data_7QZ6
# 
_entry.id   7QZ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.384 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7QZ6         pdb_00007qz6 10.2210/pdb7qz6/pdb 
WWPDB D_1292120661 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-11-23 
2 'Structure model' 1 1 2024-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' pdbx_initial_refinement_model 
4 2 'Structure model' struct_ncs_dom_lim            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id'  
2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 
3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 
4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id'  
5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id'  
6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 
7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 
8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id'  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7QZ6 
_pdbx_database_status.recvd_initial_deposition_date   2022-01-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 7QZ5 PDB . 
unspecified 7QZ7 PDB . 
unspecified 7QZ8 PDB . 
unspecified 7QZ9 PDB . 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              a.m.w.h.thunnissen@rug.nl 
_pdbx_contact_author.name_first         Andy-Mark 
_pdbx_contact_author.name_last          Thunnissen 
_pdbx_contact_author.name_mi            W.H. 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0002-1915-9850 
# 
_audit_author.name               'Thunnissen, A.M.W.H.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_id_ASTM           JACSAT 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1520-5126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            144 
_citation.language                  ? 
_citation.page_first                13815 
_citation.page_last                 13822 
_citation.title                     'The Role of Tryptophan in pi Interactions in Proteins: An Experimental Approach.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/jacs.2c04986 
_citation.pdbx_database_id_PubMed   35868012 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shao, J.'           1 ?                   
primary 'Kuiper, B.P.'       2 ?                   
primary 'Thunnissen, A.W.H.' 3 0000-0002-1915-9850 
primary 'Cool, R.H.'         4 ?                   
primary 'Zhou, L.'           5 ?                   
primary 'Huang, C.'          6 ?                   
primary 'Dijkstra, B.W.'     7 0000-0001-9731-6586 
primary 'Broos, J.'          8 0000-0001-7746-4709 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcriptional regulator, PadR-like family' 14343.235 2  ? 'W67 and W96 are replaced by 5-fluoroTrp' ? ? 
2 non-polymer syn DAUNOMYCIN                                    527.520   1  ? ?                                         ? ? 
3 water       nat water                                         18.015    22 ? ?                                         ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSY(FTR)GDESQGGRR
KYYRLTEIGHENMRLAFES(FTR)SRVDKIIENLEANKKSEAIKHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYR
LTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIKHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 DAUNOMYCIN DM1 
3 water      HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLU n 
1 4   ILE n 
1 5   PRO n 
1 6   LYS n 
1 7   GLU n 
1 8   MET n 
1 9   LEU n 
1 10  ARG n 
1 11  ALA n 
1 12  GLN n 
1 13  THR n 
1 14  ASN n 
1 15  VAL n 
1 16  ILE n 
1 17  LEU n 
1 18  LEU n 
1 19  ASN n 
1 20  VAL n 
1 21  LEU n 
1 22  LYS n 
1 23  GLN n 
1 24  GLY n 
1 25  ASP n 
1 26  ASN n 
1 27  TYR n 
1 28  VAL n 
1 29  TYR n 
1 30  GLY n 
1 31  ILE n 
1 32  ILE n 
1 33  LYS n 
1 34  GLN n 
1 35  VAL n 
1 36  LYS n 
1 37  GLU n 
1 38  ALA n 
1 39  SER n 
1 40  ASN n 
1 41  GLY n 
1 42  GLU n 
1 43  MET n 
1 44  GLU n 
1 45  LEU n 
1 46  ASN n 
1 47  GLU n 
1 48  ALA n 
1 49  THR n 
1 50  LEU n 
1 51  TYR n 
1 52  THR n 
1 53  ILE n 
1 54  PHE n 
1 55  LYS n 
1 56  ARG n 
1 57  LEU n 
1 58  GLU n 
1 59  LYS n 
1 60  ASP n 
1 61  GLY n 
1 62  ILE n 
1 63  ILE n 
1 64  SER n 
1 65  SER n 
1 66  TYR n 
1 67  FTR n 
1 68  GLY n 
1 69  ASP n 
1 70  GLU n 
1 71  SER n 
1 72  GLN n 
1 73  GLY n 
1 74  GLY n 
1 75  ARG n 
1 76  ARG n 
1 77  LYS n 
1 78  TYR n 
1 79  TYR n 
1 80  ARG n 
1 81  LEU n 
1 82  THR n 
1 83  GLU n 
1 84  ILE n 
1 85  GLY n 
1 86  HIS n 
1 87  GLU n 
1 88  ASN n 
1 89  MET n 
1 90  ARG n 
1 91  LEU n 
1 92  ALA n 
1 93  PHE n 
1 94  GLU n 
1 95  SER n 
1 96  FTR n 
1 97  SER n 
1 98  ARG n 
1 99  VAL n 
1 100 ASP n 
1 101 LYS n 
1 102 ILE n 
1 103 ILE n 
1 104 GLU n 
1 105 ASN n 
1 106 LEU n 
1 107 GLU n 
1 108 ALA n 
1 109 ASN n 
1 110 LYS n 
1 111 LYS n 
1 112 SER n 
1 113 GLU n 
1 114 ALA n 
1 115 ILE n 
1 116 LYS n 
1 117 HIS n 
1 118 HIS n 
1 119 HIS n 
1 120 HIS n 
1 121 HIS n 
1 122 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   122 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 llmg_0323 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    MG1363 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lactococcus cremoris' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1359 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?            'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE          ?            'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?            'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?            'C4 H7 N O4'      133.103 
DM1 non-polymer         . DAUNOMYCIN        DAUNORUBICIN 'C27 H29 N O10'   527.520 
FTR 'L-peptide linking' n FLUOROTRYPTOPHANE ?            'C11 H11 F N2 O2' 222.216 
GLN 'L-peptide linking' y GLUTAMINE         ?            'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?            'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE           ?            'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE         ?            'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER             ?            'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?            'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE           ?            'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE            ?            'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE        ?            'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?            'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE           ?            'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE            ?            'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE         ?            'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE          ?            'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE            ?            'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   ?   ?   ?   A . n 
A 1 4   ILE 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   MET 8   8   8   MET MET A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  GLN 12  12  12  GLN GLN A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ASN 14  14  14  ASN ASN A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ASN 19  19  19  ASN ASN A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  ASN 26  26  26  ASN ASN A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  TYR 51  51  51  TYR TYR A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  PHE 54  54  54  PHE PHE A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  FTR 67  67  67  FTR FTR A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  ASP 69  69  ?   ?   ?   A . n 
A 1 70  GLU 70  70  ?   ?   ?   A . n 
A 1 71  SER 71  71  ?   ?   ?   A . n 
A 1 72  GLN 72  72  ?   ?   ?   A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  HIS 86  86  86  HIS HIS A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  MET 89  89  89  MET MET A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  FTR 96  96  96  FTR FTR A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 GLU 113 113 ?   ?   ?   A . n 
