R_Free 0.179 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.778 _refine.overall_SU_ML 0.159 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.130 _refine_hist.d_res_low 68.321 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 1179 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1084 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 1173 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1097 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.556 1.662 1585 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.367 1.588 2539 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.169 5.000 137 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.048 21.039 77 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.717 15.000 216 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.885 15.000 14 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 150 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1306 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 256 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.216 0.200 289 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.186 0.200 1005 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 578 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 541 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.226 0.200 56 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.102 0.200 2 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.247 0.200 9 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.285 0.200 30 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.223 0.200 6 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.064 0.200 1 ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 4.585 5.895 539 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.561 5.886 538 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.470 8.833 679 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.468 8.843 680 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 6.381 6.642 634 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 6.378 6.650 635 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 9.445 9.711 906 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 9.446 9.721 907 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.319 71.444 1379 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 12.315 71.453 1380 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.130 2.185 . . 57 981 100.0000 . . . 0.438 . 0.411 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.185 2.245 . . 45 998 100.0000 . . . 0.442 . 0.357 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.245 2.310 . . 46 950 100.0000 . . . 0.360 . 0.334 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.310 2.381 . . 53 917 100.0000 . . . 0.324 . 0.316 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.381 2.460 . . 50 913 100.0000 . . . 0.376 . 0.275 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.460 2.546 . . 55 872 100.0000 . . . 0.319 . 0.245 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.546 2.642 . . 48 838 100.0000 . . . 0.327 . 0.240 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.642 2.750 . . 37 809 100.0000 . . . 0.279 . 0.227 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.750 2.872 . . 40 793 100.0000 . . . 0.236 . 0.235 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.872 3.012 . . 44 748 100.0000 . . . 0.280 . 0.214 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.012 3.175 . . 26 738 100.0000 . . . 0.185 . 0.205 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.175 3.367 . . 26 692 100.0000 . . . 0.259 . 0.195 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.367 3.600 . . 41 653 100.0000 . . . 0.219 . 0.188 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.600 3.888 . . 33 591 99.8400 . . . 0.249 . 0.174 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.888 4.259 . . 40 557 100.0000 . . . 0.207 . 