data_7RTZ # _entry.id 7RTZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7RTZ pdb_00007rtz 10.2210/pdb7rtz/pdb WWPDB D_1000258985 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7RTZ _pdbx_database_status.recvd_initial_deposition_date 2021-08-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Samdin, T.D.' 1 0000-0003-3516-9175 'Kreutzer, A.G.' 2 0000-0002-9724-6298 'Nowick, J.S.' 3 0000-0002-2273-1029 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6539 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'A beta-Barrel-Like Tetramer Formed by a beta-Hairpin Derived From A beta' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/D3SC05185D _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Samdin, T.D.' 1 ? primary 'Jones, C.R.' 2 ? primary 'Guaglianone, G.' 3 ? primary 'Kreutzer, A.G.' 4 ? primary 'Freites, J.A.' 5 ? primary 'Wierzbicki, M.' 6 ? primary 'Nowick, J.S.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7RTZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.327 _cell.length_a_esd ? _cell.length_b 44.327 _cell.length_b_esd ? _cell.length_c 64.427 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7RTZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Amyloid-beta protein 40' 2631.293 2 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Abeta40,Beta-APP40 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ORN)VHHCKLVFFAE(ORN)AII(SAR)LMVCGVV' _entity_poly.pdbx_seq_one_letter_code_can AVHHCKLVFFAEAAIIGLMVCGVV _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ORN n 1 2 VAL n 1 3 HIS n 1 4 HIS n 1 5 CYS n 1 6 LYS n 1 7 LEU n 1 8 VAL n 1 9 PHE n 1 10 PHE n 1 11 ALA n 1 12 GLU n 1 13 ORN n 1 14 ALA n 1 15 ILE n 1 16 ILE n 1 17 SAR n 1 18 LEU n 1 19 MET n 1 20 VAL n 1 21 CYS n 1 22 GLY n 1 23 VAL n 1 24 VAL n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 24 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4_HUMAN _struct_ref.pdbx_db_accession P05067 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _struct_ref.pdbx_align_begin 682 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7RTZ A 1 ? 24 ? P05067 682 ? 711 ? 1 24 2 1 7RTZ B 1 ? 24 ? P05067 682 ? 711 ? 1 24 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7RTZ ORN A 1 ? UNP P05067 GLU 682 conflict 1 1 1 7RTZ CYS A 5 ? UNP P05067 GLN 686 conflict 5 2 1 7RTZ ? A ? ? UNP P05067 ASP 694 deletion ? 3 1 7RTZ ? A ? ? UNP P05067 VAL 695 deletion ? 4 1 7RTZ ? A ? ? UNP P05067 GLY 696 deletion ? 5 1 7RTZ ? A ? ? UNP P05067 SER 697 deletion ? 6 1 7RTZ ? A ? ? UNP P05067 ASN 698 deletion ? 7 1 7RTZ ? A ? ? UNP P05067 LYS 699 deletion ? 8 1 7RTZ ORN A 13 ? UNP P05067 GLY 700 conflict 13 9 1 7RTZ CYS A 21 ? UNP P05067 GLY 708 conflict 21 10 2 7RTZ ORN B 1 ? UNP P05067 GLU 682 conflict 1 11 2 7RTZ CYS B 5 ? UNP P05067 GLN 686 conflict 5 12 2 7RTZ ? B ? ? UNP P05067 ASP 694 deletion ? 13 2 7RTZ ? B ? ? UNP P05067 VAL 695 deletion ? 14 2 7RTZ ? B ? ? UNP P05067 GLY 696 deletion ? 15 2 7RTZ ? B ? ? UNP P05067 SER 697 deletion ? 16 2 7RTZ ? B ? ? UNP P05067 ASN 698 deletion ? 17 2 7RTZ ? B ? ? UNP P05067 LYS 699 deletion ? 18 2 7RTZ ORN B 13 ? UNP P05067 GLY 700 conflict 13 19 2 7RTZ CYS B 21 ? UNP P05067 GLY 708 conflict 21 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 ORN 'L-peptide linking' n L-ornithine ? 