data_7S3L # _entry.id 7S3L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.358 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7S3L pdb_00007s3l 10.2210/pdb7s3l/pdb WWPDB D_1000259565 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7S3L _pdbx_database_status.recvd_initial_deposition_date 2021-09-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nandakumar, J.' 1 0000-0001-9146-2785 'Wozniak, K.J.' 2 0000-0002-3406-3689 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Genet.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7404 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 18 _citation.language ? _citation.page_first e1010196 _citation.page_last e1010196 _citation.title 'Structure and kinase activity of bacterial cell cycle regulator CcrZ.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pgen.1010196 _citation.pdbx_database_id_PubMed 35576203 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wozniak, K.J.' 1 0000-0002-3406-3689 primary 'Burby, P.E.' 2 ? primary 'Nandakumar, J.' 3 ? primary 'Simmons, L.A.' 4 0000-0002-9600-7623 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7S3L _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.118 _cell.length_a_esd ? _cell.length_b 98.118 _cell.length_b_esd ? _cell.length_c 69.127 _cell.length_c_esd ? _cell.volume 665504.717 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7S3L _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aminoglycoside phosphotransferase family protein' 31327.332 1 ? ? ? ? 2 non-polymer nat 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;LNID(MSE)NWLGQLLGSDWEIFPAGGATGDAYYAKHNGQQLFLKRNSSPFLAVLSAEGIVPKLVWTKR(MSE)ENGDVI TAQHW(MSE)TGRELKPKD(MSE)SGRPVAELLRKIHTSKALLD(MSE)LKRLGKEPLNPGALLSQLKQAVFAVQQSSPL IQEGIKYLEEHLHEVHFGEKVVCHCDVNHNNWLLSEDNQLYLIDWDGA(MSE)IADPA(MSE)DLGPLLYHYVEKPAWES WLS(MSE)YGIELTESLRLR(MSE)AWYVLSETITFIAWHKAKGNDKEFHDA(MSE)EELHIL(MSE)KRIVD ; _entity_poly.pdbx_seq_one_letter_code_can ;LNIDMNWLGQLLGSDWEIFPAGGATGDAYYAKHNGQQLFLKRNSSPFLAVLSAEGIVPKLVWTKRMENGDVITAQHWMTG RELKPKDMSGRPVAELLRKIHTSKALLDMLKRLGKEPLNPGALLSQLKQAVFAVQQSSPLIQEGIKYLEEHLHEVHFGEK VVCHCDVNHNNWLLSEDNQLYLIDWDGAMIADPAMDLGPLLYHYVEKPAWESWLSMYGIELTESLRLRMAWYVLSETITF IAWHKAKGNDKEFHDAMEELHILMKRIVD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ASN n 1 3 ILE n 1 4 ASP n 1 5 MSE n 1 6 ASN n 1 7 TRP n 1 8 LEU n 1 9 GLY n 1 10 GLN n 1 11 LEU n 1 12 LEU n 1 13 GLY n 1 14 SER n 1 15 ASP n 1 16 TRP n 1 17 GLU n 1 18 ILE n 1 19 PHE n 1 20 PRO n 1 21 ALA n 1 22 GLY n 1 23 GLY n 1 24 ALA n 1 25 THR n 1 26 GLY n 1 27 ASP n 1 28 ALA n 1 29 TYR n 1 30 TYR n 1 31 ALA n 1 32 LYS n 1 33 HIS n 1 34 ASN n 1 35 GLY n 1 36 GLN n 1 37 GLN n 1 38 LEU n 1 39 PHE n 1 40 LEU n 1 41 LYS n 1 42 ARG n 1 43 ASN n 1 44 SER n 1 45 SER n 1 46 PRO n 1 47 PHE n 1 48 LEU n 1 49 ALA n 1 50 VAL n 1 51 LEU n 1 52 SER n 1 53 ALA n 1 54 GLU n 1 55 GLY n 1 56 ILE n 1 57 VAL n 1 58 PRO n 1 59 LYS n 1 60 LEU n 1 61 VAL n 1 62 TRP n 1 63 THR n 1 64 LYS n 1 65 ARG n 1 66 MSE n 1 67 GLU n 1 68 ASN n 1 69 GLY n 1 70 ASP n 1 71 VAL n 1 72 ILE n 1 73 THR n 1 74 ALA n 1 75 GLN n 1 76 HIS n 1 77 TRP n 1 78 MSE n 1 79 THR n 1 80 GLY n 1 81 ARG n 1 82 GLU n 1 83 LEU n 1 84 LYS n 1 85 PRO n 1 86 LYS n 1 87 ASP n 1 88 MSE n 1 89 SER n 1 90 GLY n 1 91 ARG n 1 92 PRO n 1 93 VAL n 1 94 ALA n 1 95 GLU n 1 96 LEU n 1 97 LEU n 1 98 ARG n 1 99 LYS n 1 100 ILE n 1 101 HIS n 1 102 THR n 1 103 SER n 1 104 LYS n 1 105 ALA n 1 106 LEU n 1 107 LEU n 1 108 ASP n 1 109 MSE n 1 110 LEU n 1 111 LYS n 1 112 ARG n 1 113 LEU n 1 114 GLY n 1 115 LYS n 1 116 GLU n 1 117 PRO n 1 118 LEU n 1 119 ASN n 1 120 PRO n 1 121 GLY n 1 122 ALA n 1 123 LEU n 1 124 LEU n 1 125 SER n 1 126 GLN n 1 127 LEU n 1 128 LYS n 1 129 GLN n 1 130 ALA n 1 131 VAL n 1 132 PHE n 1 133 ALA n 1 134 VAL n 1 135 GLN n 1 136 GLN n 1 137 SER n 1 138 SER n 1 139 PRO n 1 140 LEU n 1 141 ILE n 1 142 GLN n 1 143 GLU n 1 144 GLY n 1 145 ILE n 1 146 LYS n 1 147 TYR n 1 148 LEU n 1 149 GLU n 1 150 GLU n 1 151 HIS n 1 152 LEU n 1 153 HIS n 1 154 GLU n 1 155 VAL n 1 156 HIS n 1 157 PHE n 1 158 GLY n 1 159 GLU n 1 160 LYS n 1 161 VAL n 1 162 VAL n 1 163 CYS n 1 164 HIS n 1 165 CYS n 1 166 ASP n 1 167 VAL n 1 168 ASN n 1 169 HIS n 1 170 ASN n 1 171 ASN n 1 172 TRP n 1 173 LEU n 1 174 LEU n 1 175 SER n 1 176 GLU n 1 177 ASP n 1 178 ASN n 1 179 GLN n 1 180 LEU n 1 181 TYR n 1 182 LEU n 1 183 ILE n 1 184 ASP n 1 185 TRP n 1 186 ASP n 1 187 GLY n 1 188 ALA n 1 189 MSE n 1 190 ILE n 1 191 ALA n 1 192 ASP n 1 193 PRO n 1 194 ALA n 1 195 MSE n 1 196 ASP