data_7QUU # _entry.id 7QUU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QUU pdb_00007quu 10.2210/pdb7quu/pdb WWPDB D_1292120282 ? ? BMRB 34702 ? 10.13018/BMR34702 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-07 2 'Structure model' 1 1 2022-11-16 3 'Structure model' 1 2 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation_author 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation_author.identifier_ORCID' 2 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7QUU _pdbx_database_status.recvd_initial_deposition_date 2022-01-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Red1-Iss10 complex' _pdbx_database_related.db_id 34702 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email jan.kadlec@ibs.fr _pdbx_contact_author.name_first Kadlec _pdbx_contact_author.name_last Jan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4853-6918 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mackereth, C.D.' 1 0000-0002-0776-7947 'Kadlec, J.' 2 0000-0002-4853-6918 'Laroussi, H.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 4969 _citation.page_last 4969 _citation.title 'Structural analysis of Red1 as a conserved scaffold of the RNA-targeting MTREC/PAXT complex.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-022-32542-3 _citation.pdbx_database_id_PubMed 36002457 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Foucher, A.E.' 1 ? primary 'Touat-Todeschini, L.' 2 ? primary 'Juarez-Martinez, A.B.' 3 ? primary 'Rakitch, A.' 4 ? primary 'Laroussi, H.' 5 ? primary 'Karczewski, C.' 6 ? primary 'Acajjaoui, S.' 7 ? primary 'Soler-Lopez, M.' 8 ? primary 'Cusack, S.' 9 ? primary 'Mackereth, C.D.' 10 ? primary 'Verdel, A.' 11 ? primary 'Kadlec, J.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein C7D4.14c' 6592.497 1 ? ? ? ? 2 polymer man 'NURS complex subunit red1' 5299.981 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no MGWSHPQFEKSSDAVEPSVEKEYKKIISFRDTVFEGKHQQFLVPNNVRLKFLRDR MGWSHPQFEKSSDAVEPSVEKEYKKIISFRDTVFEGKHQQFLVPNNVRLKFLRDR A ? 2 'polypeptide(L)' no no GAMGTTNQKEAEKAVSQLFEVGVRFNDFIAEGIEPSVVHTLFLKLGLDS GAMGTTNQKEAEKAVSQLFEVGVRFNDFIAEGIEPSVVHTLFLKLGLDS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 TRP n 1 4 SER n 1 5 HIS n 1 6 PRO n 1 7 GLN n 1 8 PHE n 1 9 GLU n 1 10 LYS n 1 11 SER n 1 12 SER n 1 13 ASP n 1 14 ALA n 1 15 VAL n 1 16 GLU n 1 17 PRO n 1 18 SER n 1 19 VAL n 1 20 GLU n 1 21 LYS n 1 22 GLU n 1 23 TYR n 1 24 LYS n 1 25 LYS n 1 26 ILE n 1 27 ILE n 1 28 SER n 1 29 PHE n 1 30 ARG n 1 31 ASP n 1 32 THR n 1 33 VAL n 1 34 PHE n 1 35 GLU n 1 36 GLY n 1 37 LYS n 1 38 HIS n 1 39 GLN n 1 40 GLN n 1 41 PHE n 1 42 