'C5 H12 N2 O2' 132.161 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SAR 'peptide linking' n SARCOSINE ? 'C3 H7 N O2' 89.093 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7RTZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M magnesium acetate tetrahydrate, 0.1 M sodium cacodylate trihydrate pH 6.5, and 30% (v/v) 2-methyl-2,4-pentanediol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 123 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7RTZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 36.52 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7150 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.83 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 48.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.83 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.175 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 393 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.795 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 117.860 _refine.B_iso_mean 60.8087 _refine.B_iso_min 27.450 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7RTZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 36.5200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7150 _refine.ls_number_reflns_R_free 718 _refine.ls_number_reflns_R_work 6432 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8300 _refine.ls_percent_reflns_R_free 10.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2661 _refine.ls_R_factor_R_free 0.2934 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2632 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6WXM _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 41.1200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 36.5200 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 376 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 48 _refine_hist.pdbx_B_iso_mean_ligand 80.92 _refine_hist.pdbx_B_iso_mean_solvent 55.98 _refine_hist.pdbx_number_atoms_protein 364 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1000 2.2600 1426 . 141 1285 100.0000 . . . 0.3258 0.0000 0.3250 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.2600 2.4900 1436 . 145 1291 100.0000 . . . 0.3390 0.0000 0.2997 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.4900 2.8500 1424 . 143 1281 100.0000 . . . 0.3251 0.0000 0.3211 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.8500 3.5900 1434 . 145 1289 100.0000 . . . 0.2504 0.0000 0.2636 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.5900 36.5200 1430 . 144 1286 100.0000 . . . 0.2916 0.0000 0.2371 . . . . . . . 5 . . . # _struct.entry_id 7RTZ _struct.title 'X-ray crystallographic structure of a beta-hairpin peptide derived from amyloid beta 14-40' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7RTZ _struct_keywords.text 'amyloid, oligomer, hairpin, barrel, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 5 A CYS 21 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf2 disulf ? ? B CYS 5 SG ? ? ? 1_555 B CYS 21 SG ? ? B CYS 5 B CYS 21 1_555 ? ? ? ? ? ? ? 2.035 ? ? covale1 covale both ? A ORN 1 C ? ? ? 1_555 A VAL 2 N ? ? A ORN 1 A VAL 2 1_555 ? ? ? ? ? ? ? 1.374 ? ? covale2 covale both ? A ORN 1 NE ? ? ? 1_555 A VAL 24 C ? ? A ORN 1 A VAL 24 1_555 ? ? ? ? ? ? ? 