A 1 114 ALA 114 114 ?   ?   ?   A . n 
A 1 115 ILE 115 115 ?   ?   ?   A . n 
A 1 116 LYS 116 116 ?   ?   ?   A . n 
A 1 117 HIS 117 117 ?   ?   ?   A . n 
A 1 118 HIS 118 118 ?   ?   ?   A . n 
A 1 119 HIS 119 119 ?   ?   ?   A . n 
A 1 120 HIS 120 120 ?   ?   ?   A . n 
A 1 121 HIS 121 121 ?   ?   ?   A . n 
A 1 122 HIS 122 122 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   GLU 3   3   ?   ?   ?   B . n 
B 1 4   ILE 4   4   ?   ?   ?   B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   GLU 7   7   7   GLU GLU B . n 
B 1 8   MET 8   8   8   MET MET B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  ARG 10  10  10  ARG ARG B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  GLN 12  12  12  GLN GLN B . n 
B 1 13  THR 13  13  13  THR THR B . n 
B 1 14  ASN 14  14  14  ASN ASN B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ASN 19  19  19  ASN ASN B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  LEU 21  21  21  LEU LEU B . n 
B 1 22  LYS 22  22  22  LYS LYS B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  ASP 25  25  25  ASP ASP B . n 
B 1 26  ASN 26  26  26  ASN ASN B . n 
B 1 27  TYR 27  27  27  TYR TYR B . n 
B 1 28  VAL 28  28  28  VAL VAL B . n 
B 1 29  TYR 29  29  29  TYR TYR B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  ILE 31  31  31  ILE ILE B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  LYS 33  33  33  LYS LYS B . n 
B 1 34  GLN 34  34  34  GLN GLN B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  LYS 36  36  36  LYS LYS B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  SER 39  39  39  SER SER B . n 
B 1 40  ASN 40  40  40  ASN ASN B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  MET 43  43  43  MET MET B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  ASN 46  46  46  ASN ASN B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  TYR 51  51  51  TYR TYR B . n 
B 1 52  THR 52  52  52  THR THR B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  PHE 54  54  54  PHE PHE B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  GLU 58  58  58  GLU GLU B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  GLY 61  61  61  GLY GLY B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  ILE 63  63  63  ILE ILE B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  TYR 66  66  66  TYR TYR B . n 
B 1 67  FTR 67  67  67  FTR FTR B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  ASP 69  69  69  ASP ASP B . n 
B 1 70  GLU 70  70  ?   ?   ?   B . n 
B 1 71  SER 71  71  ?   ?   ?   B . n 
B 1 72  GLN 72  72  ?   ?   ?   B . n 
B 1 73  GLY 73  73  ?   ?   ?   B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  ARG 75  75  75  ARG ARG B . n 
B 1 76  ARG 76  76  76  ARG ARG B . n 
B 1 77  LYS 77  77  77  LYS LYS B . n 
B 1 78  TYR 78  78  78  TYR TYR B . n 
B 1 79  TYR 79  79  79  TYR TYR B . n 
B 1 80  ARG 80  80  80  ARG ARG B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  GLU 83  83  83  GLU GLU B . n 
B 1 84  ILE 84  84  84  ILE ILE B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  HIS 86  86  86  HIS HIS B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  ASN 88  88  88  ASN ASN B . n 
B 1 89  MET 89  89  89  MET MET B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  ALA 92  92  92  ALA ALA B . n 
B 1 93  PHE 93  93  93  PHE PHE B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  SER 95  95  95  SER SER B . n 
B 1 96  FTR 96  96  96  FTR FTR B . n 
B 1 97  SER 97  97  97  SER SER B . n 
B 1 98  ARG 98  98  98  ARG ARG B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 ASN 105 105 105 ASN ASN B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 GLU 107 107 107 GLU GLU B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 ASN 109 109 109 ASN ASN B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 LYS 111 111 111 LYS LYS B . n 
B 1 112 SER 112 112 112 SER SER B . n 
B 1 113 GLU 113 113 ?   ?   ?   B . n 
B 1 114 ALA 114 114 ?   ?   ?   B . n 
B 1 115 ILE 115 115 ?   ?   ?   B . n 
B 1 116 LYS 116 116 ?   ?   ?   B . n 
B 1 117 HIS 117 117 ?   ?   ?   B . n 
B 1 118 HIS 118 118 ?   ?   ?   B . n 
B 1 119 HIS 119 119 ?   ?   ?   B . n 
B 1 120 HIS 120 120 ?   ?   ?   B . n 
B 1 121 HIS 121 121 ?   ?   ?   B . n 
B 1 122 HIS 122 122 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 DM1 1  201 1  DM1 DM1 A . 
D 3 HOH 1  301 14 HOH HOH A . 
D 3 HOH 2  302 20 HOH HOH A . 
D 3 HOH 3  303 10 HOH HOH A . 
D 3 HOH 4  304 17 HOH HOH A . 
D 3 HOH 5  305 9  HOH HOH A . 
D 3 HOH 6  306 6  HOH HOH A . 
D 3 HOH 7  307 3  HOH HOH A . 
D 3 HOH 8  308 5  HOH HOH A . 
D 3 HOH 9  309 4  HOH HOH A . 
D 3 HOH 10 310 8  HOH HOH A . 
D 3 HOH 11 311 1  HOH HOH A . 
D 3 HOH 12 312 2  HOH HOH A . 
D 3 HOH 13 313 21 HOH HOH A . 
D 3 HOH 14 314 7  HOH HOH A . 
D 3 HOH 15 315 18 HOH HOH A . 
D 3 HOH 16 316 23 HOH HOH A . 
D 3 HOH 17 317 12 HOH HOH A . 
D 3 HOH 18 318 16 HOH HOH A . 
D 3 HOH 19 319 22 HOH HOH A . 
E 3 HOH 1  201 13 HOH HOH B . 
E 3 HOH 2  202 11 HOH HOH B . 
E 3 HOH 3  203 15 HOH HOH B . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .           1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.7.7       2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .           3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.20.1-4487 4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27        5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   97.310 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7QZ6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     103.157 
_cell.length_a_esd                 ? 
_cell.length_b                     35.382 
_cell.length_b_esd                 ? 
_cell.length_c                     67.787 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7QZ6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7QZ6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.14 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.49 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;Protein solution: 6 mg/ml in 20 mM Tris-HCl, pH 8.0, 300 mM NaCl. Reservoir solution: 100 mM HEPES, pH 7.0, 200 mM NH4Cl, 20% PEG 6000
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-12-03 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976250 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.976250 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate                          54.240 
_reflns.entry_id                                       7QZ6 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.150 
_reflns.d_resolution_low                               43.470 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     13450 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           99.500 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                3.400 
_reflns.pdbx_Rmerge_I_obs                              0.038 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          14.100 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           13 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                0.045 
_reflns.pdbx_Rpim_I_all                                0.025 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       45664 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.999 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
_reflns_shell.pdbx_percent_possible_ellipsoidal 
_reflns_shell.pdbx_percent_possible_spherical 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous 
_reflns_shell.pdbx_percent_possible_spherical_anomalous 
_reflns_shell.pdbx_redundancy_anomalous 
_reflns_shell.pdbx_CC_half_anomalous 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous 
_reflns_shell.pdbx_percent_possible_anomalous 
2.150 2.220  ? ? 4037 ? ? ? 1174 99.700 ? ? ? ? 0.638 ? ? ? ? ? ? ? ? 3.400 ? ? ? 1.700  0.756 0.401 ? 1 1 0.480 ? ? ? ? ? ? ? ? ? 