0.184 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.259 4.761 . . 27 513 100.0000 . . . 0.226 . 0.169 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.761 5.496 . . 31 460 100.0000 . . . 0.284 . 0.178 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.496 6.729 . . 19 407 100.0000 . . . 0.318 . 0.235 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.729 9.504 . . 13 328 100.0000 . . . 0.304 . 0.199 . . . . . . . . . . . 'X-RAY DIFFRACTION' 9.504 68.321 . . 7 210 99.5413 . . . 0.539 . 0.263 . . . . . . . . . . . # _struct.entry_id 7QU7 _struct.title 'ATAD2 in complex with FragLite16' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QU7 _struct_keywords.text 'ATAD2, INHIBITOR, FRAGMENT, BROMODOMAIN, FRAGLITE, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 2 ? I N N 5 ? J N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATAD2_HUMAN _struct_ref.pdbx_db_accession Q6PL18 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNA LEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _struct_ref.pdbx_align_begin 981 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QU7 _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6PL18 _struct_ref_seq.db_align_beg 981 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 981 _struct_ref_seq.pdbx_auth_seq_align_end 1108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QU7 SER AAA 1 ? UNP Q6PL18 ? ? 'expression tag' 979 1 1 7QU7 MET AAA 2 ? UNP Q6PL18 ? ? 'expression tag' 980 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 980 ? 1 MORE -12 ? 1 'SSA (A^2)' 8270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? ILE A 24 ? SER AAA 979 ILE AAA 1002 1 ? 24 HELX_P HELX_P2 AA2 ASP A 25 ? THR A 32 ? ASP AAA 1003 THR AAA 1010 5 ? 8 HELX_P HELX_P3 AA3 ASP A 42 ? ILE A 47 ? ASP AAA 1020 ILE AAA 1025 1 ? 6 HELX_P HELX_P4 AA4 ASP A 52 ? LEU A 62 ? ASP AAA 1030 LEU AAA 1040 1 ? 11 HELX_P HELX_P5 AA5 THR A 67 ? ASN A 86 ? THR AAA 1045 ASN AAA 1064 1 ? 20 HELX_P HELX_P6 AA6 ASP A 90 ? LEU A 115 ? ASP AAA 1068 LEU AAA 1093 1 ? 26 HELX_P HELX_P7 AA7 ASP A 116 ? SER A 129 ? ASP AAA 1094 SER AAA 1107 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 79 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 101 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id AAA _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 1057 _struct_conn.ptnr2_auth_asym_id AAA _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 1079 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.105 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE AAA ARG 1067 ? ? O AAA HOH 1303 ? ? 1.49 2 1 O AAA TYR 1021 ? ? H AAA ILE 1025 ? ? 1.57 3 1 CL AAA CL 1202 ? ? O AAA HOH 1351 ? ? 2.10 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 HH21 _pdbx_validate_symm_contact.auth_asym_id_1 AAA _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 1077 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 AAA _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 1103 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_565 _pdbx_validate_symm_contact.dist 1.56 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE AAA ARG 1067 ? ? CZ AAA ARG 1067 ? ? NH1 AAA ARG 1067 ? ? 117.25 120.30 -3.05 0.50 N 2 1 CB AAA CYS 1079 ? ? CA AAA CYS 1079 ? ? C AAA CYS 1079 ? ? 118.75 111.50 7.25 1.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP AAA 1016 ? ? -58.56 -73.66 2 1 GLN AAA 1027 ? B -116.36 75.28 3 1 SER AAA 1107 ? B -89.37 35.35 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id AAA _pdbx_struct_special_symmetry.auth_comp_id SO4 _pdbx_struct_special_symmetry.auth_seq_id 1207 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id H _pdbx_struct_special_symmetry.label_comp_id SO4 _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 7QU7 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 EDO C1 C N N 89 EDO O1 O N N 90 EDO C2 C N N 91 EDO O2 O N N 92 EDO H11 H N N 93 EDO H12 H N N 94 EDO HO1 H N N 95 EDO H21 H N N 96 EDO H22 H N N 97 EDO HO2 