1.378 ? ? covale3 covale both ? A GLU 12 C ? ? ? 1_555 A ORN 13 NE ? ? A GLU 12 A ORN 13 1_555 ? ? ? ? ? ? ? 1.378 ? ? covale4 covale both ? A ORN 13 C ? ? ? 1_555 A ALA 14 N ? ? A ORN 13 A ALA 14 1_555 ? ? ? ? ? ? ? 1.372 ? ? covale5 covale both ? A ILE 16 C ? ? ? 1_555 A SAR 17 N ? ? A ILE 16 A SAR 17 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale6 covale both ? A SAR 17 C ? ? ? 1_555 A LEU 18 N ? ? A SAR 17 A LEU 18 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale7 covale both ? B ORN 1 C ? ? ? 1_555 B VAL 2 N ? ? B ORN 1 B VAL 2 1_555 ? ? ? ? ? ? ? 1.381 ? ? covale8 covale both ? B ORN 1 NE ? ? ? 1_555 B VAL 24 C ? ? B ORN 1 B VAL 24 1_555 ? ? ? ? ? ? ? 1.376 ? ? covale9 covale both ? B GLU 12 C ? ? ? 1_555 B ORN 13 NE ? ? B GLU 12 B ORN 13 1_555 ? ? ? ? ? ? ? 1.380 ? ? covale10 covale both ? B ORN 13 C ? ? ? 1_555 B ALA 14 N ? ? B ORN 13 B ALA 14 1_555 ? ? ? ? ? ? ? 1.369 ? ? covale11 covale both ? B ILE 16 C ? ? ? 1_555 B SAR 17 N ? ? B ILE 16 B SAR 17 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale12 covale both ? B SAR 17 C ? ? ? 1_555 B LEU 18 N ? ? B SAR 17 B LEU 18 1_555 ? ? ? ? ? ? ? 1.332 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 2 ? ALA A 11 ? VAL A 2 ALA A 11 AA1 2 ILE A 15 ? VAL A 24 ? ILE A 15 VAL A 24 AA1 3 ILE B 15 ? VAL B 24 ? ILE B 15 VAL B 24 AA1 4 VAL B 2 ? ALA B 11 ? VAL B 2 ALA B 11 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 4 ? N HIS A 4 O GLY A 22 ? O GLY A 22 AA1 2 3 N CYS A 21 ? N CYS A 21 O MET B 19 ? O MET B 19 AA1 3 4 O ILE B 16 ? O ILE B 16 N PHE B 10 ? N PHE B 10 # _atom_sites.entry_id 7RTZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022560 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022560 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015522 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ORN 1 1 1 ORN ORN A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ORN 13 13 13 ORN ORN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SAR 17 17 17 SAR SAR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n B 1 1 ORN 1 1 1 ORN ORN B . n B 1 2 VAL 2 2 2 VAL VAL B . n B 1 3 HIS 3 3 3 HIS HIS B . n B 1 4 HIS 4 4 4 HIS HIS B . n B 1 5 CYS 5 5 5 CYS CYS B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 PHE 9 9 9 PHE PHE B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 ORN 13 13 13 ORN ORN B . n B 1 14 ALA 14 14 14 ALA ALA B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 ILE 16 16 16 ILE ILE B . n B 1 17 SAR 17 17 17 SAR SAR B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 MET 19 19 19 MET MET B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 CYS 21 21 21 CYS CYS B . n B 1 22 GLY 22 22 22 GLY GLY B . n B 1 23 VAL 23 23 23 VAL VAL B . n B 1 24 VAL 24 24 24 VAL VAL B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CL 1 101 1 CL CL A . D 3 HOH 1 201 1 HOH HOH A . D 3 HOH 2 202 6 HOH HOH A . D 3 HOH 3 203 8 HOH HOH A . D 3 HOH 4 204 10 HOH HOH A . D 3 HOH 5 205 7 HOH HOH A . E 3 HOH 1 101 2 HOH HOH B . E 3 HOH 2 102 4 HOH HOH B . E 3 HOH 3 103 3 HOH HOH B . E 3 HOH 4 104 5 HOH HOH B . E 3 HOH 5 105 11 HOH HOH B . E 3 HOH 6 106 9 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A SAR 17 A SAR 17 ? GLY 'modified residue' 2 B SAR 17 B SAR 17 ? GLY 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 640 ? 