? 
8.860 43.470 ? ? 627  ? ? ? 212  98.600 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 3.000 ? ? ? 39.500 0.039 0.022 ? 2 1 0.998 ? ? ? ? ? ? ? ? ? 
? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                198.520 
_refine.B_iso_mean                               90.0857 
_refine.B_iso_min                                29.770 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7QZ6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.1500 
_refine.ls_d_res_low                             43.4700 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     13442 
_refine.ls_number_reflns_R_free                  696 
_refine.ls_number_reflns_R_work                  12746 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.3000 
_refine.ls_percent_reflns_R_free                 5.1800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2289 
_refine.ls_R_factor_R_free                       0.2848 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2258 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.400 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3F8B 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 34.4800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4000 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.1500 
_refine_hist.d_res_low                        43.4700 
_refine_hist.number_atoms_solvent             22 
_refine_hist.number_atoms_total               1800 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       208 
_refine_hist.pdbx_B_iso_mean_ligand           121.47 
_refine_hist.pdbx_B_iso_mean_solvent          60.68 
_refine_hist.pdbx_number_atoms_protein        1712 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1018 5.355 ? 1 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1018 5.355 ? 1 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1500 2.3200  2669 . 139 2530 100.0000 . . . 0.3955 0.0000 0.3495 . . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 2.3200 2.5500  2649 . 145 2504 99.0000  . . . 0.3319 0.0000 0.2927 . . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 2.5500 2.9200  2674 . 114 2560 100.0000 . . . 0.3557 0.0000 0.2939 . . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 2.9200 3.6800  2675 . 145 2530 99.0000  . . . 0.2712 0.0000 0.2522 . . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 3.6800 43.4700 2775 . 153 2622 99.0000  . . . 0.2657 0.0000 0.1838 . . . . . . . 5 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 '(chain A and (resid 5 through 68 or resid 74 through 112))' 
1 2 '(chain B and (resid 5 through 68 or resid 74 through 112))' 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_comp_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_comp_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.selection_details 
1 1 1 A PRO 5  . A GLY 68  . A PRO 5  A GLY 68  ? '(chain A and (resid 5 through 68 or resid 74 through 112))' 
1 1 2 A GLY 74 . A SER 112 . A GLY 74 A SER 112 ? '(chain A and (resid 5 through 68 or resid 74 through 112))' 
1 2 1 B PRO 5  . B GLY 68  . B PRO 5  B GLY 68  ? '(chain B and (resid 5 through 68 or resid 74 through 112))' 
1 2 2 B GLY 74 . B SER 112 . B GLY 74 B SER 112 ? '(chain B and (resid 5 through 68 or resid 74 through 112))' 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     7QZ6 
_struct.title                        
'Transcriptional regulator LmrR with bound daunomycin and with Trp-67 and Trp-96 replaced by 5-fluoroTrp' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7QZ6 
_struct_keywords.text            
'Transcriptional regulator, PadR, Fluorinated tryptophan, Daunomycin, pi-pi interactions, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A2RI36_LACLM 
_struct_ref.pdbx_db_accession          A2RI36 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYR
LTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIK
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7QZ6 A 1 ? 116 ? A2RI36 1 ? 116 ? 1 116 
2 1 7QZ6 B 1 ? 116 ? A2RI36 1 ? 116 ? 1 116 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7QZ6 HIS A 117 ? UNP A2RI36 ? ? 'expression tag' 117 1  
1 7QZ6 HIS A 118 ? UNP A2RI36 ? ? 'expression tag' 118 2  
1 7QZ6 HIS A 119 ? UNP A2RI36 ? ? 'expression tag' 119 3  
1 7QZ6 HIS A 120 ? UNP A2RI36 ? ? 'expression tag' 120 4  
1 7QZ6 HIS A 121 ? UNP A2RI36 ? ? 'expression tag' 121 5  
1 7QZ6 HIS A 122 ? UNP A2RI36 ? ? 'expression tag' 122 6  
2 7QZ6 HIS B 117 ? UNP A2RI36 ? ? 'expression tag' 117 7  
2 7QZ6 HIS B 118 ? UNP A2RI36 ? ? 'expression tag' 118 8  
2 7QZ6 HIS B 119 ? UNP A2RI36 ? ? 'expression tag' 119 9  
2 7QZ6 HIS B 120 ? UNP A2RI36 ? ? 'expression tag' 120 10 
2 7QZ6 HIS B 121 ? UNP A2RI36 ? ? 'expression tag' 121 11 
2 7QZ6 HIS B 122 ? UNP A2RI36 ? ? 'expression tag' 122 12 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3740  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  12940 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 5  ? GLY A 24  ? PRO A 5  GLY A 24  1 ? 20 
HELX_P HELX_P2 AA2 TYR A 27 ? SER A 39  ? TYR A 27 SER A 39  1 ? 13 