LEU n 1 43 VAL n 1 44 PRO n 1 45 ASN n 1 46 ASN n 1 47 VAL n 1 48 ARG n 1 49 LEU n 1 50 LYS n 1 51 PHE n 1 52 LEU n 1 53 ARG n 1 54 ASP n 1 55 ARG n 2 1 GLY n 2 2 ALA n 2 3 MET n 2 4 GLY n 2 5 THR n 2 6 THR n 2 7 ASN n 2 8 GLN n 2 9 LYS n 2 10 GLU n 2 11 ALA n 2 12 GLU n 2 13 LYS n 2 14 ALA n 2 15 VAL n 2 16 SER n 2 17 GLN n 2 18 LEU n 2 19 PHE n 2 20 GLU n 2 21 VAL n 2 22 GLY n 2 23 VAL n 2 24 ARG n 2 25 PHE n 2 26 ASN n 2 27 ASP n 2 28 PHE n 2 29 ILE n 2 30 ALA n 2 31 GLU n 2 32 GLY n 2 33 ILE n 2 34 GLU n 2 35 PRO n 2 36 SER n 2 37 VAL n 2 38 VAL n 2 39 HIS n 2 40 THR n 2 41 LEU n 2 42 PHE n 2 43 LEU n 2 44 LYS n 2 45 LEU n 2 46 GLY n 2 47 LEU n 2 48 ASP n 2 49 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 55 'fission yeast' ? SPAC7D4.14c ? '972 / ATCC 24843' ? ? ? ? 'Schizosaccharomyces pombe' 4896 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 49 'fission yeast' ? 'red1, iss3, SPAC1006.03c' ? '972 / ATCC 24843' ? ? ? ? 'Schizosaccharomyces pombe' 4896 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -10 ? ? ? A . n A 1 2 GLY 2 -9 ? ? ? A . n A 1 3 TRP 3 -8 ? ? ? A . n A 1 4 SER 4 -7 ? ? ? A . n A 1 5 HIS 5 -6 ? ? ? A . n A 1 6 PRO 6 -5 ? ? ? A . n A 1 7 GLN 7 -4 ? ? ? A . n A 1 8 PHE 8 -3 ? ? ? A . n A 1 9 GLU 9 -2 ? ? ? A . n A 1 10 LYS 10 -1 ? ? ? A . n A 1 11 SER 11 0 ? ? ? A . n A 1 12 SER 12 1 1 SER SER A . n A 1 13 ASP 13 2 2 ASP ASP A . n A 1 14 ALA 14 3 3 ALA ALA A . n A 1 15 VAL 15 4 4 VAL VAL A . n A 1 16 GLU 16 5 5 GLU GLU A . n A 1 17 PRO 17 6 6 PRO PRO A . n A 1 18 SER 18 7 7 SER SER A . n A 1 19 VAL 19 8 8 VAL VAL A . n A 1 20 GLU 20 9 9 GLU GLU A . n A 1 21 LYS 21 10 10 LYS LYS A . n A 1 22 GLU 22 11 11 GLU GLU A . n A 1 23 TYR 23 12 12 TYR TYR A . n A 1 24 LYS 24 13 13 LYS LYS A . n A 1 25 LYS 25 14 14 LYS LYS A . n A 1 26 ILE 26 15 15 ILE ILE A . n A 1 27 ILE 27 16 16 ILE ILE A . n A 1 28 SER 28 17 17 SER SER A . n A 1 29 PHE 29 18 18 PHE PHE A . n A 1 30 ARG 30 19 19 ARG ARG A . n A 1 31 ASP 31 20 20 ASP ASP A . n A 1 32 THR 32 21 21 THR THR A . n A 1 33 VAL 33 22 22 VAL VAL A . n A 1 34 PHE 34 23 23 PHE PHE A . n A 1 35 GLU 35 24 24 GLU GLU A . n A 1 36 GLY 36 25 25 GLY GLY A . n A 1 37 LYS 37 26 26 LYS LYS A . n A 1 38 HIS 38 27 27 HIS HIS A . n A 1 39 GLN 39 28 28 GLN GLN A . n A 1 40 GLN 40 29 29 GLN GLN A . n A 1 41 PHE 41 30 30 PHE PHE A . n A 1 42 LEU 42 31 31 LEU LEU A . n A 1 43 VAL 43 32 32 VAL VAL A . n A 1 44 PRO 44 33 33 PRO PRO A . n A 1 45 ASN 45 34 34 ASN ASN A . n A 1 46 ASN 46 35 35 ASN ASN A . n A 1 47 VAL 47 36 36 VAL VAL A . n A 1 48 ARG 48 37 37 ARG ARG A . n A 1 49 LEU 49 38 38 LEU LEU A . n A 1 50 LYS 