1 MORE -13 ? 1 'SSA (A^2)' 4250 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-31 2 'Structure model' 1 1 2023-10-18 3 'Structure model' 1 2 2023-12-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' citation 5 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_abbrev' 3 3 'Structure model' '_citation.journal_id_CSD' 4 3 'Structure model' '_citation.journal_id_ISSN' 5 3 'Structure model' '_citation.pdbx_database_id_DOI' 6 3 'Structure model' '_citation.title' 7 3 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19_4092 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7RTZ _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B HOH 104 ? ? O B HOH 106 ? ? 2.04 2 1 O B HOH 103 ? ? O B HOH 104 ? ? 2.08 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 H _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ORN _pdbx_validate_symm_contact.auth_seq_id_1 13 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 VAL _pdbx_validate_symm_contact.auth_seq_id_2 23 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_556 _pdbx_validate_symm_contact.dist 1.52 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CL CL CL N N 47 CYS N N N N 48 CYS CA C N R 49 CYS C C N N 50 CYS O O N N 51 CYS CB C N N 52 CYS SG S N N 53 CYS OXT O N N 54 CYS H H N N 55 CYS H2 H N N 56 CYS HA H N N 57 CYS HB2 H N N 58 CYS HB3 H N N 59 CYS HG H N N 60 CYS HXT H N N 61 GLN N N N N 62 GLN CA C N S 63 GLN C C N N 64 GLN O O N N 65 GLN CB C N N 66 GLN CG C N N 67 GLN CD C N N 68 GLN OE1 O N N 69 GLN NE2 N N N 70 GLN OXT O N N 71 GLN H H N N 72 GLN H2 H N N 73 GLN HA H N N 74 GLN HB2 H N N 75 GLN HB3 H N N 76 GLN HG2 H N N 77 GLN HG3 H N N 78 GLN HE21 H N N 79 GLN HE22 H N N 80 GLN HXT H N N 81 GLU N N N N 82 GLU CA C N S 83 GLU C C N N 84 GLU O O N N 85 GLU CB C N N 86 GLU CG C N N 87 GLU CD C N N 88 GLU OE1 O N N 89 GLU OE2 O N N 90 GLU OXT O N N 91 GLU H H N N 92 GLU H2 H N N 93 GLU HA H N N 94 GLU HB2 H N N 95 GLU HB3 H N N 96 GLU HG2 H N N 97 GLU HG3 H N N 98 GLU HE2 H N N 99 GLU HXT H N N 100 GLY N N N N 101 GLY CA C N N 102 GLY C C N N 103 GLY O O N N 104 GLY OXT O N N 105 GLY H H N N 106 GLY H2 H N N 107 GLY HA2 H N N 108 GLY HA3 H N N 109 GLY HXT H N N 110 HIS N N N N 111 HIS CA C N S 112 HIS C C N N 113 HIS O O N N 114 HIS CB C N N 115 HIS CG C Y N 116 HIS ND1 N Y N 117 HIS CD2 C Y N 118 HIS CE1 C Y N 119 HIS NE2 N Y N 120 HIS OXT O N N 121 HIS H H N N 122 HIS H2 H N N 123 HIS HA H N N 124 HIS HB2 H N N 125 HIS HB3 H N N 126 HIS HD1 H N N 127 HIS HD2 H N N 128 HIS HE1 H N N 129 HIS HE2 H N N 130 HIS HXT H N N 131 HOH O O N N 132 HOH H1 H N N 133 HOH H2 H N N 134 ILE N N N N 135 ILE CA C N S 136 ILE C C N N 137 ILE O O N N 138 ILE CB C N S 139 ILE CG1 C N N 140 ILE CG2 C N N 141 ILE CD1 C N N 142 ILE OXT O N N 143 ILE H H N N 144 ILE H2 H N N 145 ILE HA H N N 146 ILE HB H N N 147 ILE HG12 H N N 148 ILE HG13 H N N 149 ILE HG21 H N N 150 ILE HG22 H N N 151 ILE HG23 H N N 152 ILE HD11 H N N 153 ILE HD12 H N N 154 ILE HD13 H N N 155 ILE HXT H N N 156 LEU N N N N 157 LEU CA C N S 158 LEU C C N N 159 LEU O O N N 160 LEU CB C N N 161 LEU CG C N N 162 LEU CD1 C N N 163 LEU CD2 C N N 164 LEU OXT O N N 165 LEU H H N N 166 LEU H2 H N N 167 LEU