HELX_P HELX_P3 AA3 ASN A 46 ? ASP A 60  ? ASN A 46 ASP A 60  1 ? 15 
HELX_P HELX_P4 AA4 THR A 82 ? SER A 112 ? THR A 82 SER A 112 1 ? 31 
HELX_P HELX_P5 AA5 LYS B 6  ? GLY B 24  ? LYS B 6  GLY B 24  1 ? 19 
HELX_P HELX_P6 AA6 TYR B 27 ? SER B 39  ? TYR B 27 SER B 39  1 ? 13 
HELX_P HELX_P7 AA7 ASN B 46 ? ASP B 60  ? ASN B 46 ASP B 60  1 ? 15 
HELX_P HELX_P8 AA8 THR B 82 ? SER B 112 ? THR B 82 SER B 112 1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A TYR 66 C ? ? ? 1_555 A FTR 67 N ? ? A TYR 66 A FTR 67 1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale2 covale both ? A FTR 67 C ? ? ? 1_555 A GLY 68 N ? ? A FTR 67 A GLY 68 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale3 covale both ? A SER 95 C ? ? ? 1_555 A FTR 96 N ? ? A SER 95 A FTR 96 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale4 covale both ? A FTR 96 C ? ? ? 1_555 A SER 97 N ? ? A FTR 96 A SER 97 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale5 covale both ? B TYR 66 C ? ? ? 1_555 B FTR 67 N ? ? B TYR 66 B FTR 67 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale6 covale both ? B FTR 67 C ? ? ? 1_555 B GLY 68 N ? ? B FTR 67 B GLY 68 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale7 covale both ? B SER 95 C ? ? ? 1_555 B FTR 96 N ? ? B SER 95 B FTR 96 1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale8 covale both ? B FTR 96 C ? ? ? 1_555 B SER 97 N ? ? B FTR 96 B SER 97 1_555 ? ? ? ? ? ? ? 1.334 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 63 ? FTR A 67 ? ILE A 63 FTR A 67 
AA1 2 LYS A 77 ? LEU A 81 ? LYS A 77 LEU A 81 
AA2 1 ILE B 63 ? GLY B 68 ? ILE B 63 GLY B 68 
AA2 2 ARG B 76 ? LEU B 81 ? ARG B 76 LEU B 81 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 66 ? N TYR A 66 O TYR A 78 ? O TYR A 78 
AA2 1 2 N TYR B 66 ? N TYR B 66 O TYR B 78 ? O TYR B 78 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 40 ? ? 36.94 46.63 
2 1 ASN B 40 ? ? 39.29 48.16 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A FTR 67 A FTR 67 ? TRP 'modified residue' 
2 A FTR 96 A FTR 96 ? TRP 'modified residue' 
3 B FTR 67 B FTR 67 ? TRP 'modified residue' 
4 B FTR 96 B FTR 96 ? TRP 'modified residue' 
# 
_phasing.method   MR 
# 
_pdbx_entry_details.entry_id                 7QZ6 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A GLU 3   ? A GLU 3   
4  1 Y 1 A ILE 4   ? A ILE 4   
5  1 Y 1 A ASP 69  ? A ASP 69  
6  1 Y 1 A GLU 70  ? A GLU 70  
7  1 Y 1 A SER 71  ? A SER 71  
8  1 Y 1 A GLN 72  ? A GLN 72  
9  1 Y 1 A GLU 113 ? A GLU 113 
10 1 Y 1 A ALA 114 ? A ALA 114 
11 1 Y 1 A ILE 115 ? A ILE 115 
12 1 Y 1 A LYS 116 ? A LYS 116 
13 1 Y 1 A HIS 117 ? A HIS 117 
14 1 Y 1 A HIS 118 ? A HIS 118 
15 1 Y 1 A HIS 119 ? A HIS 119 
16 1 Y 1 A HIS 120 ? A HIS 120 
17 1 Y 1 A HIS 121 ? A HIS 121 
18 1 Y 1 A HIS 122 ? A HIS 122 
19 1 Y 1 B MET 1   ? B MET 1   
20 1 Y 1 B ALA 2   ? B ALA 2   
21 1 Y 1 B GLU 3   ? B GLU 3   
22 1 Y 1 B ILE 4   ? B ILE 4   
23 1 Y 1 B GLU 70  ? B GLU 70  
24 1 Y 1 B SER 71  ? B SER 71  
25 1 Y 1 B GLN 72  ? B GLN 72  
26 1 Y 1 B GLY 73  ? B GLY 73  
27 1 Y 1 B GLU 113 ? B GLU 113 
28 1 Y 1 B ALA 114 ? B ALA 114 
29 1 Y 1 B ILE 115 ? B ILE 115 
30 1 Y 1 B LYS 116 ? B LYS 116 
31 1 Y 1 B HIS 117 ? B HIS 117 
32 1 Y 1 B HIS 118 ? B HIS 118 
33 1 Y 1 B HIS 119 ? B HIS 119 
34 1 Y 1 B HIS 120 ? B HIS 120 
35 1 Y 1 B HIS 121 ? B HIS 121 
36 1 Y 1 B HIS 122 ? B HIS 122 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N N N 1   
ALA CA     C N S 2   
ALA C      C N N 3   
ALA O      O N N 4   
ALA CB     C N N 5   
ALA OXT    O N N 6   
ALA H      H N N 7   
ALA H2     H N N 8   
ALA HA     H N N 9   
ALA HB1    H N N 10  
ALA HB2    H N N 11  
ALA HB3    H N N 12  
ALA HXT    H N N 13  
ARG N      N N N 14  
ARG CA     C N S 15  
ARG C      C N N 16  
ARG O      O N N 17  
ARG CB     C N N 18  
ARG CG     C N N 19  
ARG CD     C N N 20  
ARG NE     N N N 21  
ARG CZ     C N N 22  
ARG NH1    N N N 23  
ARG NH2    N N N 24  
ARG OXT    O N N 25  
ARG H      H N N 26  
ARG H2     H N N 27  
ARG HA     H N N 28  
ARG HB2    H N N 29  
ARG HB3    H N N 30  
ARG HG2    H N N 31  
ARG HG3    H N N 32  
ARG HD2    H N N 33  
ARG HD3    H N N 34  
ARG HE     H N N 35  
ARG HH11   H N N 36  
ARG HH12   H N N 37  
ARG HH21   H N N 38  
ARG HH22   H N N 39  
ARG HXT    H N N 40  
ASN N      N N N 41  
ASN CA     C N S 42  
ASN C      C N N 43  
ASN O      O N N 44  
ASN CB     C N N 45  
ASN CG     C N N 46  
ASN OD1    O N N 47  
ASN ND2    N N N 48  
ASN OXT    O N N 49  
ASN H      H N N 50  
ASN H2     H N N 51  
ASN HA     H N N 52  
ASN HB2    H N N 53  
ASN HB3    H N N 54  
ASN HD21   H N N 55  
ASN HD22   H N N 56  
ASN HXT    H N N 57  
ASP N      N N N 58  
ASP CA     C N S 59  
ASP C      C N N 60  
ASP O      O N N 61  
ASP CB     C N N 62  
ASP CG     C N N 63  
ASP OD1    O N N 64  
ASP OD2    O N N 65  
ASP OXT    O N N 66  
ASP H      H N N 67  
ASP H2     H N N 68  
ASP HA     H N N 69  
ASP HB2    H N N 70  
ASP HB3    H N N 71  
ASP HD2    H N N 72  
ASP HXT    H N N 73  