H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HH8 C4 C Y N 148 HH8 C5 C Y N 149 HH8 C6 C Y N 150 HH8 C7 C Y N 151 HH8 C8 C Y N 152 HH8 N1 N Y N 153 HH8 N2 N Y N 154 HH8 C3 C Y N 155 HH8 BR1 BR N N 156 HH8 C1 C Y N 157 HH8 C2 C Y N 158 HH8 H1 H N N 159 HH8 H2 H N N 160 HH8 H3 H N N 161 HH8 H4 H N N 162 HH8 H5 H N N 163 HIS N N N N 164 HIS CA C N S 165 HIS C C N N 166 HIS O O N N 167 HIS CB C N N 168 HIS CG C Y N 169 HIS ND1 N Y N 170 HIS CD2 C Y N 171 HIS CE1 C Y N 172 HIS NE2 N Y N 173 HIS OXT O N N 174 HIS H H N N 175 HIS H2 H N N 176 HIS HA H N N 177 HIS HB2 H N N 178 HIS HB3 H N N 179 HIS HD1 H N N 180 HIS HD2 H N N 181 HIS HE1 H N N 182 HIS HE2 H N N 183 HIS HXT H N N 184 HOH O O N N 185 HOH H1 H N N 186 HOH H2 H N N 187 ILE N N N N 188 ILE CA C N S 189 ILE C C N N 190 ILE O O N N 191 ILE CB C N S 192 ILE CG1 C N N 193 ILE CG2 C N N 194 ILE CD1 C N N 195 ILE OXT O N N 196 ILE H H N N 197 ILE H2 H N N 198 ILE HA H N N 199 ILE HB H N N 200 ILE HG12 H N N 201 ILE HG13 H N N 202 ILE HG21 H N N 203 ILE HG22 H N N 204 ILE HG23 H N N 205 ILE HD11 H N N 206 ILE HD12 H N N 207 ILE HD13 H N N 208 ILE HXT H N N 209 LEU N N N N 210 LEU CA C N S 211 LEU C C N N 212 LEU O O N N 213 LEU CB C N N 214 LEU CG C N N 215 LEU CD1 C N N 216 LEU CD2 C N N 217 LEU OXT O N N 218 LEU H H N N 219 LEU H2 H N N 220 LEU HA H N N 221 LEU HB2 H N N 222 LEU HB3 H N N 223 LEU HG H N N 224 LEU HD11 H N N 225 LEU HD12 H N N 226 LEU HD13 H N N 227 LEU HD21 H N N 228 LEU HD22 H N N 229 LEU HD23 H N N 230 LEU HXT H N N 231 LYS N N N N 232 LYS CA C N S 233 LYS C C N N 234 LYS O O N N 235 LYS CB C N N 236 LYS CG C N N 237 LYS CD C N N 238 LYS CE C N N 239 LYS NZ N N N 240 LYS OXT O N N 241 LYS H H N N 242 LYS H2 H N N 243 LYS HA H N N 244 LYS HB2 H N N 245 LYS HB3 H N N 246 LYS HG2 H N N 247 LYS HG3 H N N 248 LYS HD2 H N N 249 LYS HD3 H N N 250 LYS HE2 H N N 251 LYS HE3 H N N 252 LYS HZ1 H N N 253 LYS HZ2 H N N 254 LYS HZ3 H N N 255 LYS HXT H N N 256 MET N N N N 257 MET CA C N S 258 MET C C N N 259 MET O O N N 260 MET CB C N N 261 MET CG C N N 262 MET SD S N N 263 MET CE C N N 264 MET OXT O N N 265 MET H H N N 266 MET H2 H N N 267 MET HA H N N 268 MET HB2 H N N 269 MET HB3 H N N 270 MET HG2 H N N 271 MET HG3 H N N 272 MET HE1 H N N 273 MET HE2 H N N 274 MET HE3 H N N 275 MET HXT H N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SER N N N N 317 SER CA C N S 318 SER C C N N 319 SER O O N N 320 SER CB C N N 321 SER OG O N N 322 SER OXT O N N 323 SER H H N N 324 SER H2 H N N 325 SER HA H N N 326 SER HB2 H N N 327 SER HB3 H N N 328 SER HG H N N 329 SER HXT H N N 330 SO4 S S N N 331 SO4 O1 O N N 332 SO4 O2 O N N 333 SO4 O3 O N N 334 SO4 O4 O N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HH8 BR1 C1 sing N N 138 HH8 C1 C2 doub Y N 139 HH8 C1 C8 sing Y N 140 HH8 C2 C3 sing Y N 141 HH8 C7 C8 sing Y N 142 HH8 C7 C6 doub Y N 143 HH8 C8 C4 doub Y N 144 HH8 C3 N1 doub Y N 145 HH8 C6 C5 sing Y N 146 HH8 C4 N1 sing Y N 147 HH8 C4 N2 sing Y N 148 HH8 C5 N2 doub Y N 149 HH8 C5 H1 sing N N 150 HH8 C6 H2 sing N N 151 HH8 C7 H3 sing N N 152 HH8 C3 H4 sing N N 153 HH8 C2 H5 sing N N 154 HIS N CA sing N N 155 HIS N H sing N N 156 HIS N H2 sing N N 157 HIS CA C sing N N 158 HIS CA CB sing N N 159 HIS CA HA sing N N 160 HIS C O doub N N 161 HIS C OXT sing N N 162 HIS CB CG sing N N 163 HIS CB HB2 sing N N 164 HIS CB HB3 sing N N 165 HIS CG ND1 sing Y N 166 HIS CG CD2 doub Y N 167 HIS ND1 CE1 doub Y N 168 HIS ND1 HD1 sing N N 169 HIS CD2 NE2 sing Y N 170 HIS CD2 HD2 sing N N 171 HIS CE1 NE2 sing Y N 172 HIS CE1 HE1 sing N N 173 HIS NE2 HE2 sing N N 174 HIS OXT HXT sing N N 175 HOH O H1 sing N N 176 HOH O H2 sing N N 177 ILE N CA sing N N 178 ILE N H sing N N 179 ILE N H2 sing N N 180 ILE CA C sing N N 181 ILE CA CB sing N N 182 ILE CA HA sing N N 183 ILE C O doub N N 184 ILE C OXT sing N N 185 ILE CB CG1 sing N N 186 ILE CB CG2 sing N N 187 ILE CB HB sing N N 188 ILE CG1 CD1 sing N N 189 ILE CG1 HG12 sing N N 190 ILE CG1 