HA H N N 168 LEU HB2 H N N 169 LEU HB3 H N N 170 LEU HG H N N 171 LEU HD11 H N N 172 LEU HD12 H N N 173 LEU HD13 H N N 174 LEU HD21 H N N 175 LEU HD22 H N N 176 LEU HD23 H N N 177 LEU HXT H N N 178 LYS N N N N 179 LYS CA C N S 180 LYS C C N N 181 LYS O O N N 182 LYS CB C N N 183 LYS CG C N N 184 LYS CD C N N 185 LYS CE C N N 186 LYS NZ N N N 187 LYS OXT O N N 188 LYS H H N N 189 LYS H2 H N N 190 LYS HA H N N 191 LYS HB2 H N N 192 LYS HB3 H N N 193 LYS HG2 H N N 194 LYS HG3 H N N 195 LYS HD2 H N N 196 LYS HD3 H N N 197 LYS HE2 H N N 198 LYS HE3 H N N 199 LYS HZ1 H N N 200 LYS HZ2 H N N 201 LYS HZ3 H N N 202 LYS HXT H N N 203 MET N N N N 204 MET CA C N S 205 MET C C N N 206 MET O O N N 207 MET CB C N N 208 MET CG C N N 209 MET SD S N N 210 MET CE C N N 211 MET OXT O N N 212 MET H H N N 213 MET H2 H N N 214 MET HA H N N 215 MET HB2 H N N 216 MET HB3 H N N 217 MET HG2 H N N 218 MET HG3 H N N 219 MET HE1 H N N 220 MET HE2 H N N 221 MET HE3 H N N 222 MET HXT H N N 223 ORN N N N N 224 ORN CA C N S 225 ORN CB C N N 226 ORN CG C N N 227 ORN CD C N N 228 ORN NE N N N 229 ORN C C N N 230 ORN O O N N 231 ORN OXT O N N 232 ORN H H N N 233 ORN H2 H N N 234 ORN HA H N N 235 ORN HB2 H N N 236 ORN HB3 H N N 237 ORN HG2 H N N 238 ORN HG3 H N N 239 ORN HD2 H N N 240 ORN HD3 H N N 241 ORN HE1 H N N 242 ORN HE2 H N N 243 ORN HXT H N N 244 PHE N N N N 245 PHE CA C N S 246 PHE C C N N 247 PHE O O N N 248 PHE CB C N N 249 PHE CG C Y N 250 PHE CD1 C Y N 251 PHE CD2 C Y N 252 PHE CE1 C Y N 253 PHE CE2 C Y N 254 PHE CZ C Y N 255 PHE OXT O N N 256 PHE H H N N 257 PHE H2 H N N 258 PHE HA H N N 259 PHE HB2 H N N 260 PHE HB3 H N N 261 PHE HD1 H N N 262 PHE HD2 H N N 263 PHE HE1 H N N 264 PHE HE2 H N N 265 PHE HZ H N N 266 PHE HXT H N N 267 SAR N N N N 268 SAR CA C N N 269 SAR C C N N 270 SAR O O N N 271 SAR CN C N N 272 SAR OXT O N N 273 SAR H H N N 274 SAR HA2 H N N 275 SAR HA3 H N N 276 SAR HN1 H N N 277 SAR HN2 H N N 278 SAR HN3 H N N 279 SAR HXT H N N 280 SER N N N N 281 SER CA C N S 282 SER C C N N 283 SER O O N N 284 SER CB C N N 285 SER OG O N N 286 SER OXT O N N 287 SER H H N N 288 SER H2 H N N 289 SER HA H N N 290 SER HB2 H N N 291 SER HB3 H N N 292 SER HG H N N 293 SER HXT H N N 294 VAL N N N N 295 VAL CA C N S 296 VAL C C N N 297 VAL O O N N 298 VAL CB C N N 299 VAL CG1 C N N 300 VAL CG2 C N N 301 VAL OXT O N N 302 VAL H H N N 303 VAL H2 H N N 304 VAL HA H N N 305 VAL HB H N N 306 VAL HG11 H N N 307 VAL HG12 H N N 308 VAL HG13 H N N 309 VAL HG21 H N N 310 VAL HG22 H N N 311 VAL HG23 H N N 312 VAL HXT H N N 313 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 HOH O H1 sing N N 124 HOH O H2 sing N N 125 ILE N CA sing N N 126 ILE N H sing N N 127 ILE N H2 sing N N 128 ILE CA C sing N N 129 ILE CA CB sing N N 130 ILE CA HA sing N N 131 ILE C O doub N N 132 ILE C OXT sing N N 133 ILE CB CG1 sing N N 134 ILE CB CG2 sing N N 135 ILE CB HB sing N N 136 ILE CG1 CD1 sing N N 137 ILE CG1 HG12 sing N N 138 ILE CG1 HG13 sing N N 139 ILE CG2 HG21 sing N N 140 ILE CG2 HG22 sing N N 141 ILE CG2 HG23 sing N N 142 ILE CD1 HD11 sing N N 143 ILE CD1 HD12 sing N N 144 ILE CD1 HD13 sing N N 145 ILE OXT HXT sing N N 146 LEU N CA sing N N 147 LEU N H sing N N 148 LEU N H2 sing N N 149 LEU CA C sing N N 150 LEU CA CB sing N N 151 