DM1 C1     C Y N 74  
DM1 C2     C Y N 75  
DM1 C3     C Y N 76  
DM1 C4     C Y N 77  
DM1 O4     O N N 78  
DM1 C5     C Y N 79  
DM1 C6     C N N 80  
DM1 O6     O N N 81  
DM1 C7     C Y N 82  
DM1 C8     C Y N 83  
DM1 O8     O N N 84  
DM1 C9     C Y N 85  
DM1 C10    C N S 86  
DM1 O10    O N N 87  
DM1 C11    C N N 88  
DM1 C12    C N S 89  
DM1 O12    O N N 90  
DM1 C13    C N N 91  
DM1 O13    O N N 92  
DM1 C14    C N N 93  
DM1 C15    C N N 94  
DM1 C16    C Y N 95  
DM1 C17    C Y N 96  
DM1 O17    O N N 97  
DM1 C18    C Y N 98  
DM1 C19    C N N 99  
DM1 O19    O N N 100 
DM1 C20    C Y N 101 
DM1 C21    C N N 102 
DM1 "C1'"  C N R 103 
DM1 "C2'"  C N N 104 
DM1 "C3'"  C N S 105 
DM1 "N3'"  N N N 106 
DM1 "C4'"  C N S 107 
DM1 "O4'"  O N N 108 
DM1 "C5'"  C N S 109 
DM1 "O5'"  O N N 110 
DM1 "C6'"  C N N 111 
DM1 H1     H N N 112 
DM1 H2     H N N 113 
DM1 H3     H N N 114 
DM1 HO8    H N N 115 
DM1 H10    H N N 116 
DM1 H111   H N N 117 
DM1 H112   H N N 118 
DM1 HO12   H N N 119 
DM1 H141   H N N 120 
DM1 H142   H N N 121 
DM1 H143   H N N 122 
DM1 H151   H N N 123 
DM1 H152   H N N 124 
DM1 HO17   H N N 125 
DM1 H211   H N N 126 
DM1 H212   H N N 127 
DM1 H213   H N N 128 
DM1 "H1'"  H N N 129 
DM1 "H2'1" H N N 130 
DM1 "H2'2" H N N 131 
DM1 "H3'"  H N N 132 
DM1 "HN'1" H N N 133 
DM1 "HN'2" H N N 134 
DM1 "H4'"  H N N 135 
DM1 "HO4'" H N N 136 
DM1 "H5'"  H N N 137 
DM1 "H6'1" H N N 138 
DM1 "H6'2" H N N 139 
DM1 "H6'3" H N N 140 
FTR N      N N N 141 
FTR CA     C N S 142 
FTR CB     C N N 143 
FTR CG     C Y N 144 
FTR CD2    C Y N 145 
FTR CE2    C Y N 146 
FTR CE3    C Y N 147 
FTR CD1    C Y N 148 
FTR NE1    N Y N 149 
FTR CZ2    C Y N 150 
FTR CZ3    C Y N 151 
FTR F      F N N 152 
FTR CH2    C Y N 153 
FTR C      C N N 154 
FTR O      O N N 155 
FTR OXT    O N N 156 
FTR H      H N N 157 
FTR H2     H N N 158 
FTR HA     H N N 159 
FTR HB2    H N N 160 
FTR HB3    H N N 161 
FTR HE3    H N N 162 
FTR HD1    H N N 163 
FTR HE1    H N N 164 
FTR HZ2    H N N 165 
FTR HH2    H N N 166 
FTR HXT    H N N 167 
GLN N      N N N 168 
GLN CA     C N S 169 
GLN C      C N N 170 
GLN O      O N N 171 
GLN CB     C N N 172 
GLN CG     C N N 173 
GLN CD     C N N 174 
GLN OE1    O N N 175 
GLN NE2    N N N 176 
GLN OXT    O N N 177 
GLN H      H N N 178 
GLN H2     H N N 179 
GLN HA     H N N 180 
GLN HB2    H N N 181 
GLN HB3    H N N 182 
GLN HG2    H N N 183 
GLN HG3    H N N 184 
GLN HE21   H N N 185 
GLN HE22   H N N 186 
GLN HXT    H N N 187 
GLU N      N N N 188 
GLU CA     C N S 189 
GLU C      C N N 190 
GLU O      O N N 191 
GLU CB     C N N 192 
GLU CG     C N N 193 
GLU CD     C N N 194 
GLU OE1    O N N 195 
GLU OE2    O N N 196 
GLU OXT    O N N 197 
GLU H      H N N 198 
GLU H2     H N N 199 
GLU HA     H N N 200 
GLU HB2    H N N 201 
GLU HB3    H N N 202 
GLU HG2    H N N 203 
GLU HG3    H N N 204 
GLU HE2    H N N 205 
GLU HXT    H N N 206 
GLY N      N N N 207 
GLY CA     C N N 208 
GLY C      C N N 209 
GLY O      O N N 210 
GLY OXT    O N N 211 
GLY H      H N N 212 
GLY H2     H N N 213 
GLY HA2    H N N 214 
GLY HA3    H N N 215 
GLY HXT    H N N 216 
HIS N      N N N 217 
HIS CA     C N S 218 
HIS C      C N N 219 
HIS O      O N N 220 
HIS CB     C N N 221 
HIS CG     C Y N 222 
HIS ND1    N Y N 223 
HIS CD2    C Y N 224 
HIS CE1    C Y N 225 
HIS NE2    N Y N 226 
HIS OXT    O N N 227 
HIS H      H N N 228 
HIS H2     H N N 229 
HIS HA     H N N 230 
HIS HB2    H N N 231 
HIS HB3    H N N 232 
HIS HD1    H N N 233 
HIS HD2    H N N 234 
HIS HE1    H N N 235 
HIS HE2    H N N 236 
HIS HXT    H N N 237 
HOH O      O N N 238 
HOH H1     H N N 239 
HOH H2     H N N 240 
ILE N      N N N 241 
ILE CA     C N S 242 
ILE C      C N N 243 
ILE O      O N N 244 
ILE CB     C N S 245 
ILE CG1    C N N 246 
ILE CG2    C N N 247 
ILE CD1    C N N 248 
ILE OXT    O N N 249 
ILE H      H N N 250 
ILE H2     H N N 251 
ILE HA     H N N 252 
ILE HB     H N N 253 
ILE HG12   H N N 254 
ILE HG13   H N N 255 
ILE HG21   H N N 256 
ILE HG22   H N N 257 
ILE HG23   H N N 258 
ILE HD11   H N N 259 
ILE HD12   H N N 260 
ILE HD13   H N N 261 
ILE HXT    H N N 262 
LEU N      N N N 263 
LEU CA     C N S 264 
LEU C      C N N 265 
LEU O      O N N 266 
LEU CB     C N N 267 
LEU CG     C N N 268 
LEU CD1    C N N 269 
LEU CD2    C N N 270 
LEU OXT    O N N 271 
LEU H      H N N 272 
LEU H2     H N N 273 
LEU HA     H N N 274 
LEU HB2    H N N 275 
LEU HB3    H N N 276 
LEU HG     H N N 277 
LEU HD11   H N N 278 
LEU HD12   H N N 279 
LEU HD13   H N N 280 
LEU HD21   H N N 281 
LEU HD22   H N N 282 
LEU HD23   H N N 283 
LEU HXT    H N N 284 
LYS N      N N N 285 
LYS CA     C N S 286 
LYS C      C N N 287 
LYS O      O N N 288 
LYS CB     C N N 289 
LYS CG     C N N 290 
LYS CD     C N N 291 
LYS CE     C N N 292 
LYS NZ     N N N 293 
LYS OXT    O N N 294 
LYS H      H N N 295 
LYS H2     H N N 296 
LYS HA     H N N 297 
LYS HB2    H N N 298 
LYS HB3    H N N 299 
LYS HG2    H N N 300 
LYS HG3    H N N 301 
LYS HD2    H N N 302 