HG13 sing N N 191 ILE CG2 HG21 sing N N 192 ILE CG2 HG22 sing N N 193 ILE CG2 HG23 sing N N 194 ILE CD1 HD11 sing N N 195 ILE CD1 HD12 sing N N 196 ILE CD1 HD13 sing N N 197 ILE OXT HXT sing N N 198 LEU N CA sing N N 199 LEU N H sing N N 200 LEU N H2 sing N N 201 LEU CA C sing N N 202 LEU CA CB sing N N 203 LEU CA HA sing N N 204 LEU C O doub N N 205 LEU C OXT sing N N 206 LEU CB CG sing N N 207 LEU CB HB2 sing N N 208 LEU CB HB3 sing N N 209 LEU CG CD1 sing N N 210 LEU CG CD2 sing N N 211 LEU CG HG sing N N 212 LEU CD1 HD11 sing N N 213 LEU CD1 HD12 sing N N 214 LEU CD1 HD13 sing N N 215 LEU CD2 HD21 sing N N 216 LEU CD2 HD22 sing N N 217 LEU CD2 HD23 sing N N 218 LEU OXT HXT sing N N 219 LYS N CA sing N N 220 LYS N H sing N N 221 LYS N H2 sing N N 222 LYS CA C sing N N 223 LYS CA CB sing N N 224 LYS CA HA sing N N 225 LYS C O doub N N 226 LYS C OXT sing N N 227 LYS CB CG sing N N 228 LYS CB HB2 sing N N 229 LYS CB HB3 sing N N 230 LYS CG CD sing N N 231 LYS CG HG2 sing N N 232 LYS CG HG3 sing N N 233 LYS CD CE sing N N 234 LYS CD HD2 sing N N 235 LYS CD HD3 sing N N 236 LYS CE NZ sing N N 237 LYS CE HE2 sing N N 238 LYS CE HE3 sing N N 239 LYS NZ HZ1 sing N N 240 LYS NZ HZ2 sing N N 241 LYS NZ HZ3 sing N N 242 LYS OXT HXT sing N N 243 MET N CA sing N N 244 MET N H sing N N 245 MET N H2 sing N N 246 MET CA C sing N N 247 MET CA CB sing N N 248 MET CA HA sing N N 249 MET C O doub N N 250 MET C OXT sing N N 251 MET CB CG sing N N 252 MET CB HB2 sing N N 253 MET CB HB3 sing N N 254 MET CG SD sing N N 255 MET CG HG2 sing N N 256 MET CG HG3 sing N N 257 MET SD CE sing N N 258 MET CE HE1 sing N N 259 MET CE HE2 sing N N 260 MET CE HE3 sing N N 261 MET OXT HXT sing N N 262 PHE N CA sing N N 263 PHE N H sing N N 264 PHE N H2 sing N N 265 PHE CA C sing N N 266 PHE CA CB sing N N 267 PHE CA HA sing N N 268 PHE C O doub N N 269 PHE C OXT sing N N 270 PHE CB CG sing N N 271 PHE CB HB2 sing N N 272 PHE CB HB3 sing N N 273 PHE CG CD1 doub Y N 274 PHE CG CD2 sing Y N 275 PHE CD1 CE1 sing Y N 276 PHE CD1 HD1 sing N N 277 PHE CD2 CE2 doub Y N 278 PHE CD2 HD2 sing N N 279 PHE CE1 CZ doub Y N 280 PHE CE1 HE1 sing N N 281 PHE CE2 CZ sing Y N 282 PHE CE2 HE2 sing N N 283 PHE CZ HZ sing N N 284 PHE OXT HXT sing N N 285 PRO N CA sing N N 286 PRO N CD sing N N 287 PRO N H sing N N 288 PRO CA C sing N N 289 PRO CA CB sing N N 290 PRO CA HA sing N N 291 PRO C O doub N N 292 PRO C OXT sing N N 293 PRO CB CG sing N N 294 PRO CB HB2 sing N N 295 PRO CB HB3 sing N N 296 PRO CG CD sing N N 297 PRO CG HG2 sing N N 298 PRO CG HG3 sing N N 299 PRO CD HD2 sing N N 300 PRO CD HD3 sing N N 301 PRO OXT HXT sing N N 302 SER N CA sing N N 303 SER N H sing N N 304 SER N H2 sing N N 305 SER CA C sing N N 306 SER CA CB sing N N 307 SER CA HA sing N N 308 SER C O doub N N 309 SER C OXT sing N N 310 SER CB OG sing N N 311 SER CB HB2 sing N N 312 SER CB HB3 sing N N 313 SER OG HG sing N N 314 SER OXT HXT sing N N 315 SO4 S O1 doub N N 316 SO4 S O2 doub N N 317 SO4 S O3 sing N N 318 SO4 S O4 sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' C57659/A27310 1 'Cancer Research UK' 'United Kingdom' C1362/A20263 2 'Cancer Research UK' 'United Kingdom' C2215/A21421 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HH8 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HH8 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3DAI _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7QU7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012693 _atom_sites.fract_transf_matrix[1][2] 0.007328 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014657 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007295 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c BR 35 35 17.182 2.172 5.237 16.580 5.639 0.261 3.986 41.433 -0.076 C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 CL 17 17 11.460 0.010 7.196 1.166 6.255 18.519 1.645 47.778 -9.370 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.026 # loop_