50 39 39 LYS LYS A . n A 1 51 PHE 51 40 40 PHE PHE A . n A 1 52 LEU 52 41 41 LEU LEU A . n A 1 53 ARG 53 42 42 ARG ARG A . n A 1 54 ASP 54 43 43 ASP ASP A . n A 1 55 ARG 55 44 44 ARG ARG A . n B 2 1 GLY 1 188 188 GLY GLY B . n B 2 2 ALA 2 189 189 ALA ALA B . n B 2 3 MET 3 190 190 MET MET B . n B 2 4 GLY 4 191 191 GLY GLY B . n B 2 5 THR 5 192 192 THR THR B . n B 2 6 THR 6 193 193 THR THR B . n B 2 7 ASN 7 194 194 ASN ASN B . n B 2 8 GLN 8 195 195 GLN GLN B . n B 2 9 LYS 9 196 196 LYS LYS B . n B 2 10 GLU 10 197 197 GLU GLU B . n B 2 11 ALA 11 198 198 ALA ALA B . n B 2 12 GLU 12 199 199 GLU GLU B . n B 2 13 LYS 13 200 200 LYS LYS B . n B 2 14 ALA 14 201 201 ALA ALA B . n B 2 15 VAL 15 202 202 VAL VAL B . n B 2 16 SER 16 203 203 SER SER B . n B 2 17 GLN 17 204 204 GLN GLN B . n B 2 18 LEU 18 205 205 LEU LEU B . n B 2 19 PHE 19 206 206 PHE PHE B . n B 2 20 GLU 20 207 207 GLU GLU B . n B 2 21 VAL 21 208 208 VAL VAL B . n B 2 22 GLY 22 209 209 GLY GLY B . n B 2 23 VAL 23 210 210 VAL VAL B . n B 2 24 ARG 24 211 211 ARG ARG B . n B 2 25 PHE 25 212 212 PHE PHE B . n B 2 26 ASN 26 213 213 ASN ASN B . n B 2 27 ASP 27 214 214 ASP ASP B . n B 2 28 PHE 28 215 215 PHE PHE B . n B 2 29 ILE 29 216 216 ILE ILE B . n B 2 30 ALA 30 217 217 ALA ALA B . n B 2 31 GLU 31 218 218 GLU GLU B . n B 2 32 GLY 32 219 219 GLY GLY B . n B 2 33 ILE 33 220 220 ILE ILE B . n B 2 34 GLU 34 221 221 GLU GLU B . n B 2 35 PRO 35 222 222 PRO PRO B . n B 2 36 SER 36 223 223 SER SER B . n B 2 37 VAL 37 224 224 VAL VAL B . n B 2 38 VAL 38 225 225 VAL VAL B . n B 2 39 HIS 39 226 226 HIS HIS B . n B 2 40 THR 40 227 227 THR THR B . n B 2 41 LEU 41 228 228 LEU LEU B . n B 2 42 PHE 42 229 229 PHE PHE B . n B 2 43 LEU 43 230 230 LEU LEU B . n B 2 44 LYS 44 231 231 LYS LYS B . n B 2 45 LEU 45 232 232 LEU LEU B . n B 2 46 GLY 46 233 233 GLY GLY B . n B 2 47 LEU 47 234 234 LEU LEU B . n B 2 48 ASP 48 235 235 ASP ASP B . n B 2 49 SER 49 236 236 SER SER B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QUU _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7QUU _struct.title 'Red1-Iss10 complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QUU _struct_keywords.text 'MTREC complex, RNA degradation, meiosis, RNA' _struct_keywords.pdbx_keywords RNA # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP YFPE_SCHPO O14269 ? 1 DAVEPSVEKEYKKIISFRDTVFEGKHQQFLVPNNVRLKFLRDR 2 2 UNP RED1_SCHPO Q9UTR8 ? 2 TTNQKEAEKAVSQLFEVGVRFNDFIAEGIEPSVVHTLFLKLGLD 192 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7QUU A 13 ? 55 ? O14269 2 ? 44 ? 2 44 2 2 7QUU B 5 ? 48 ? Q9UTR8 192 ? 235 ? 192 235 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QUU MET A 1 ? UNP O14269 ? ? 'initiating methionine' -10 1 1 7QUU GLY A 2 ? UNP O14269 ? ? 'expression tag' -9 2 1 7QUU TRP A 3 ? UNP O14269 ? ? 'expression tag' -8 3 1 7QUU SER A 4 ? UNP O14269 ? ? 'expression tag' -7 4 1 7QUU HIS A 5 ? UNP O14269 ? ? 'expression tag' -6 5 1 7QUU PRO A 6 ? UNP O14269 ? ? 'expression tag' -5 6 1 7QUU GLN A 7 ? UNP O14269 ? ? 'expression tag' -4 7 1 7QUU PHE A 8 ? UNP O14269 ? ? 'expression tag' -3 8 1 7QUU GLU A 9 ? UNP O14269 ? ? 'expression tag' -2 9 1 7QUU LYS A 10 ? UNP O14269 ? ? 'expression tag' -1 10 1 7QUU SER A 11 ? UNP O14269 ? ? 'expression tag' 0 11 1 7QUU SER A 12 ? UNP O14269 ? ? 'expression tag' 1 12 2 7QUU GLY B 1 ? UNP Q9UTR8 ? ? 'expression tag' 188 13 2 7QUU ALA B 2 ? UNP Q9UTR8 ? ? 'expression tag' 189 14 2 7QUU MET B 3 ? UNP Q9UTR8 ? ? 'expression tag' 190 15 2 7QUU GLY B 4 ? UNP Q9UTR8 ? ? 'expression tag' 191 16 2 7QUU SER B 49 ? UNP Q9UTR8 ? ? 'expression tag' 236 17 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR Distance Restraints' ? 2 1 'assay for oligomerization' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 17 ? GLY A 36 ? PRO A 6 GLY A 25 1 ? 20 HELX_P HELX_P2 AA2 PRO A 44 ? ARG A 55 ? PRO A 33 ARG A 44 1 ? 12 HELX_P HELX_P3 AA3 THR B 6 ? GLY B 22 ? THR B 193 GLY B 209 1 ? 17 HELX_P HELX_P4 AA4 ARG B 24 ? GLU B 31 ? ARG B 211 GLU B 218 1 ? 8 HELX_P HELX_P5 AA5 GLU B 34 ? LEU B 45 ? GLU B 221 LEU B 232 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HZ2 A LYS 10 ? ? OE2 A GLU 11 ? ? 1.59 2 6 OE2 A GLU 11 ? ? HZ3 A LYS 14 ? ? 1.59 3 10 HZ3 A LYS 10 ? ? OE2 A GLU 11 ? ? 1.55 4 10 HZ1 A LYS 39 ? ? OE1 B GLU 207 ? ? 1.58 5 15 OD1 A ASP 2 ? ? HZ2 B LYS 196 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 4 ? ? 75.21 99.15 2 1 PRO A 33 ? ? -93.08 -158.97 3 2 VAL A 4 ? ? 64.80 79.79 4 2 GLU A 5 ? ? -77.66 -163.75 5 3 ASP A 2 ? ? 35.82 46.41 6 3 ALA A 3 ? ? -113.41 69.87 7 3 VAL A 4 ? ? 65.30 60.84 8 3 ASP A 43 ? ? -108.13 -167.18 9 4 VAL A 4 ? ? 62.35 73.22 10 4 ASP A 43 ? ? -100.64 -75.71 11 5 ASP A 2 ? ? -141.28 19.69 12 5 VAL A 4 ? ? 62.07 76.22 13 6 ALA A 3 ? ? -117.46 62.68 14 6 VAL A 4 ? ? 71.90 70.70 15 7 VAL A 4 ? ? 70.44 70.86 16 7 ASP A 43 ? ? -115.07 -76.66 17 8 VAL A 4 ? ? 69.36 112.18 18 9 VAL A 4 ? ? 63.87 80.06 19 9 ASP A 43 ? ? -114.34 -165.75 20 9 ALA B 189 ? ? -148.30 29.36 21 10 VAL A 4 ? ? 72.29 103.32 22 10 GLU A 5 ? ? -101.04 -162.17 23 10 PRO A 33 ? ? -86.21 -87.65 24 10 ASN A 34 ? ? -130.22 -61.49 25 10 ALA B 189 ? ? -146.06 -54.31 26 11 ASP A 2 ? ? -90.35 45.44 27 11 VAL A 4 ? ? 64.37 73.24 28 11 GLU A 5 ? ? -78.77 -164.07 29 11 ASP A 43 ? ? -108.79 -165.88 30 12 VAL A 4 ? ? 