LEU CA HA sing N N 152 LEU C O doub N N 153 LEU C OXT sing N N 154 LEU CB CG sing N N 155 LEU CB HB2 sing N N 156 LEU CB HB3 sing N N 157 LEU CG CD1 sing N N 158 LEU CG CD2 sing N N 159 LEU CG HG sing N N 160 LEU CD1 HD11 sing N N 161 LEU CD1 HD12 sing N N 162 LEU CD1 HD13 sing N N 163 LEU CD2 HD21 sing N N 164 LEU CD2 HD22 sing N N 165 LEU CD2 HD23 sing N N 166 LEU OXT HXT sing N N 167 LYS N CA sing N N 168 LYS N H sing N N 169 LYS N H2 sing N N 170 LYS CA C sing N N 171 LYS CA CB sing N N 172 LYS CA HA sing N N 173 LYS C O doub N N 174 LYS C OXT sing N N 175 LYS CB CG sing N N 176 LYS CB HB2 sing N N 177 LYS CB HB3 sing N N 178 LYS CG CD sing N N 179 LYS CG HG2 sing N N 180 LYS CG HG3 sing N N 181 LYS CD CE sing N N 182 LYS CD HD2 sing N N 183 LYS CD HD3 sing N N 184 LYS CE NZ sing N N 185 LYS CE HE2 sing N N 186 LYS CE HE3 sing N N 187 LYS NZ HZ1 sing N N 188 LYS NZ HZ2 sing N N 189 LYS NZ HZ3 sing N N 190 LYS OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 ORN N CA sing N N 211 ORN N H sing N N 212 ORN N H2 sing N N 213 ORN CA CB sing N N 214 ORN CA C sing N N 215 ORN CA HA sing N N 216 ORN CB CG sing N N 217 ORN CB HB2 sing N N 218 ORN CB HB3 sing N N 219 ORN CG CD sing N N 220 ORN CG HG2 sing N N 221 ORN CG HG3 sing N N 222 ORN CD NE sing N N 223 ORN CD HD2 sing N N 224 ORN CD HD3 sing N N 225 ORN NE HE1 sing N N 226 ORN NE HE2 sing N N 227 ORN C O doub N N 228 ORN C OXT sing N N 229 ORN OXT HXT sing N N 230 PHE N CA sing N N 231 PHE N H sing N N 232 PHE N H2 sing N N 233 PHE CA C sing N N 234 PHE CA CB sing N N 235 PHE CA HA sing N N 236 PHE C O doub N N 237 PHE C OXT sing N N 238 PHE CB CG sing N N 239 PHE CB HB2 sing N N 240 PHE CB HB3 sing N N 241 PHE CG CD1 doub Y N 242 PHE CG CD2 sing Y N 243 PHE CD1 CE1 sing Y N 244 PHE CD1 HD1 sing N N 245 PHE CD2 CE2 doub Y N 246 PHE CD2 HD2 sing N N 247 PHE CE1 CZ doub Y N 248 PHE CE1 HE1 sing N N 249 PHE CE2 CZ sing Y N 250 PHE CE2 HE2 sing N N 251 PHE CZ HZ sing N N 252 PHE OXT HXT sing N N 253 SAR N CA sing N N 254 SAR N CN sing N N 255 SAR N H sing N N 256 SAR CA C sing N N 257 SAR CA HA2 sing N N 258 SAR CA HA3 sing N N 259 SAR C O doub N N 260 SAR C OXT sing N N 261 SAR CN HN1 sing N N 262 SAR CN HN2 sing N N 263 SAR CN HN3 sing N N 264 SAR OXT HXT sing N N 265 SER N CA sing N N 266 SER N H sing N N 267 SER N H2 sing N N 268 SER CA C sing N N 269 SER CA CB sing N N 270 SER CA HA sing N N 271 SER C O doub N N 272 SER C OXT sing N N 273 SER CB OG sing N N 274 SER CB HB2 sing N N 275 SER CB HB3 sing N N 276 SER OG HG sing N N 277 SER OXT HXT sing N N 278 VAL N CA sing N N 279 VAL N H sing N N 280 VAL N H2 sing N N 281 VAL CA C sing N N 282 VAL CA CB sing N N 283 VAL CA HA sing N N 284 VAL C O doub N N 285 VAL C OXT sing N N 286 VAL CB CG1 sing N N 287 VAL CB CG2 sing N N 288 VAL CB HB sing N N 289 VAL CG1 HG11 sing N N 290 VAL CG1 HG12 sing N N 291 VAL CG1 HG13 sing N N 292 VAL CG2 HG21 sing N N 293 VAL CG2 HG22 sing N N 294 VAL CG2 HG23 sing N N 295 VAL OXT HXT sing N N 296 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM097562 1 'National Institutes of Health/National Institute on Aging (NIH/NIA)' 'United States' ? 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6WXM _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #