data_7QZ6 # _entry.id 7QZ6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QZ6 pdb_00007qz6 10.2210/pdb7qz6/pdb WWPDB D_1292120661 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QZ6 _pdbx_database_status.recvd_initial_deposition_date 2022-01-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 7QZ5 PDB . unspecified 7QZ7 PDB . unspecified 7QZ8 PDB . unspecified 7QZ9 PDB . # _pdbx_contact_author.id 2 _pdbx_contact_author.email a.m.w.h.thunnissen@rug.nl _pdbx_contact_author.name_first Andy-Mark _pdbx_contact_author.name_last Thunnissen _pdbx_contact_author.name_mi W.H. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1915-9850 # _audit_author.name 'Thunnissen, A.M.W.H.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 144 _citation.language ? _citation.page_first 13815 _citation.page_last 13822 _citation.title 'The Role of Tryptophan in pi Interactions in Proteins: An Experimental Approach.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.2c04986 _citation.pdbx_database_id_PubMed 35868012 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shao, J.' 1 ? primary 'Kuiper, B.P.' 2 ? primary 'Thunnissen, A.W.H.' 3 0000-0002-1915-9850 primary 'Cool, R.H.' 4 ? primary 'Zhou, L.' 5 ? primary 'Huang, C.' 6 ? primary 'Dijkstra, B.W.' 7 0000-0001-9731-6586 primary 'Broos, J.' 8 0000-0001-7746-4709 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator, PadR-like family' 14343.235 2 ? 'W67 and W96 are replaced by 5-fluoroTrp' ? ? 2 non-polymer syn DAUNOMYCIN 527.520 1 ? ? ? ? 3 water nat water 18.015 22 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSY(FTR)GDESQGGRR KYYRLTEIGHENMRLAFES(FTR)SRVDKIIENLEANKKSEAIKHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYR LTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIKHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 DAUNOMYCIN DM1 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ILE n 1 5 PRO n 1 6 LYS n 1 7 GLU n 1 8 MET n 1 9 LEU n 1 10 ARG n 1 11 ALA n 1 12 GLN n 1 13 THR n 1 14 ASN n 1 15 VAL n 1 16 ILE n 1 17 LEU n 1 18 LEU n 1 19 ASN n 1 20 VAL n 1 21 LEU n 1 22 LYS n 1 23 GLN n 1 24 GLY n 1 25 ASP n 1 26 ASN n 1 27 TYR n 1 28 VAL n 1 29 TYR n 1 30 GLY n 1 31 ILE n 1 32 ILE n 1 33 LYS n 1 34 GLN n 1 35 VAL n 1 36 LYS n 1 37 GLU n 1 38 ALA n 1 39 SER n 1 40 ASN n 1 41 GLY n 1 42 GLU n 1 43 MET n 1 44 GLU n 1 45 LEU n 1 46 ASN n 1 47 GLU n 1 48 ALA n 1 49 THR n 1 50 LEU n 1 51 TYR n 1 52 THR n 1 53 ILE n 1 54 PHE n 1 55 LYS n 1 56 ARG n 1 57 LEU n 1 58 GLU n 1 59 LYS n 1 60 ASP n 1 61 GLY n 1 62 ILE n 1 63 ILE n 1 64 SER n 1 65 SER n 1 66 TYR n 1 67 FTR n 1 68 GLY n 1 69 ASP n 1 70 GLU n 1 71 SER n 1 72 GLN n 1 73 GLY n 1 74 GLY n 1 75 ARG n 1 76 ARG n 1 77 LYS n 1 78 TYR n 1 79 TYR n 1 80 ARG n 1 81 LEU n 1 82 THR n 1 83 GLU n 1 84 ILE n 1 85 GLY n 1 86 HIS n 1 87 GLU n 1 88 ASN n 1 89 MET n 1 90 ARG n 1 91 LEU n 1 92 ALA n 1 93 PHE n 1 94 GLU n 1 95 SER n 1 96 FTR n 1 97 SER n 1 98 ARG n 1 99 VAL n 1 100 ASP n 1 101 LYS n 1 102 ILE n 1 103 ILE n 1 104 GLU n 1 105 ASN n 1 106 LEU n 1 107 GLU n 1 108 ALA n 1 109 ASN n 1 110 LYS n 1 111 LYS n 1 112 SER n 1 113 GLU n 1 114 ALA n 1 115 ILE n 1 116 LYS n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n 1 121 HIS n 1 122 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 122 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene llmg_0323 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MG1363 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus cremoris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1359 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DM1 non-polymer . DAUNOMYCIN DAUNORUBICIN 'C27 H29 N O10' 527.520 FTR 'L-peptide linking' n FLUOROTRYPTOPHANE ? 'C11 H11 F N2 O2' 222.216 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 FTR 67 67 67 FTR FTR A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASP 69 69 ? ? ? A . n A 1 70 GLU 70 70 ? ? ? A . n A 1 71 SER 71 71 ? ? ? A . n A 1 72 GLN 72 72 ? ? ? A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 FTR 96 96 96 FTR FTR A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLU 113 113 ? ? ? A . n A 1 114 ALA 114 114 ? ? ? A . n A 1 115 ILE 115 115 ? ? ? A . n A 1 116 LYS 116 116 ? ? ? A . n A 1 117 HIS 117 117 ? ? ? A . n A 1 118 HIS 118 118 ? ? ? A . n A 1 119 HIS 119 119 ? ? ? A . n A 1 120 HIS 120 120 ? ? ? A . n A 1 121 HIS 121 121 ? ? ? A . n A 1 122 HIS 122 122 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ALA 2 2 ? ? ? B . n B 1 3 GLU 3 3 ? ? ? B . n B 1 4 ILE 4 4 ? ? ? B . n B 1 5 PRO 5 5 5 PRO PRO B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 MET 8 8 8 MET MET B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 ARG 10 10 10 ARG ARG B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 THR 13 13 13 THR THR B . n B 1 14 ASN 14 14 14 ASN ASN B . n B 1 15 VAL 15 15 15 VAL VAL B . n B 1 16 ILE 16 16 16 ILE ILE B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 ASN 19 19 19 ASN ASN B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 GLN 23 23 23 GLN GLN B . n B 1 24 GLY 24 24 24 GLY GLY B . n B 1 25 ASP 25 25 25 ASP ASP B . n B 1 26 ASN 26 26 26 ASN ASN B . n B 1 27 TYR 27 27 27 TYR TYR B . n B 1 28 VAL 28 28 28 VAL VAL B . n B 1 29 TYR 29 29 29 TYR TYR B . n B 1 30 GLY 30 30 30 GLY GLY B . n B 1 31 ILE 31 31 31 ILE ILE B . n B 1 32 ILE 32 32 32 ILE ILE B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 GLN 34 34 34 GLN GLN B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 LYS 36 36 36 LYS LYS B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 SER 39 39 39 SER SER B . n B 1 40 ASN 40 40 40 ASN ASN B . n B 1 41 GLY 41 41 41 GLY GLY B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 MET 43 43 43 MET MET B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 ASN 46 46 46 ASN ASN B . n B 1 47 GLU 47 47 47 GLU GLU B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 THR 49 49 49 THR THR B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 TYR 51 51 51 TYR TYR B . n B 1 52 THR 52 52 52 THR THR B . n B 1 53 ILE 53 53 53 ILE ILE B . n B 1 54 PHE 54 54 54 PHE PHE B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 ARG 56 56 56 ARG ARG B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 GLU 58 58 58 GLU GLU B . n B 1 59 LYS 59 59 59 LYS LYS B . n B 1 60 ASP 60 60 60 ASP ASP B . n B 1 61 GLY 61 61 61 GLY GLY B . n B 1 62 ILE 62 62 62 ILE ILE B . n B 1 63 ILE 63 63 63 ILE ILE B . n B 1 64 SER 64 64 64 SER SER B . n B 1 65 SER 65 65 65 SER SER B . n B 1 66 TYR 66 66 66 TYR TYR B . n B 1 67 FTR 67 67 67 FTR FTR B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 ASP 69 69 69 ASP ASP B . n B 1 70 GLU 70 70 ? ? ? B . n B 1 71 SER 71 71 ? ? ? B . n B 1 72 GLN 72 72 ? ? ? B . n B 1 73 GLY 73 73 ? ? ? B . n B 1 74 GLY 74 74 74 GLY GLY B . n B 1 75 ARG 75 75 75 ARG ARG B . n B 1 76 ARG 76 76 76 ARG ARG B . n B 1 77 LYS 77 77 77 LYS LYS B . n B 1 78 TYR 78 78 78 TYR TYR B . n B 1 79 TYR 79 79 79 TYR TYR B . n B 1 80 ARG 80 80 80 ARG ARG B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 THR 82 82 82 THR THR B . n B 1 83 GLU 83 83 83 GLU GLU B . n B 1 84 ILE 84 84 84 ILE ILE B . n B 1 85 GLY 85 85 85 GLY GLY B . n B 1 86 HIS 86 86 86 HIS HIS B . n B 1 87 GLU 87 87 87 GLU GLU B . n B 1 88 ASN 88 88 88 ASN ASN B . n B 1 89 MET 89 89 89 MET MET B . n B 1 90 ARG 90 90 90 ARG ARG B . n B 1 91 LEU 91 91 91 LEU LEU B . n B 1 92 ALA 92 92 92 ALA ALA B . n B 1 93 PHE 93 93 93 PHE PHE B . n B 1 94 GLU 94 94 94 GLU GLU B . n B 1 95 SER 95 95 95 SER SER B . n B 1 96 FTR 96 96 96 FTR FTR B . n B 1 97 SER 97 97 97 SER SER B . n B 1 98 ARG 98 98 98 ARG ARG B . n B 1 99 VAL 99 99 99 VAL VAL B . n B 1 100 ASP 100 100 100 ASP ASP B . n B 1 101 LYS 101 101 101 LYS LYS B . n B 1 102 ILE 102 102 102 ILE ILE B . n B 1 103 ILE 103 103 103 ILE ILE B . n B 1 104 GLU 104 104 104 GLU GLU B . n B 1 105 ASN 105 105 105 ASN ASN B . n B 1 106 LEU 106 106 106 LEU LEU B . n B 1 107 GLU 107 107 107 GLU GLU B . n B 1 108 ALA 108 108 108 ALA ALA B . n B 1 109 ASN 109 109 109 ASN ASN B . n B 1 110 LYS 110 110 110 LYS LYS B . n B 1 111 LYS 111 111 111 LYS LYS B . n B 1 112 SER 112 112 112 SER SER B . n B 1 113 GLU 113 113 ? ? ? B . n B 1 114 ALA 114 114 ? ? ? B . n B 1 115 ILE 115 115 ? ? ? B . n B 1 116 LYS 116 116 ? ? ? B . n B 1 117 HIS 117 117 ? ? ? B . n B 1 118 HIS 118 118 ? ? ? B . n B 1 119 HIS 119 119 ? ? ? B . n B 1 120 HIS 120 120 ? ? ? B . n B 1 121 HIS 121 121 ? ? ? B . n B 1 122 HIS 122 122 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 DM1 1 201 1 DM1 DM1 A . D 3 HOH 1 301 14 HOH HOH A . D 3 HOH 2 302 20 HOH HOH A . D 3 HOH 3 303 10 HOH HOH A . D 3 HOH 4 304 17 HOH HOH A . D 3 HOH 5 305 9 HOH HOH A . D 3 HOH 6 306 6 HOH HOH A . D 3 HOH 7 307 3 HOH HOH A . D 3 HOH 8 308 5 HOH HOH A . D 3 HOH 9 309 4 HOH HOH A . D 3 HOH 10 310 8 HOH HOH A . D 3 HOH 11 311 1 HOH HOH A . D 3 HOH 12 312 2 HOH HOH A . D 3 HOH 13 313 21 HOH HOH A . D 3 HOH 14 314 7 HOH HOH A . D 3 HOH 15 315 18 HOH HOH A . D 3 HOH 16 316 23 HOH HOH A . D 3 HOH 17 317 12 HOH HOH A . D 3 HOH 18 318 16 HOH HOH A . D 3 HOH 19 319 22 HOH HOH A . E 3 HOH 1 201 13 HOH HOH B . E 3 HOH 2 202 11 HOH HOH B . E 3 HOH 3 203 15 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.7 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1-4487 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 97.310 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7QZ6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.157 _cell.length_a_esd ? _cell.length_b 35.382 _cell.length_b_esd ? _cell.length_c 67.787 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QZ6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QZ6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Protein solution: 6 mg/ml in 20 mM Tris-HCl, pH 8.0, 300 mM NaCl. Reservoir solution: 100 mM HEPES, pH 7.0, 200 mM NH4Cl, 20% PEG 6000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976250 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976250 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 54.240 _reflns.entry_id 7QZ6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.150 _reflns.d_resolution_low 43.470 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13450 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.400 _reflns.pdbx_Rmerge_I_obs 0.038 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 13 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.045 _reflns.pdbx_Rpim_I_all 0.025 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 45664 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.150 2.220 ? ? 4037 ? ? ? 1174 99.700 ? ? ? ? 0.638 ? ? ? ? ? ? ? ? 3.400 ? ? ? 1.700 0.756 0.401 ? 1 1 0.480 ? ? ? ? ? ? ? ? ? ? 8.860 43.470 ? ? 627 ? ? ? 212 98.600 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 3.000 ? ? ? 39.500 0.039 0.022 ? 2 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 198.520 _refine.B_iso_mean 90.0857 _refine.B_iso_min 29.770 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QZ6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1500 _refine.ls_d_res_low 43.4700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13442 _refine.ls_number_reflns_R_free 696 _refine.ls_number_reflns_R_work 12746 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3000 _refine.ls_percent_reflns_R_free 5.1800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2289 _refine.ls_R_factor_R_free 0.2848 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2258 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.400 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3F8B _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.4800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1500 _refine_hist.d_res_low 43.4700 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 1800 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 208 _refine_hist.pdbx_B_iso_mean_ligand 121.47 _refine_hist.pdbx_B_iso_mean_solvent 60.68 _refine_hist.pdbx_number_atoms_protein 1712 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 66 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1018 5.355 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1018 5.355 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1500 2.3200 2669 . 139 2530 100.0000 . . . 0.3955 0.0000 0.3495 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.3200 2.5500 2649 . 145 2504 99.0000 . . . 0.3319 0.0000 0.2927 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.5500 2.9200 2674 . 114 2560 100.0000 . . . 0.3557 0.0000 0.2939 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.9200 3.6800 2675 . 145 2530 99.0000 . . . 0.2712 0.0000 0.2522 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.6800 43.4700 2775 . 153 2622 99.0000 . . . 0.2657 0.0000 0.1838 . . . . . . . 5 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 '(chain A and (resid 5 through 68 or resid 74 through 112))' 1 2 '(chain B and (resid 5 through 68 or resid 74 through 112))' # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A PRO 5 . A GLY 68 . A PRO 5 A GLY 68 ? '(chain A and (resid 5 through 68 or resid 74 through 112))' 1 1 2 A GLY 74 . A SER 112 . A GLY 74 A SER 112 ? '(chain A and (resid 5 through 68 or resid 74 through 112))' 1 2 1 B PRO 5 . B GLY 68 . B PRO 5 B GLY 68 ? '(chain B and (resid 5 through 68 or resid 74 through 112))' 1 2 2 B GLY 74 . B SER 112 . B GLY 74 B SER 112 ? '(chain B and (resid 5 through 68 or resid 74 through 112))' # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7QZ6 _struct.title 'Transcriptional regulator LmrR with bound daunomycin and with Trp-67 and Trp-96 replaced by 5-fluoroTrp' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QZ6 _struct_keywords.text 'Transcriptional regulator, PadR, Fluorinated tryptophan, Daunomycin, pi-pi interactions, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A2RI36_LACLM _struct_ref.pdbx_db_accession A2RI36 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYR LTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIK ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7QZ6 A 1 ? 116 ? A2RI36 1 ? 116 ? 1 116 2 1 7QZ6 B 1 ? 116 ? A2RI36 1 ? 116 ? 1 116 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QZ6 HIS A 117 ? UNP A2RI36 ? ? 'expression tag' 117 1 1 7QZ6 HIS A 118 ? UNP A2RI36 ? ? 'expression tag' 118 2 1 7QZ6 HIS A 119 ? UNP A2RI36 ? ? 'expression tag' 119 3 1 7QZ6 HIS A 120 ? UNP A2RI36 ? ? 'expression tag' 120 4 1 7QZ6 HIS A 121 ? UNP A2RI36 ? ? 'expression tag' 121 5 1 7QZ6 HIS A 122 ? UNP A2RI36 ? ? 'expression tag' 122 6 2 7QZ6 HIS B 117 ? UNP A2RI36 ? ? 'expression tag' 117 7 2 7QZ6 HIS B 118 ? UNP A2RI36 ? ? 'expression tag' 118 8 2 7QZ6 HIS B 119 ? UNP A2RI36 ? ? 'expression tag' 119 9 2 7QZ6 HIS B 120 ? UNP A2RI36 ? ? 'expression tag' 120 10 2 7QZ6 HIS B 121 ? UNP A2RI36 ? ? 'expression tag' 121 11 2 7QZ6 HIS B 122 ? UNP A2RI36 ? ? 'expression tag' 122 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3740 ? 1 MORE -22 ? 1 'SSA (A^2)' 12940 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 5 ? GLY A 24 ? PRO A 5 GLY A 24 1 ? 20 HELX_P HELX_P2 AA2 TYR A 27 ? SER A 39 ? TYR A 27 SER A 39 1 ? 13 HELX_P HELX_P3 AA3 ASN A 46 ? ASP A 60 ? ASN A 46 ASP A 60 1 ? 15 HELX_P HELX_P4 AA4 THR A 82 ? SER A 112 ? THR A 82 SER A 112 1 ? 31 HELX_P HELX_P5 AA5 LYS B 6 ? GLY B 24 ? LYS B 6 GLY B 24 1 ? 19 HELX_P HELX_P6 AA6 TYR B 27 ? SER B 39 ? TYR B 27 SER B 39 1 ? 13 HELX_P HELX_P7 AA7 ASN B 46 ? ASP B 60 ? ASN B 46 ASP B 60 1 ? 15 HELX_P HELX_P8 AA8 THR B 82 ? SER B 112 ? THR B 82 SER B 112 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TYR 66 C ? ? ? 1_555 A FTR 67 N ? ? A TYR 66 A FTR 67 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? A FTR 67 C ? ? ? 1_555 A GLY 68 N ? ? A FTR 67 A GLY 68 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A SER 95 C ? ? ? 1_555 A FTR 96 N ? ? A SER 95 A FTR 96 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale4 covale both ? A FTR 96 C ? ? ? 1_555 A SER 97 N ? ? A FTR 96 A SER 97 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale5 covale both ? B TYR 66 C ? ? ? 1_555 B FTR 67 N ? ? B TYR 66 B FTR 67 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale6 covale both ? B FTR 67 C ? ? ? 1_555 B GLY 68 N ? ? B FTR 67 B GLY 68 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale7 covale both ? B SER 95 C ? ? ? 1_555 B FTR 96 N ? ? B SER 95 B FTR 96 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale8 covale both ? B FTR 96 C ? ? ? 1_555 B SER 97 N ? ? B FTR 96 B SER 97 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 63 ? FTR A 67 ? ILE A 63 FTR A 67 AA1 2 LYS A 77 ? LEU A 81 ? LYS A 77 LEU A 81 AA2 1 ILE B 63 ? GLY B 68 ? ILE B 63 GLY B 68 AA2 2 ARG B 76 ? LEU B 81 ? ARG B 76 LEU B 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 66 ? N TYR A 66 O TYR A 78 ? O TYR A 78 AA2 1 2 N TYR B 66 ? N TYR B 66 O TYR B 78 ? O TYR B 78 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 40 ? ? 36.94 46.63 2 1 ASN B 40 ? ? 39.29 48.16 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A FTR 67 A FTR 67 ? TRP 'modified residue' 2 A FTR 96 A FTR 96 ? TRP 'modified residue' 3 B FTR 67 B FTR 67 ? TRP 'modified residue' 4 B FTR 96 B FTR 96 ? TRP 'modified residue' # _phasing.method MR # _pdbx_entry_details.entry_id 7QZ6 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A ASP 69 ? A ASP 69 6 1 Y 1 A GLU 70 ? A GLU 70 7 1 Y 1 A SER 71 ? A SER 71 8 1 Y 1 A GLN 72 ? A GLN 72 9 1 Y 1 A GLU 113 ? A GLU 113 10 1 Y 1 A ALA 114 ? A ALA 114 11 1 Y 1 A ILE 115 ? A ILE 115 12 1 Y 1 A LYS 116 ? A LYS 116 13 1 Y 1 A HIS 117 ? A HIS 117 14 1 Y 1 A HIS 118 ? A HIS 118 15 1 Y 1 A HIS 119 ? A HIS 119 16 1 Y 1 A HIS 120 ? A HIS 120 17 1 Y 1 A HIS 121 ? A HIS 121 18 1 Y 1 A HIS 122 ? A HIS 122 19 1 Y 1 B MET 1 ? B MET 1 20 1 Y 1 B ALA 2 ? B ALA 2 21 1 Y 1 B GLU 3 ? B GLU 3 22 1 Y 1 B ILE 4 ? B ILE 4 23 1 Y 1 B GLU 70 ? B GLU 70 24 1 Y 1 B SER 71 ? B SER 71 25 1 Y 1 B GLN 72 ? B GLN 72 26 1 Y 1 B GLY 73 ? B GLY 73 27 1 Y 1 B GLU 113 ? B GLU 113 28 1 Y 1 B ALA 114 ? B ALA 114 29 1 Y 1 B ILE 115 ? B ILE 115 30 1 Y 1 B LYS 116 ? B LYS 116 31 1 Y 1 B HIS 117 ? B HIS 117 32 1 Y 1 B HIS 118 ? B HIS 118 33 1 Y 1 B HIS 119 ? B HIS 119 34 1 Y 1 B HIS 120 ? B HIS 120 35 1 Y 1 B HIS 121 ? B HIS 121 36 1 Y 1 B HIS 122 ? B HIS 122 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 DM1 C1 C Y N 74 DM1 C2 C Y N 75 DM1 C3 C Y N 76 DM1 C4 C Y N 77 DM1 O4 O N N 78 DM1 C5 C Y N 79 DM1 C6 C N N 80 DM1 O6 O N N 81 DM1 C7 C Y N 82 DM1 C8 C Y N 83 DM1 O8 O N N 84 DM1 C9 C Y N 85 DM1 C10 C N S 86 DM1 O10 O N N 87 DM1 C11 C N N 88 DM1 C12 C N S 89 DM1 O12 O N N 90 DM1 C13 C N N 91 DM1 O13 O N N 92 DM1 C14 C N N 93 DM1 C15 C N N 94 DM1 C16 C Y N 95 DM1 C17 C Y N 96 DM1 O17 O N N 97 DM1 C18 C Y N 98 DM1 C19 C N N 99 DM1 O19 O N N 100 DM1 C20 C Y N 101 DM1 C21 C N N 102 DM1 "C1'" C N R 103 DM1 "C2'" C N N 104 DM1 "C3'" C N S 105 DM1 "N3'" N N N 106 DM1 "C4'" C N S 107 DM1 "O4'" O N N 108 DM1 "C5'" C N S 109 DM1 "O5'" O N N 110 DM1 "C6'" C N N 111 DM1 H1 H N N 112 DM1 H2 H N N 113 DM1 H3 H N N 114 DM1 HO8 H N N 115 DM1 H10 H N N 116 DM1 H111 H N N 117 DM1 H112 H N N 118 DM1 HO12 H N N 119 DM1 H141 H N N 120 DM1 H142 H N N 121 DM1 H143 H N N 122 DM1 H151 H N N 123 DM1 H152 H N N 124 DM1 HO17 H N N 125 DM1 H211 H N N 126 DM1 H212 H N N 127 DM1 H213 H N N 128 DM1 "H1'" H N N 129 DM1 "H2'1" H N N 130 DM1 "H2'2" H N N 131 DM1 "H3'" H N N 132 DM1 "HN'1" H N N 133 DM1 "HN'2" H N N 134 DM1 "H4'" H N N 135 DM1 "HO4'" H N N 136 DM1 "H5'" H N N 137 DM1 "H6'1" H N N 138 DM1 "H6'2" H N N 139 DM1 "H6'3" H N N 140 FTR N N N N 141 FTR CA C N S 142 FTR CB C N N 143 FTR CG C Y N 144 FTR CD2 C Y N 145 FTR CE2 C Y N 146 FTR CE3 C Y N 147 FTR CD1 C Y N 148 FTR NE1 N Y N 149 FTR CZ2 C Y N 150 FTR CZ3 C Y N 151 FTR F F N N 152 FTR CH2 C Y N 153 FTR C C N N 154 FTR O O N N 155 FTR OXT O N N 156 FTR H H N N 157 FTR H2 H N N 158 FTR HA H N N 159 FTR HB2 H N N 160 FTR HB3 H N N 161 FTR HE3 H N N 162 FTR HD1 H N N 163 FTR HE1 H N N 164 FTR HZ2 H N N 165 FTR HH2 H N N 166 FTR HXT H N N 167 GLN N N N N 168 GLN CA C N S 169 GLN C C N N 170 GLN O O N N 171 GLN CB C N N 172 GLN CG C N N 173 GLN CD C N N 174 GLN OE1 O N N 175 GLN NE2 N N N 176 GLN OXT O N N 177 GLN H H N N 178 GLN H2 H N N 179 GLN HA H N N 180 GLN HB2 H N N 181 GLN HB3 H N N 182 GLN HG2 H N N 183 GLN HG3 H N N 184 GLN HE21 H N N 185 GLN HE22 H N N 186 GLN HXT H N N 187 GLU N N N N 188 GLU CA C N S 189 GLU C C N N 190 GLU O O N N 191 GLU CB C N N 192 GLU CG C N N 193 GLU CD C N N 194 GLU OE1 O N N 195 GLU OE2 O N N 196 GLU OXT O N N 197 GLU H H N N 198 GLU H2 H N N 199 GLU HA H N N 200 GLU HB2 H N N 201 GLU HB3 H N N 202 GLU HG2 H N N 203 GLU HG3 H N N 204 GLU HE2 H N N 205 GLU HXT H N N 206 GLY N N N N 207 GLY CA C N N 208 GLY C C N N 209 GLY O O N N 210 GLY OXT O N N 211 GLY H H N N 212 GLY H2 H N N 213 GLY HA2 H N N 214 GLY HA3 H N N 215 GLY HXT H N N 216 HIS N N N N 217 HIS CA C N S 218 HIS C C N N 219 HIS O O N N 220 HIS CB C N N 221 HIS CG C Y N 222 HIS ND1 N Y N 223 HIS CD2 C Y N 224 HIS CE1 C Y N 225 HIS NE2 N Y N 226 HIS OXT O N N 227 HIS H H N N 228 HIS H2 H N N 229 HIS HA H N N 230 HIS HB2 H N N 231 HIS HB3 H N N 232 HIS HD1 H N N 233 HIS HD2 H N N 234 HIS HE1 H N N 235 HIS HE2 H N N 236 HIS HXT H N N 237 HOH O O N N 238 HOH H1 H N N 239 HOH H2 H N N 240 ILE N N N N 241 ILE CA C N S 242 ILE C C N N 243 ILE O O N N 244 ILE CB C N S 245 ILE CG1 C N N 246 ILE CG2 C N N 247 ILE CD1 C N N 248 ILE OXT O N N 249 ILE H H N N 250 ILE H2 H N N 251 ILE HA H N N 252 ILE HB H N N 253 ILE HG12 H N N 254 ILE HG13 H N N 255 ILE HG21 H N N 256 ILE HG22 H N N 257 ILE HG23 H N N 258 ILE HD11 H N N 259 ILE HD12 H N N 260 ILE HD13 H N N 261 ILE HXT H N N 262 LEU N N N N 263 LEU CA C N S 264 LEU C C N N 265 LEU O O N N 266 LEU CB C N N 267 LEU CG C N N 268 LEU CD1 C N N 269 LEU CD2 C N N 270 LEU OXT O N N 271 LEU H H N N 272 LEU H2 H N N 273 LEU HA H N N 274 LEU HB2 H N N 275 LEU HB3 H N N 276 LEU HG H N N 277 LEU HD11 H N N 278 LEU HD12 H N N 279 LEU HD13 H N N 280 LEU HD21 H N N 281 LEU HD22 H N N 282 LEU HD23 H N N 283 LEU HXT H N N 284 LYS N N N N 285 LYS CA C N S 286 LYS C C N N 287 LYS O O N N 288 LYS CB C N N 289 LYS CG C N N 290 LYS CD C N N 291 LYS CE C N N 292 LYS NZ N N N 293 LYS OXT O N N 294 LYS H H N N 295 LYS H2 H N N 296 LYS HA H N N 297 LYS HB2 H N N 298 LYS HB3 H N N 299 LYS HG2 H N N 300 LYS HG3 H N N 301 LYS HD2 H N N 302 LYS HD3 H N N 303 LYS HE2 H N N 304 LYS HE3 H N N 305 LYS HZ1 H N N 306 LYS HZ2 H N N 307 LYS HZ3 H N N 308 LYS HXT H N N 309 MET N N N N 310 MET CA C N S 311 MET C C N N 312 MET O O N N 313 MET CB C N N 314 MET CG C N N 315 MET SD S N N 316 MET CE C N N 317 MET OXT O N N 318 MET H H N N 319 MET H2 H N N 320 MET HA H N N 321 MET HB2 H N N 322 MET HB3 H N N 323 MET HG2 H N N 324 MET HG3 H N N 325 MET HE1 H N N 326 MET HE2 H N N 327 MET HE3 H N N 328 MET HXT H N N 329 PHE N N N N 330 PHE CA C N S 331 PHE C C N N 332 PHE O O N N 333 PHE CB C N N 334 PHE CG C Y N 335 PHE CD1 C Y N 336 PHE CD2 C Y N 337 PHE CE1 C Y N 338 PHE CE2 C Y N 339 PHE CZ C Y N 340 PHE OXT O N N 341 PHE H H N N 342 PHE H2 H N N 343 PHE HA H N N 344 PHE HB2 H N N 345 PHE HB3 H N N 346 PHE HD1 H N N 347 PHE HD2 H N N 348 PHE HE1 H N N 349 PHE HE2 H N N 350 PHE HZ H N N 351 PHE HXT H N N 352 PRO N N N N 353 PRO CA C N S 354 PRO C C N N 355 PRO O O N N 356 PRO CB C N N 357 PRO CG C N N 358 PRO CD C N N 359 PRO OXT O N N 360 PRO H H N N 361 PRO HA H N N 362 PRO HB2 H N N 363 PRO HB3 H N N 364 PRO HG2 H N N 365 PRO HG3 H N N 366 PRO HD2 H N N 367 PRO HD3 H N N 368 PRO HXT H N N 369 SER N N N N 370 SER CA C N S 371 SER C C N N 372 SER O O N N 373 SER CB C N N 374 SER OG O N N 375 SER OXT O N N 376 SER H H N N 377 SER H2 H N N 378 SER HA H N N 379 SER HB2 H N N 380 SER HB3 H N N 381 SER HG H N N 382 SER HXT H N N 383 THR N N N N 384 THR CA C N S 385 THR C C N N 386 THR O O N N 387 THR CB C N R 388 THR OG1 O N N 389 THR CG2 C N N 390 THR OXT O N N 391 THR H H N N 392 THR H2 H N N 393 THR HA H N N 394 THR HB H N N 395 THR HG1 H N N 396 THR HG21 H N N 397 THR HG22 H N N 398 THR HG23 H N N 399 THR HXT H N N 400 TYR N N N N 401 TYR CA C N S 402 TYR C C N N 403 TYR O O N N 404 TYR CB C N N 405 TYR CG C Y N 406 TYR CD1 C Y N 407 TYR CD2 C Y N 408 TYR CE1 C Y N 409 TYR CE2 C Y N 410 TYR CZ C Y N 411 TYR OH O N N 412 TYR OXT O N N 413 TYR H H N N 414 TYR H2 H N N 415 TYR HA H N N 416 TYR HB2 H N N 417 TYR HB3 H N N 418 TYR HD1 H N N 419 TYR HD2 H N N 420 TYR HE1 H N N 421 TYR HE2 H N N 422 TYR HH H N N 423 TYR HXT H N N 424 VAL N N N N 425 VAL CA C N S 426 VAL C C N N 427 VAL O O N N 428 VAL CB C N N 429 VAL CG1 C N N 430 VAL CG2 C N N 431 VAL OXT O N N 432 VAL H H N N 433 VAL H2 H N N 434 VAL HA H N N 435 VAL HB H N N 436 VAL HG11 H N N 437 VAL HG12 H N N 438 VAL HG13 H N N 439 VAL HG21 H N N 440 VAL HG22 H N N 441 VAL HG23 H N N 442 VAL HXT H N N 443 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 DM1 C1 C2 doub Y N 70 DM1 C1 C20 sing Y N 71 DM1 C1 H1 sing N N 72 DM1 C2 C3 sing Y N 73 DM1 C2 H2 sing N N 74 DM1 C3 C4 doub Y N 75 DM1 C3 H3 sing N N 76 DM1 C4 O4 sing N N 77 DM1 C4 C5 sing Y N 78 DM1 O4 C21 sing N N 79 DM1 C5 C6 sing N N 80 DM1 C5 C20 doub Y N 81 DM1 C6 O6 doub N N 82 DM1 C6 C7 sing N N 83 DM1 C7 C8 doub Y N 84 DM1 C7 C18 sing Y N 85 DM1 C8 O8 sing N N 86 DM1 C8 C9 sing Y N 87 DM1 O8 HO8 sing N N 88 DM1 C9 C10 sing N N 89 DM1 C9 C16 doub Y N 90 DM1 C10 O10 sing N N 91 DM1 C10 C11 sing N N 92 DM1 C10 H10 sing N N 93 DM1 O10 "C1'" sing N N 94 DM1 C11 C12 sing N N 95 DM1 C11 H111 sing N N 96 DM1 C11 H112 sing N N 97 DM1 C12 O12 sing N N 98 DM1 C12 C13 sing N N 99 DM1 C12 C15 sing N N 100 DM1 O12 HO12 sing N N 101 DM1 C13 O13 doub N N 102 DM1 C13 C14 sing N N 103 DM1 C14 H141 sing N N 104 DM1 C14 H142 sing N N 105 DM1 C14 H143 sing N N 106 DM1 C15 C16 sing N N 107 DM1 C15 H151 sing N N 108 DM1 C15 H152 sing N N 109 DM1 C16 C17 sing Y N 110 DM1 C17 O17 sing N N 111 DM1 C17 C18 doub Y N 112 DM1 O17 HO17 sing N N 113 DM1 C18 C19 sing N N 114 DM1 C19 O19 doub N N 115 DM1 C19 C20 sing N N 116 DM1 C21 H211 sing N N 117 DM1 C21 H212 sing N N 118 DM1 C21 H213 sing N N 119 DM1 "C1'" "C2'" sing N N 120 DM1 "C1'" "O5'" sing N N 121 DM1 "C1'" "H1'" sing N N 122 DM1 "C2'" "C3'" sing N N 123 DM1 "C2'" "H2'1" sing N N 124 DM1 "C2'" "H2'2" sing N N 125 DM1 "C3'" "N3'" sing N N 126 DM1 "C3'" "C4'" sing N N 127 DM1 "C3'" "H3'" sing N N 128 DM1 "N3'" "HN'1" sing N N 129 DM1 "N3'" "HN'2" sing N N 130 DM1 "C4'" "O4'" sing N N 131 DM1 "C4'" "C5'" sing N N 132 DM1 "C4'" "H4'" sing N N 133 DM1 "O4'" "HO4'" sing N N 134 DM1 "C5'" "O5'" sing N N 135 DM1 "C5'" "C6'" sing N N 136 DM1 "C5'" "H5'" sing N N 137 DM1 "C6'" "H6'1" sing N N 138 DM1 "C6'" "H6'2" sing N N 139 DM1 "C6'" "H6'3" sing N N 140 FTR N CA sing N N 141 FTR N H sing N N 142 FTR N H2 sing N N 143 FTR CA CB sing N N 144 FTR CA C sing N N 145 FTR CA HA sing N N 146 FTR CB CG sing N N 147 FTR CB HB2 sing N N 148 FTR CB HB3 sing N N 149 FTR CG CD2 sing Y N 150 FTR CG CD1 doub Y N 151 FTR CD2 CE2 doub Y N 152 FTR CD2 CE3 sing Y N 153 FTR CE2 NE1 sing Y N 154 FTR CE2 CZ2 sing Y N 155 FTR CE3 CZ3 doub Y N 156 FTR CE3 HE3 sing N N 157 FTR CD1 NE1 sing Y N 158 FTR CD1 HD1 sing N N 159 FTR NE1 HE1 sing N N 160 FTR CZ2 CH2 doub Y N 161 FTR CZ2 HZ2 sing N N 162 FTR CZ3 F sing N N 163 FTR CZ3 CH2 sing Y N 164 FTR CH2 HH2 sing N N 165 FTR C O doub N N 166 FTR C OXT sing N N 167 FTR OXT HXT sing N N 168 GLN N CA sing N N 169 GLN N H sing N N 170 GLN N H2 sing N N 171 GLN CA C sing N N 172 GLN CA CB sing N N 173 GLN CA HA sing N N 174 GLN C O doub N N 175 GLN C OXT sing N N 176 GLN CB CG sing N N 177 GLN CB HB2 sing N N 178 GLN CB HB3 sing N N 179 GLN CG CD sing N N 180 GLN CG HG2 sing N N 181 GLN CG HG3 sing N N 182 GLN CD OE1 doub N N 183 GLN CD NE2 sing N N 184 GLN NE2 HE21 sing N N 185 GLN NE2 HE22 sing N N 186 GLN OXT HXT sing N N 187 GLU N CA sing N N 188 GLU N H sing N N 189 GLU N H2 sing N N 190 GLU CA C sing N N 191 GLU CA CB sing N N 192 GLU CA HA sing N N 193 GLU C O doub N N 194 GLU C OXT sing N N 195 GLU CB CG sing N N 196 GLU CB HB2 sing N N 197 GLU CB HB3 sing N N 198 GLU CG CD sing N N 199 GLU CG HG2 sing N N 200 GLU CG HG3 sing N N 201 GLU CD OE1 doub N N 202 GLU CD OE2 sing N N 203 GLU OE2 HE2 sing N N 204 GLU OXT HXT sing N N 205 GLY N CA sing N N 206 GLY N H sing N N 207 GLY N H2 sing N N 208 GLY CA C sing N N 209 GLY CA HA2 sing N N 210 GLY CA HA3 sing N N 211 GLY C O doub N N 212 GLY C OXT sing N N 213 GLY OXT HXT sing N N 214 HIS N CA sing N N 215 HIS N H sing N N 216 HIS N H2 sing N N 217 HIS CA C sing N N 218 HIS CA CB sing N N 219 HIS CA HA sing N N 220 HIS C O doub N N 221 HIS C OXT sing N N 222 HIS CB CG sing N N 223 HIS CB HB2 sing N N 224 HIS CB HB3 sing N N 225 HIS CG ND1 sing Y N 226 HIS CG CD2 doub Y N 227 HIS ND1 CE1 doub Y N 228 HIS ND1 HD1 sing N N 229 HIS CD2 NE2 sing Y N 230 HIS CD2 HD2 sing N N 231 HIS CE1 NE2 sing Y N 232 HIS CE1 HE1 sing N N 233 HIS NE2 HE2 sing N N 234 HIS OXT HXT sing N N 235 HOH O H1 sing N N 236 HOH O H2 sing N N 237 ILE N CA sing N N 238 ILE N H sing N N 239 ILE N H2 sing N N 240 ILE CA C sing N N 241 ILE CA CB sing N N 242 ILE CA HA sing N N 243 ILE C O doub N N 244 ILE C OXT sing N N 245 ILE CB CG1 sing N N 246 ILE CB CG2 sing N N 247 ILE CB HB sing N N 248 ILE CG1 CD1 sing N N 249 ILE CG1 HG12 sing N N 250 ILE CG1 HG13 sing N N 251 ILE CG2 HG21 sing N N 252 ILE CG2 HG22 sing N N 253 ILE CG2 HG23 sing N N 254 ILE CD1 HD11 sing N N 255 ILE CD1 HD12 sing N N 256 ILE CD1 HD13 sing N N 257 ILE OXT HXT sing N N 258 LEU N CA sing N N 259 LEU N H sing N N 260 LEU N H2 sing N N 261 LEU CA C sing N N 262 LEU CA CB sing N N 263 LEU CA HA sing N N 264 LEU C O doub N N 265 LEU C OXT sing N N 266 LEU CB CG sing N N 267 LEU CB HB2 sing N N 268 LEU CB HB3 sing N N 269 LEU CG CD1 sing N N 270 LEU CG CD2 sing N N 271 LEU CG HG sing N N 272 LEU CD1 HD11 sing N N 273 LEU CD1 HD12 sing N N 274 LEU CD1 HD13 sing N N 275 LEU CD2 HD21 sing N N 276 LEU CD2 HD22 sing N N 277 LEU CD2 HD23 sing N N 278 LEU OXT HXT sing N N 279 LYS N CA sing N N 280 LYS N H sing N N 281 LYS N H2 sing N N 282 LYS CA C sing N N 283 LYS CA CB sing N N 284 LYS CA HA sing N N 285 LYS C O doub N N 286 LYS C OXT sing N N 287 LYS CB CG sing N N 288 LYS CB HB2 sing N N 289 LYS CB HB3 sing N N 290 LYS CG CD sing N N 291 LYS CG HG2 sing N N 292 LYS CG HG3 sing N N 293 LYS CD CE sing N N 294 LYS CD HD2 sing N N 295 LYS CD HD3 sing N N 296 LYS CE NZ sing N N 297 LYS CE HE2 sing N N 298 LYS CE HE3 sing N N 299 LYS NZ HZ1 sing N N 300 LYS NZ HZ2 sing N N 301 LYS NZ HZ3 sing N N 302 LYS OXT HXT sing N N 303 MET N CA sing N N 304 MET N H sing N N 305 MET N H2 sing N N 306 MET CA C sing N N 307 MET CA CB sing N N 308 MET CA HA sing N N 309 MET C O doub N N 310 MET C OXT sing N N 311 MET CB CG sing N N 312 MET CB HB2 sing N N 313 MET CB HB3 sing N N 314 MET CG SD sing N N 315 MET CG HG2 sing N N 316 MET CG HG3 sing N N 317 MET SD CE sing N N 318 MET CE HE1 sing N N 319 MET CE HE2 sing N N 320 MET CE HE3 sing N N 321 MET OXT HXT sing N N 322 PHE N CA sing N N 323 PHE N H sing N N 324 PHE N H2 sing N N 325 PHE CA C sing N N 326 PHE CA CB sing N N 327 PHE CA HA sing N N 328 PHE C O doub N N 329 PHE C OXT sing N N 330 PHE CB CG sing N N 331 PHE CB HB2 sing N N 332 PHE CB HB3 sing N N 333 PHE CG CD1 doub Y N 334 PHE CG CD2 sing Y N 335 PHE CD1 CE1 sing Y N 336 PHE CD1 HD1 sing N N 337 PHE CD2 CE2 doub Y N 338 PHE CD2 HD2 sing N N 339 PHE CE1 CZ doub Y N 340 PHE CE1 HE1 sing N N 341 PHE CE2 CZ sing Y N 342 PHE CE2 HE2 sing N N 343 PHE CZ HZ sing N N 344 PHE OXT HXT sing N N 345 PRO N CA sing N N 346 PRO N CD sing N N 347 PRO N H sing N N 348 PRO CA C sing N N 349 PRO CA CB sing N N 350 PRO CA HA sing N N 351 PRO C O doub N N 352 PRO C OXT sing N N 353 PRO CB CG sing N N 354 PRO CB HB2 sing N N 355 PRO CB HB3 sing N N 356 PRO CG CD sing N N 357 PRO CG HG2 sing N N 358 PRO CG HG3 sing N N 359 PRO CD HD2 sing N N 360 PRO CD HD3 sing N N 361 PRO OXT HXT sing N N 362 SER N CA sing N N 363 SER N H sing N N 364 SER N H2 sing N N 365 SER CA C sing N N 366 SER CA CB sing N N 367 SER CA HA sing N N 368 SER C O doub N N 369 SER C OXT sing N N 370 SER CB OG sing N N 371 SER CB HB2 sing N N 372 SER CB HB3 sing N N 373 SER OG HG sing N N 374 SER OXT HXT sing N N 375 THR N CA sing N N 376 THR N H sing N N 377 THR N H2 sing N N 378 THR CA C sing N N 379 THR CA CB sing N N 380 THR CA HA sing N N 381 THR C O doub N N 382 THR C OXT sing N N 383 THR CB OG1 sing N N 384 THR CB CG2 sing N N 385 THR CB HB sing N N 386 THR OG1 HG1 sing N N 387 THR CG2 HG21 sing N N 388 THR CG2 HG22 sing N N 389 THR CG2 HG23 sing N N 390 THR OXT HXT sing N N 391 TYR N CA sing N N 392 TYR N H sing N N 393 TYR N H2 sing N N 394 TYR CA C sing N N 395 TYR CA CB sing N N 396 TYR CA HA sing N N 397 TYR C O doub N N 398 TYR C OXT sing N N 399 TYR CB CG sing N N 400 TYR CB HB2 sing N N 401 TYR CB HB3 sing N N 402 TYR CG CD1 doub Y N 403 TYR CG CD2 sing Y N 404 TYR CD1 CE1 sing Y N 405 TYR CD1 HD1 sing N N 406 TYR CD2 CE2 doub Y N 407 TYR CD2 HD2 sing N N 408 TYR CE1 CZ doub Y N 409 TYR CE1 HE1 sing N N 410 TYR CE2 CZ sing Y N 411 TYR CE2 HE2 sing N N 412 TYR CZ OH sing N N 413 TYR OH HH sing N N 414 TYR OXT HXT sing N N 415 VAL N CA sing N N 416 VAL N H sing N N 417 VAL N H2 sing N N 418 VAL CA C sing N N 419 VAL CA CB sing N N 420 VAL CA HA sing N N 421 VAL C O doub N N 422 VAL C OXT sing N N 423 VAL CB CG1 sing N N 424 VAL CB CG2 sing N N 425 VAL CB HB sing N N 426 VAL CG1 HG11 sing N N 427 VAL CG1 HG12 sing N N 428 VAL CG1 HG13 sing N N 429 VAL CG2 HG21 sing N N 430 VAL CG2 HG22 sing N N 431 VAL CG2 HG23 sing N N 432 VAL OXT HXT sing N N 433 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 DM1 ? ? DM1 ? ? 'SUBJECT OF INVESTIGATION' ? 2 FTR ? ? FTR ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3F8B _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7QZ6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009694 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001244 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028263 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014873 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F H N O S # loop_