LYS HD3    H N N 303 
LYS HE2    H N N 304 
LYS HE3    H N N 305 
LYS HZ1    H N N 306 
LYS HZ2    H N N 307 
LYS HZ3    H N N 308 
LYS HXT    H N N 309 
MET N      N N N 310 
MET CA     C N S 311 
MET C      C N N 312 
MET O      O N N 313 
MET CB     C N N 314 
MET CG     C N N 315 
MET SD     S N N 316 
MET CE     C N N 317 
MET OXT    O N N 318 
MET H      H N N 319 
MET H2     H N N 320 
MET HA     H N N 321 
MET HB2    H N N 322 
MET HB3    H N N 323 
MET HG2    H N N 324 
MET HG3    H N N 325 
MET HE1    H N N 326 
MET HE2    H N N 327 
MET HE3    H N N 328 
MET HXT    H N N 329 
PHE N      N N N 330 
PHE CA     C N S 331 
PHE C      C N N 332 
PHE O      O N N 333 
PHE CB     C N N 334 
PHE CG     C Y N 335 
PHE CD1    C Y N 336 
PHE CD2    C Y N 337 
PHE CE1    C Y N 338 
PHE CE2    C Y N 339 
PHE CZ     C Y N 340 
PHE OXT    O N N 341 
PHE H      H N N 342 
PHE H2     H N N 343 
PHE HA     H N N 344 
PHE HB2    H N N 345 
PHE HB3    H N N 346 
PHE HD1    H N N 347 
PHE HD2    H N N 348 
PHE HE1    H N N 349 
PHE HE2    H N N 350 
PHE HZ     H N N 351 
PHE HXT    H N N 352 
PRO N      N N N 353 
PRO CA     C N S 354 
PRO C      C N N 355 
PRO O      O N N 356 
PRO CB     C N N 357 
PRO CG     C N N 358 
PRO CD     C N N 359 
PRO OXT    O N N 360 
PRO H      H N N 361 
PRO HA     H N N 362 
PRO HB2    H N N 363 
PRO HB3    H N N 364 
PRO HG2    H N N 365 
PRO HG3    H N N 366 
PRO HD2    H N N 367 
PRO HD3    H N N 368 
PRO HXT    H N N 369 
SER N      N N N 370 
SER CA     C N S 371 
SER C      C N N 372 
SER O      O N N 373 
SER CB     C N N 374 
SER OG     O N N 375 
SER OXT    O N N 376 
SER H      H N N 377 
SER H2     H N N 378 
SER HA     H N N 379 
SER HB2    H N N 380 
SER HB3    H N N 381 
SER HG     H N N 382 
SER HXT    H N N 383 
THR N      N N N 384 
THR CA     C N S 385 
THR C      C N N 386 
THR O      O N N 387 
THR CB     C N R 388 
THR OG1    O N N 389 
THR CG2    C N N 390 
THR OXT    O N N 391 
THR H      H N N 392 
THR H2     H N N 393 
THR HA     H N N 394 
THR HB     H N N 395 
THR HG1    H N N 396 
THR HG21   H N N 397 
THR HG22   H N N 398 
THR HG23   H N N 399 
THR HXT    H N N 400 
TYR N      N N N 401 
TYR CA     C N S 402 
TYR C      C N N 403 
TYR O      O N N 404 
TYR CB     C N N 405 
TYR CG     C Y N 406 
TYR CD1    C Y N 407 
TYR CD2    C Y N 408 
TYR CE1    C Y N 409 
TYR CE2    C Y N 410 
TYR CZ     C Y N 411 
TYR OH     O N N 412 
TYR OXT    O N N 413 
TYR H      H N N 414 
TYR H2     H N N 415 
TYR HA     H N N 416 
TYR HB2    H N N 417 
TYR HB3    H N N 418 
TYR HD1    H N N 419 
TYR HD2    H N N 420 
TYR HE1    H N N 421 
TYR HE2    H N N 422 
TYR HH     H N N 423 
TYR HXT    H N N 424 
VAL N      N N N 425 
VAL CA     C N S 426 
VAL C      C N N 427 
VAL O      O N N 428 
VAL CB     C N N 429 
VAL CG1    C N N 430 
VAL CG2    C N N 431 
VAL OXT    O N N 432 
VAL H      H N N 433 
VAL H2     H N N 434 
VAL HA     H N N 435 
VAL HB     H N N 436 
VAL HG11   H N N 437 
VAL HG12   H N N 438 
VAL HG13   H N N 439 
VAL HG21   H N N 440 
VAL HG22   H N N 441 
VAL HG23   H N N 442 
VAL HXT    H N N 443 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
DM1 C1    C2     doub Y N 70  
DM1 C1    C20    sing Y N 71  
DM1 C1    H1     sing N N 72  
DM1 C2    C3     sing Y N 73  
DM1 C2    H2     sing N N 74  
DM1 C3    C4     doub Y N 75  
DM1 C3    H3     sing N N 76  
DM1 C4    O4     sing N N 77  
DM1 C4    C5     sing Y N 78  
DM1 O4    C21    sing N N 79  
DM1 C5    C6     sing N N 80  
DM1 C5    C20    doub Y N 81  
DM1 C6    O6     doub N N 82  
DM1 C6    C7     sing N N 83  
DM1 C7    C8     doub Y N 84  
DM1 C7    C18    sing Y N 85  
DM1 C8    O8     sing N N 86  
DM1 C8    C9     sing Y N 87  
DM1 O8    HO8    sing N N 88  
DM1 C9    C10    sing N N 89  
DM1 C9    C16    doub Y N 90  
DM1 C10   O10    sing N N 91  
DM1 C10   C11    sing N N 92  
DM1 C10   H10    sing N N 93  
DM1 O10   "C1'"  sing N N 94  
DM1 C11   C12    sing N N 95  
DM1 C11   H111   sing N N 96  
DM1 C11   H112   sing N N 97  
DM1 C12   O12    sing N N 98  
DM1 C12   C13    sing N N 99  
DM1 C12   C15    sing N N 100 
DM1 O12   HO12   sing N N 101 
DM1 C13   O13    doub N N 102 
DM1 C13   C14    sing N N 103 
DM1 C14   H141   sing N N 104 
DM1 C14   H142   sing N N 105 
DM1 C14   H143   sing N N 106 
DM1 C15   C16    sing N N 107 
DM1 C15   H151   sing N N 108 
DM1 C15   H152   sing N N 109 
DM1 C16   C17    sing Y N 110 
DM1 C17   O17    sing N N 111 
DM1 C17   C18    doub Y N 112 
DM1 O17   HO17   sing N N 113 
DM1 C18   C19    sing N N 114 
DM1 C19   O19    doub N N 115 
DM1 C19   C20    sing N N 116 
DM1 C21   H211   sing N N 117 
DM1 C21   H212   sing N N 118 
DM1 C21   H213   sing N N 119 
DM1 "C1'" "C2'"  sing N N 120 
DM1 "C1'" "O5'"  sing N N 121 
DM1 "C1'" "H1'"  sing N N 122 
DM1 "C2'" "C3'"  sing N N 123 
DM1 "C2'" "H2'1" sing N N 124 
DM1 "C2'" "H2'2" sing N N 125 
DM1 "C3'" "N3'"  sing N N 126 
DM1 "C3'" "C4'"  sing N N 127 
DM1 "C3'" "H3'"  sing N N 128 
DM1 "N3'" "HN'1" sing N N 129 
DM1 "N3'" "HN'2" sing N N 130 
DM1 "C4'" "O4'"  sing N N 131 
DM1 "C4'" "C5'"  sing N N 132 
DM1 "C4'" "H4'"  sing N N 133 
DM1 "O4'" "HO4'" sing N N 134 
DM1 "C5'" "O5'"  sing N N 135 
DM1 "C5'" "C6'"  sing N N 136 
DM1 "C5'" "H5'"  sing N N 137 
DM1 "C6'" "H6'1" sing N N 138 
DM1 "C6'" "H6'2" sing N N 139 
DM1 "C6'" "H6'3" sing N N 140 
FTR N     CA     sing N N 141 
FTR N     H      sing N N 142 
FTR N     H2     sing N N 143 
FTR CA    CB     sing N N 144 
FTR CA    C      sing N N 145 
FTR CA    HA     sing N N 146 
FTR CB    CG     sing N N 147 
FTR CB    HB2    sing N N 148 
FTR CB    HB3    sing N N 149 
FTR CG    CD2    sing Y N 150 
FTR CG    CD1    doub Y N 151 
FTR CD2   CE2    doub Y N 152 
FTR CD2   CE3    sing Y N 153 
FTR CE2   NE1    sing Y N 154 
FTR CE2   CZ2    sing Y N 155 
FTR CE3   CZ3    doub Y N 156 
FTR CE3   HE3    sing N N 157 
FTR CD1   NE1    sing Y N 158 
FTR CD1   HD1    sing N N 159 
FTR NE1   HE1    sing N N 160 
FTR CZ2   CH2    doub Y N 161 
FTR CZ2   HZ2    sing N N 162 
FTR CZ3   F      sing N N 163 
FTR CZ3   CH2    sing Y N 164 
FTR CH2   HH2    sing N N 165 
FTR C     O      doub N N 166 
FTR C     OXT    sing N N 167 
FTR OXT   HXT    sing N N 168 
GLN N     CA     sing N N 169 
GLN N     H      sing N N 170 
GLN N     H2     sing N N 171 
GLN CA    C      sing N N 172 
GLN CA    CB     sing N N 173 
GLN CA    HA     sing N N 174 
GLN C     O      doub N N 175 
GLN C     OXT    sing N N 176 
GLN CB    CG     sing N N 177 
GLN CB    HB2    sing N N 178 
GLN CB    HB3    sing N N 179 
GLN CG    CD     sing N N 180 
GLN CG    HG2    sing N N 181 
GLN CG    HG3    sing N N 182 
GLN CD    OE1    doub N N 183 
GLN CD    NE2    sing N N 184 
GLN NE2   HE21   sing N N 185 
GLN NE2   HE22   sing N N 186 
GLN OXT   HXT    sing N N 187 
GLU N     CA     sing N N 188 
GLU N     H      sing N N 189 
GLU N     H2     sing N N 190 
GLU CA    C      sing N N 191 
GLU CA    CB     sing N N 192 
GLU CA    HA     sing N N 193 
GLU C     O      doub N N 194 
GLU C     OXT    sing N N 195 
GLU CB    CG     sing N N 196 
GLU CB    HB2    sing N N 197 
GLU CB    HB3    sing N N 198 
GLU CG    CD     sing N N 199 
GLU CG    HG2    sing N N 200 
GLU CG    HG3    sing N N 201 
GLU CD    OE1    doub N N 202 
GLU CD    OE2    sing N N 203 
GLU OE2   HE2    sing N N 204 
GLU OXT   HXT    sing N N 205 
GLY N     CA     sing N N 206 
GLY N     H      sing N N 207 
GLY N     H2     sing N N 208 
GLY CA    C      sing N N 209 
GLY CA    HA2    sing N N 210 
GLY CA    HA3    sing N N 211 
GLY C     O      doub N N 212 
GLY C     OXT    sing N N 213 
GLY OXT   HXT    sing N N 214 
HIS N     CA     sing N N 215 
HIS N     H      sing N N 216 
HIS N     H2     sing N N 217 
HIS CA    C      sing N N 218 
HIS CA    CB     sing N N 219 
HIS CA    HA     sing N N 220 
HIS C     O      doub N N 221 
HIS C     OXT    sing N N 222 
HIS CB    CG     sing N N 223 
HIS CB    HB2    sing N N 224 
HIS CB    HB3    sing N N 225 
HIS CG    ND1    sing Y N 226 
HIS CG    CD2    doub Y N 227 
HIS ND1   CE1    doub Y N 228 
HIS ND1   HD1    sing N N 229 
HIS CD2   NE2    sing Y N 230 
HIS CD2   HD2    sing N N 231 
HIS CE1   NE2    sing Y N 232 
HIS CE1   HE1    sing N N 233 
HIS NE2   HE2    sing N N 234 
HIS OXT   HXT    sing N N 235 
HOH O     H1     sing N N 236 
HOH O     H2     sing N N 237 
ILE N     CA     sing N N 238 
ILE N     H      sing N N 239 
ILE N     H2     sing N N 240 
ILE CA    C      sing N N 241 
ILE CA    CB     sing N N 242 
ILE CA    HA     sing N N 243 
ILE C     O      doub N N 244 
ILE C     OXT    sing N N 245 
ILE CB    CG1    sing N N 246 
ILE CB    CG2    sing N N 247 
ILE CB    HB     sing N N 248 
ILE CG1   CD1    sing N N 249 
ILE CG1   HG12   sing N N 250 
ILE CG1   HG13   sing N N 251 
ILE CG2   HG21   sing N N 252 
ILE CG2   HG22   sing N N 253 
ILE CG2   HG23   sing N N 254 
ILE CD1   HD11   sing N N 255 
ILE CD1   HD12   sing N N 256 
ILE CD1   HD13   sing N N 257 
ILE OXT   HXT    sing N N 258 
LEU N     CA     sing N N 259 
LEU N     H      sing N N 260 
LEU N     H2     sing N N 261 
LEU CA    C      sing N N 262 
LEU CA    CB     sing N N 263 
LEU CA    HA     sing N N 264 
LEU C     O      doub N N 265 
LEU C     OXT    sing N N 266 
LEU CB    CG     sing N N 267 
LEU CB    HB2    sing N N 268 
LEU CB    HB3    sing N N 269 
LEU CG    CD1    sing N N 270 
LEU CG    CD2    sing N N 271 
LEU CG    HG     sing N N 272 
LEU CD1   HD11   sing N N 273 
LEU CD1   HD12   sing N N 274 
LEU CD1   HD13   sing N N 275 
LEU CD2   HD21   sing N N 276 
LEU CD2   HD22   sing N N 277 
LEU CD2   HD23   sing N N 278 
LEU OXT   HXT    sing N N 279 
LYS N     CA     sing N N 280 
LYS N     H      sing N N 281 
LYS N     H2     sing N N 282 
LYS CA    C      sing N N 283 
LYS CA    CB     sing N N 284 
LYS CA    HA     sing N N 285 
LYS C     O      doub N N 286 
LYS C     OXT    sing N N 287 
LYS CB    CG     sing N N 288 
LYS CB    HB2    sing N N 289 
LYS CB    HB3    sing N N 290 
LYS CG    CD     sing N N 291 
LYS CG    HG2    sing N N 292 
LYS CG    HG3    sing N N 293 
LYS CD    CE     sing N N 294 
LYS CD    HD2    sing N N 295 
LYS CD    HD3    sing N N 296 
LYS CE    NZ     sing N N 297 
LYS CE    HE2    sing N N 298 
LYS CE    HE3    sing N N 299 
LYS NZ    HZ1    sing N N 300 
LYS NZ    HZ2    sing N N 301 
LYS NZ    HZ3    sing N N 302 
LYS OXT   HXT    sing N N 303 
MET N     CA     sing N N 304 
MET N     H      sing N N 305 
MET N     H2     sing N N 306 
MET CA    C      sing N N 307 
MET CA    CB     sing N N 308 
MET CA    HA     sing N N 309 
MET C     O      doub N N 310 
MET C     OXT    sing N N 311 
MET CB    CG     sing N N 312 
MET CB    HB2    sing N N 313 
MET CB    HB3    sing N N 314 
MET CG    SD     sing N N 315 
MET CG    HG2    sing N N 316 
MET CG    HG3    sing N N 317 
MET SD    CE     sing N N 318 
MET CE    HE1    sing N N 319 
MET CE    HE2    sing N N 320 
MET CE    HE3    sing N N 321 
MET OXT   HXT    sing N N 322 
PHE N     CA     sing N N 323 
PHE N     H      sing N N 324 
PHE N     H2     sing N N 325 
PHE CA    C      sing N N 326 
PHE CA    CB     sing N N 327 
PHE CA    HA     sing N N 328 
PHE C     O      doub N N 329 
PHE C     OXT    sing N N 330 
PHE CB    CG     sing N N 331 
PHE CB    HB2    sing N N 332 
PHE CB    HB3    sing N N 333 
PHE CG    CD1    doub Y N 334 
PHE CG    CD2    sing Y N 335 
PHE CD1   CE1    sing Y N 336 
PHE CD1   HD1    sing N N 337 
PHE CD2   CE2    doub Y N 338 
PHE CD2   HD2    sing N N 339 
PHE CE1   CZ     doub Y N 340 
PHE CE1   HE1    sing N N 341 
PHE CE2   CZ     sing Y N 342 
PHE CE2   HE2    sing N N 343 
PHE CZ    HZ     sing N N 344 
PHE OXT   HXT    sing N N 345 
PRO N     CA     sing N N 346 
PRO N     CD     sing N N 347 
PRO N     H      sing N N 348 
PRO CA    C      sing N N 349 
PRO CA    CB     sing N N 350 
PRO CA    HA     sing N N 351 
PRO C     O      doub N N 352 
PRO C     OXT    sing N N 353 
PRO CB    CG     sing N N 354 
PRO CB    HB2    sing N N 355 
PRO CB    HB3    sing N N 356 
PRO CG    CD     sing N N 357 
PRO CG    HG2    sing N N 358 
PRO CG    HG3    sing N N 359 
PRO CD    HD2    sing N N 360 
PRO CD    HD3    sing N N 361 
PRO OXT   HXT    sing N N 362 
SER N     CA     sing N N 363 
SER N     H      sing N N 364 
SER N     H2     sing N N 365 
SER CA    C      sing N N 366 
SER CA    CB     sing N N 367 
SER CA    HA     sing N N 368 
SER C     O      doub N N 369 
SER C     OXT    sing N N 370 
SER CB    OG     sing N N 371 
SER CB    HB2    sing N N 372 
SER CB    HB3    sing N N 373 
SER OG    HG     sing N N 374 
SER OXT   HXT    sing N N 375 
THR N     CA     sing N N 376 
THR N     H      sing N N 377 
THR N     H2     sing N N 378 
THR CA    C      sing N N 379 
THR CA    CB     sing N N 380 
THR CA    HA     sing N N 381 
THR C     O      doub N N 382 
THR C     OXT    sing N N 383 
THR CB    OG1    sing N N 384 
THR CB    CG2    sing N N 385 
THR CB    HB     sing N N 386 
THR OG1   HG1    sing N N 387 
THR CG2   HG21   sing N N 388 
THR CG2   HG22   sing N N 389 
THR CG2   HG23   sing N N 390 
THR OXT   HXT    sing N N 391 
TYR N     CA     sing N N 392 
TYR N     H      sing N N 393 
TYR N     H2     sing N N 394 
TYR CA    C      sing N N 395 
TYR CA    CB     sing N N 396 
TYR CA    HA     sing N N 397 
TYR C     O      doub N N 398 
TYR C     OXT    sing N N 399 
TYR CB    CG     sing N N 400 
TYR CB    HB2    sing N N 401 
TYR CB    HB3    sing N N 402 
TYR CG    CD1    doub Y N 403 
TYR CG    CD2    sing Y N 404 
TYR CD1   CE1    sing Y N 405 
TYR CD1   HD1    sing N N 406 
TYR CD2   CE2    doub Y N 407 
TYR CD2   HD2    sing N N 408 
TYR CE1   CZ     doub Y N 409 
TYR CE1   HE1    sing N N 410 
TYR CE2   CZ     sing Y N 411 
TYR CE2   HE2    sing N N 412 
TYR CZ    OH     sing N N 413 
TYR OH    HH     sing N N 414 
TYR OXT   HXT    sing N N 415 
VAL N     CA     sing N N 416 
VAL N     H      sing N N 417 
VAL N     H2     sing N N 418 
VAL CA    C      sing N N 419 
VAL CA    CB     sing N N 420 
VAL CA    HA     sing N N 421 
VAL C     O      doub N N 422 
VAL C     OXT    sing N N 423 
VAL CB    CG1    sing N N 424 
VAL CB    CG2    sing N N 425 
VAL CB    HB     sing N N 426 
VAL CG1   HG11   sing N N 427 
VAL CG1   HG12   sing N N 428 
VAL CG1   HG13   sing N N 429 
VAL CG2   HG21   sing N N 430 
VAL CG2   HG22   sing N N 431 
VAL CG2   HG23   sing N N 432 
VAL OXT   HXT    sing N N 433 
# 
_pdbx_audit_support.funding_organization   'Not funded' 
_pdbx_audit_support.country                ? 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 DM1 ? ? DM1 ? ? 'SUBJECT OF INVESTIGATION' ? 
2 FTR ? ? FTR ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   3F8B 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    7QZ6 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.009694 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001244 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028263 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014873 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
F 
H 
N 
O 
S 
# 
loop_