61.00 89.20 31 12 PRO A 33 ? ? -88.47 -72.99 32 12 ASN A 34 ? ? -152.18 -62.43 33 13 VAL A 4 ? ? 64.71 79.94 34 13 GLU A 5 ? ? -77.39 -165.49 35 13 ASP A 43 ? ? -93.27 -65.49 36 13 MET B 190 ? ? 64.40 -169.51 37 14 ASP A 2 ? ? -91.44 -62.01 38 14 VAL A 4 ? ? 60.97 87.20 39 14 ASP A 43 ? ? -109.14 -88.81 40 15 VAL A 4 ? ? 66.98 82.45 41 15 PRO A 33 ? ? -86.54 -159.88 42 15 MET B 190 ? ? -155.33 -59.49 43 16 ASP A 2 ? ? -144.01 -72.64 44 16 ALA A 3 ? ? -116.54 74.18 45 16 MET B 190 ? ? 70.99 122.86 46 17 VAL A 4 ? ? -159.85 55.81 47 17 ASP A 43 ? ? -108.30 -80.21 48 17 ALA B 189 ? ? -139.20 -67.31 49 18 ALA A 3 ? ? 56.24 -164.47 50 18 GLU A 5 ? ? -100.63 -164.85 51 18 MET B 190 ? ? -173.31 -36.02 52 19 ALA A 3 ? ? 75.36 144.94 53 19 PRO A 33 ? ? -88.63 -158.41 54 19 ASP A 43 ? ? -75.40 -79.44 55 19 MET B 190 ? ? -110.10 62.20 56 20 ALA A 3 ? ? -64.51 92.01 57 20 ASP A 43 ? ? -87.37 -71.63 # _pdbx_nmr_ensemble.entry_id 7QUU _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7QUU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '150 uM [U-99% 15N] Red1, 150 uM [U-99% 15N] Iss10, 20 mM TRIS, 150 mM sodium chloride, 5 mM beta-mercaptoethanol, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_H2O solution ? 2 ;500 uM [U-99% 13C; U-99% 15N] Red1, 500 uM [U-99% 13C; U-99% 15N] Iss10, 20 mM TRIS, 150 mM sodium chloride, 5 mM beta-mercaptoethanol, 90% H2O/10% D2O ; '90% H2O/10% D2O' 13C15N_H2O solution ? 3 ;500 uM [U-99% 13C; U-99% 15N] Red1, 500 uM [U-99% 13C; U-99% 15N] Iss10, 20 mM TRIS, 150 mM sodium chloride, 5 mM beta-mercaptoethanol, 100% D2O ; '100% D2O' 13C15N_D2O solution ? 4 ;150 uM [U-99% 13C; U-99% 15N] Red1, 150 uM [U-99% 13C; U-99% 15N] Iss10, 20 mM TRIS, 150 mM sodium chloride, 5 mM beta-mercaptoethanol, 100% D2O ; '100% D2O' 10c_D2O solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Red1 150 ? uM '[U-99% 15N]' 1 Iss10 150 ? uM '[U-99% 15N]' 1 TRIS 20 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 beta-mercaptoethanol 5 ? mM 'natural abundance' 2 Red1 500 ? uM '[U-99% 13C; U-99% 15N]' 2 Iss10 500 ? uM '[U-99% 13C; U-99% 15N]' 2 TRIS 20 ? mM 'natural abundance' 2 'sodium chloride' 150 ? mM 'natural abundance' 2 beta-mercaptoethanol 5 ? mM 'natural abundance' 3 Red1 500 ? uM '[U-99% 13C; U-99% 15N]' 3 Iss10 500 ? uM '[U-99% 13C; U-99% 15N]' 3 TRIS 20 ? mM 'natural abundance' 3 'sodium chloride' 150 ? mM 'natural abundance' 3 beta-mercaptoethanol 5 ? mM 'natural abundance' 4 Red1 150 ? uM '[U-99% 13C; U-99% 15N]' 4 Iss10 150 ? uM '[U-99% 13C; U-99% 15N]' 4 TRIS 20 ? mM 'natural abundance' 4 'sodium chloride' 150 ? mM 'natural abundance' 4 beta-mercaptoethanol 5 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 3 '2D 1H-13C HSQC' 2 isotropic 3 1 2 '3D HNCO' 1 isotropic 4 1 2 '3D HN(CA)CO' 1 isotropic 5 1 2 '3D HNCA' 1 isotropic 6 1 2 '3D HNCACB' 1 isotropic 7 1 2 '3D CBCA(CO)NH' 1 isotropic 8 1 1 '3D HNHA' 1 isotropic 9 1 2 '3D HA(CACO)NH' 1 isotropic 10 1 2 '3D H(CCO)NH' 1 isotropic 11 1 2 '3D H(CCO)NH' 1 isotropic 12 1 3 '3D HCCH-TOCSY' 2 isotropic 13 1 3 '3D HCCH-TOCSY' 2 isotropic 14 1 2 '3D 1H-15N NOESY' 1 isotropic 15 1 2 '3D 1H-13C NOESY' 2 isotropic 16 1 4 '2D 1H-1H TOCSY' 1 isotropic 17 1 4 '2D DQF-COSY' 1 isotropic 18 1 4 '2D 1H-1H NOESY' 1 isotropic 19 1 1 '2D TROSY-RDC isotropic' 1 isotropic 20 1 1 '2D TROSY-RDC phage' 1 anisotropic # _pdbx_nmr_refine.entry_id 7QUU _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 4.0.6 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' Sparky NMRFAM Goddard 4 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -10 ? A MET 1 2 1 Y 1 A GLY -9 ? A GLY 2 3 1 Y 1 A TRP -8 ? A TRP 3 4 1 Y 1 A SER -7 ? A SER 4 5 1 Y 1 A HIS -6 ? A HIS 5 6 1 Y 1 A PRO -5 ? A PRO 6 7 1 Y 1 A GLN -4 ? A GLN 7 8 1 Y 1 A PHE -3 ? A PHE 8 9 1 Y 1 A GLU -2 ? A GLU 9 10 1 Y 1 A LYS -1 ? A LYS 10 11 1 Y 1 A SER 0 ? A SER 11 12 2 Y 1 A MET -10 ? A MET 1 13 2 Y 1 A GLY -9 ? A GLY 2 14 2 Y 1 A TRP -8 ? A TRP 3 15 2 Y 1 A SER -7 ? A SER 4 16 2 Y 1 A HIS -6 ? A HIS 5 17 2 Y 1 A PRO -5 ? A PRO 6 18 2 Y 1 A GLN -4 ? A GLN 7 19 2 Y 1 A PHE -3 ? A PHE 8 20 2 Y 1 A GLU -2 ? A GLU 9 21 2 Y 1 A LYS -1 ? A LYS 10 22 2 Y 1 A SER 0 ? A SER 11 23 3 Y 1 A MET -10 ? A MET 1 24 3 Y 1 A GLY -9 ? A GLY 2 25 3 Y 1 A TRP -8 ? A TRP 3 26 3 Y 1 A SER -7 ? A SER 4 27 3 Y 1 A HIS -6 ? A HIS 5 28 3 Y 1 A PRO -5 ? A PRO 6 29 3 Y 1 A GLN -4 ? A GLN 7 30 3 Y 1 A PHE -3 ? A PHE 8 31 3 Y 1 A GLU -2 ? A GLU 9 32 3 Y 1 A LYS -1 ? A LYS 10 33 3 Y 1 A SER 0 ? A SER 11 34 4 Y 1 A MET -10 ? A MET 1 35 4 Y 1 A GLY -9 ? A GLY 2 36 4 Y 1 A TRP -8 ? A TRP 3 37 4 Y 1 A SER -7 ? A SER 4 38 4 Y 1 A HIS -6 ? A HIS 5 39 4 Y 1 A PRO -5 ? A PRO 6 40 4 Y 1 A GLN -4 ? A GLN 7 41 4 Y 1 A PHE -3 ? A PHE 8 42 4 Y 1 A GLU -2 ? A GLU 9 43 4 Y 1 A LYS -1 ? A LYS 10 44 4 Y 1 A SER 0 ? A SER 11 45 5 Y 1 A MET -10 ? A MET 1 46 5 Y 1 A GLY -9 ? A GLY 2 47 5 Y 1 A TRP -8 ? A TRP 3 48 5 Y 1 A SER -7 ? A SER 4 49 5 Y 1 A HIS -6 ? A HIS 5 50 5 Y 1 A PRO -5 ? A PRO 6 51 5 Y 1 A GLN -4 ? A GLN 7 52 5 Y 1 A PHE -3 ? A PHE 8 53 5 Y 1 A GLU -2 ? A GLU 9 54 5 Y 1 A LYS -1 ? A LYS 10 55 5 Y 1 A SER 0 ? A SER 11 56 6 Y 1 A MET -10 ? A MET 1 57 6 Y 1 A GLY -9 ? A GLY 2 58 6 Y 1 A TRP -8 ? A TRP 3 59 6 Y 1 A SER -7 ? A SER 4 60 6 Y 1 A HIS -6 ? A HIS 5 61 6 Y 1 A PRO -5 ? A PRO 6 62 6 Y 1 A GLN -4 ? A GLN 7 63 6 Y 1 A PHE -3 ? A PHE 8 64 6 Y 1 A GLU -2 ? A GLU 9 65 6 Y 1 A LYS -1 ? A LYS 10 66 6 Y 1 A SER 0 ? A SER 11 67 7 Y 1 A MET -10 ? A MET 1 68 7 Y 1 A GLY -9 ? A GLY 2 69 7 Y 1 A TRP -8 ? A TRP 3 70 7 Y 1 A SER -7 ? A SER 4 71 7 Y 1 A HIS -6 ? A HIS 5 72 7 Y 1 A PRO -5 ? A PRO 6 73 7 Y 1 A GLN -4 ? A GLN 7 74 7 Y 1 A PHE -3 ? A PHE 8 75 7 Y 1 A GLU -2 ? A GLU 9 76 7 Y 1 A LYS -1 ? A LYS 10 77 7 Y 1 A SER 0 ? A SER 11 78 8 Y 1 A MET -10 ? A MET 1 79 8 Y 1 A GLY -9 ? A GLY 2 80 8 Y 1 A TRP -8 ? A TRP 3 81 8 Y 1 A SER -7 ? A SER 4 82 8 Y 1 A HIS -6 ? A HIS 5 83 8 Y 1 A PRO -5 ? A PRO 6 84 8 Y 1 A GLN -4 ? A GLN 7 85 8 Y 1 A PHE -3 ? A PHE 8 86 8 Y 1 A GLU -2 ? A GLU 9 87 8 Y 1 A LYS -1 ? A LYS 10 88 8 Y 1 A SER 0 ? A SER 11 89 9 Y 1 A MET -10 ? A MET 1 90 9 Y 1 A GLY -9 ? A GLY 2 91 9 Y 1 A TRP -8 ? A TRP 3 92 9 Y 1 A SER -7 ? A SER 4 93 9 Y 1 A HIS -6 ? A HIS 5 94 9 Y 1 A PRO -5 ? A PRO 6 95 9 Y 1 A GLN -4 ? A GLN 7 96 9 Y 1 A PHE -3 ? A PHE 8 97 9 Y 1 A GLU -2 ? A GLU 9 98 9 Y 1 A LYS -1 ? A LYS 10 99 9 Y 1 A SER 0 ? A SER 11 100 10 Y 1 A MET -10 ? A MET 1 101 10 Y 1 A GLY -9 ? A GLY 2 102 10 Y 1 A TRP -8 ? A TRP 3 103 10 Y 1 A SER -7 ? A SER 4 104 10 Y 1 A HIS -6 ? A HIS 5 105 10 Y 1 A PRO -5 ? A PRO 6 106 10 Y 1 A GLN -4 ? A GLN 7 107 10 Y 1 A PHE -3 ? A PHE 8 108 10 Y 1 A GLU -2 ? A GLU 9 109 10 Y 1 A LYS -1 ? A LYS 10 110 10 Y 1 A SER 0 ? A SER 11 111 11 Y 1 A MET -10 ? A MET 1 112 11 Y 1 A GLY -9 ? A GLY 2 113 11 Y 1 A TRP -8 ? A TRP 3 114 11 Y 1 A SER -7 ? A SER 4 115 11 Y 1 A HIS -6 ? A HIS 5 116 11 Y 1 A PRO -5 ? A PRO 6 117 11 Y 1 A GLN -4 ? A GLN 7 118 11 Y 1 A PHE -3 ? A PHE 8 119 11 Y 1 A GLU -2 ? A GLU 9 120 11 Y 1 A LYS -1 ? A LYS 10 121 11 Y 1 A SER 0 ? A SER 11 122 12 Y 1 A MET -10 ? A MET 1 123 12 Y 1 A GLY -9 ? A GLY 2 124 12 Y 1 A TRP -8 ? A TRP 3 125 12 Y 1 A SER -7 ? A SER 4 126 12 Y 1 A HIS -6 ? A HIS 5 127 12 Y 1 A PRO -5 ? A PRO 6 128 12 Y 1 A GLN -4 ? A GLN 7 129 12 Y 1 A PHE -3 ? A PHE 8 130 12 Y 1 A GLU -2 ? A GLU 9 131 12 Y 1 A LYS -1 ? A LYS 10 132 12 Y 1 A SER 0 ? A SER 11 133 13 Y 1 A MET -10 ? A MET 1 134 13 Y 1 A GLY -9 ? A GLY 2 135 13 Y 1 A TRP -8 ? A TRP 3 136 13 Y 1 A SER -7 ? A SER 4 137 13 Y 1 A HIS -6 ? A HIS 5 138 13 Y 1 A PRO -5 ? A PRO 6 139 13 Y 1 A GLN -4 ? A GLN 7 140 13 Y 1 A PHE -3 ? A PHE 8 141 13 Y 1 A GLU -2 ? A GLU 9 142 13 Y 1 A LYS -1 ? A LYS 10 143 13 Y 1 A SER 0 ? A SER 11 144 14 Y 1 A MET -10 ? A MET 1 145 14 Y 1 A GLY -9 ? A GLY 2 146 14 Y 1 A TRP -8 ? A TRP 3 147 14 Y 1 A SER -7 ? A SER 4 148 14 Y 1 A HIS -6 ? A HIS 5 149 14 Y 1 A PRO -5 ? A PRO 6 150 14 Y 1 A GLN -4 ? A GLN 7 151 14 Y 1 A PHE -3 ? A PHE 8 152 14 Y 1 A GLU -2 ? A GLU 9 153 14 Y 1 A LYS -1 ? A LYS 10 154 14 Y 1 A SER 0 ? A SER 11 155 15 Y 1 A MET -10 ? A MET 1 156 15 Y 1 A GLY -9 ? A GLY 2 157 15 Y 1 A TRP -8 ? A TRP 3 158 15 Y 1 A SER -7 ? A SER 4 159 15 Y 1 A HIS -6 ? A HIS 5 160 15 Y 1 A PRO -5 ? A PRO 6 161 15 Y 1 A GLN -4 ? A GLN 7 162 15 Y 1 A PHE -3 ? A PHE 8 163 15 Y 1 A GLU -2 ? A GLU 9 164 15 Y 1 A LYS -1 ? A LYS 10 165 15 Y 1 A SER 0 ? A SER 11 166 16 Y 1 A MET -10 ? A MET 1 167 16 Y 1 A GLY -9 ? A GLY 2 168 16 Y 1 A TRP -8 ? A TRP 3 169 16 Y 1 A SER -7 ? A SER 4 170 16 Y 1 A HIS -6 ? A HIS 5 171 16 Y 1 A PRO -5 ? A PRO 6 172 16 Y 1 A GLN -4 ? A GLN 7 173 16 Y 1 A PHE -3 ? A PHE 8 174 16 Y 1 A GLU -2 ? A GLU 9 175 16 Y 1 A LYS -1 ? A LYS 10 176 16 Y 1 A SER 0 ? A SER 11 177 17 Y 1 A MET -10 ? A MET 1 178 17 Y 1 A GLY -9 ? A GLY 2 179 17 Y 1 A TRP -8 ? A TRP 3 180 17 Y 1 A SER -7 ? A SER 4 181 17 Y 1 A HIS -6 ? A HIS 5 182 17 Y 1 A PRO -5 ? A PRO 6 183 17 Y 1 A GLN -4 ? A GLN 7 184 17 Y 1 A PHE -3 ? A PHE 8 185 17 Y 1 A GLU -2 ? A GLU 9 186 17 Y 1 A LYS -1 ? A LYS 10 187 17 Y 1 A SER 0 ? A SER 11 188 18 Y 1 A MET -10 ? A MET 1 189 18 Y 1 A GLY -9 ? A GLY 2 190 18 Y 1 A TRP -8 ? A TRP 3 191 18 Y 1 A SER -7 ? A SER 4 192 18 Y 1 A HIS -6 ? A HIS 5 193 18 Y 1 A PRO -5 ? A PRO 6 194 18 Y 1 A GLN -4 ? A GLN 7 195 18 Y 1 A PHE -3 ? A PHE 8 196 18 Y 1 A GLU -2 ? A GLU 9 197 18 Y 1 A LYS -1 ? A LYS 10 198 18 Y 1 A SER 0 ? A SER 11 199 19 Y 1 A MET -10 ? A MET 1 200 19 Y 1 A GLY -9 ? A GLY 2 201 19 Y 1 A TRP -8 ? A TRP 3 202 19 Y 1 A SER -7 ? A SER 4 203 19 Y 1 A HIS -6 ? A HIS 5 204 19 Y 1 A PRO -5 ? A PRO 6 205 19 Y 1 A GLN -4 ? A GLN 7 206 19 Y 1 A PHE -3 ? A PHE 8 207 19 Y 1 A GLU -2 ? A GLU 9 208 19 Y 1 A LYS -1 ? A LYS 10 209 19 Y 1 A SER 0 ? A SER 11 210 20 Y 1 A MET -10 ? A MET 1 211 20 Y 1 A GLY -9 ? A GLY 2 212 20 Y 1 A TRP -8 ? A TRP 3 213 20 Y 1 A SER -7 ? A SER 4 214 20 Y 1 A HIS -6 ? A HIS 5 215 20 Y 1 A PRO -5 ? A PRO 6 216 20 Y 1 A GLN -4 ? A GLN 7 217 20 Y 1 A PHE -3 ? A PHE 8 218 20 Y 1 A GLU -2 ? A GLU 9 219 20 Y 1 A LYS -1 ? A LYS 10 220 20 Y 1 A SER 0 ? A SER 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal ATIP-Avenir France ? 1 'Agence Nationale de la Recherche (ANR)' France ? 2 'Centre National de la Recherche Scientifique (CNRS)' France 'IR-RMN-THC Fr3050' 3 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 700 'PA TXI 700S4 H-C/N-D-05 Z BTO' 2 'AVANCE NEO' ? Bruker 800 'TCI 800S6 H-C/N-D-05 Z P' # _atom_sites.entry_id 7QUU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_