n 1 197 LEU n 1 198 GLY n 1 199 PRO n 1 200 LEU n 1 201 LEU n 1 202 TYR n 1 203 HIS n 1 204 TYR n 1 205 VAL n 1 206 GLU n 1 207 LYS n 1 208 PRO n 1 209 ALA n 1 210 TRP n 1 211 GLU n 1 212 SER n 1 213 TRP n 1 214 LEU n 1 215 SER n 1 216 MSE n 1 217 TYR n 1 218 GLY n 1 219 ILE n 1 220 GLU n 1 221 LEU n 1 222 THR n 1 223 GLU n 1 224 SER n 1 225 LEU n 1 226 ARG n 1 227 LEU n 1 228 ARG n 1 229 MSE n 1 230 ALA n 1 231 TRP n 1 232 TYR n 1 233 VAL n 1 234 LEU n 1 235 SER n 1 236 GLU n 1 237 THR n 1 238 ILE n 1 239 THR n 1 240 PHE n 1 241 ILE n 1 242 ALA n 1 243 TRP n 1 244 HIS n 1 245 LYS n 1 246 ALA n 1 247 LYS n 1 248 GLY n 1 249 ASN n 1 250 ASP n 1 251 LYS n 1 252 GLU n 1 253 PHE n 1 254 HIS n 1 255 ASP n 1 256 ALA n 1 257 MSE n 1 258 GLU n 1 259 GLU n 1 260 LEU n 1 261 HIS n 1 262 ILE n 1 263 LEU n 1 264 MSE n 1 265 LYS n 1 266 ARG n 1 267 ILE n 1 268 VAL n 1 269 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 269 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ytmP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain PY79 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis PY79' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1415167 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7S3L _struct_ref.pdbx_db_accession 7S3L _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7S3L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 269 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7S3L _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 269 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ANP non-polymer . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7S3L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.66 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.84 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 6000, 1 M LiCl, 0.1 M NaOAc (pH 5.84)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9784 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9784 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 69.53 _reflns.entry_id 7S3L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 98.12 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10890 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.5 _reflns.pdbx_Rmerge_I_obs 0.146 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.72 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1299 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.598 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 27.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.885 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 83.44 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7S3L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 34.69 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10750 _refine.ls_number_reflns_R_free 1077 _refine.ls_number_reflns_R_work 9673 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.12 _refine.ls_percent_reflns_R_free 10.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2445 _refine.ls_R_factor_R_free 0.2629 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2424 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.7606 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3371 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 34.69 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 2100 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2068 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0083 ? 2153 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0391 ? 2920 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0527 ? 316 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0055 ? 359 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.4333 ? 788 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.60 2.72 . . 127 1139 95.62 . . . 0.3702 . 0.3197 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.72 2.86 . . 131 1165 98.48 . . . 0.3861 . 0.3239 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.86 3.04 . . 132 1186 99.17 . . . 0.3933 . 0.3108 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.04 3.28 . . 134 1204 99.85 . . . 0.3638 . 0.3148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.28 3.60 . . 133 1205 99.85 . . . 0.3127 . 0.2714 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.60 4.13 . . 135 1214 100.00 . . . 0.2438 . 0.2401 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.13 5.19 . . 138 1244 100.00 . . . 0.2141 . 0.2040 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.20 34.69 . . 147 1316 99.93 . . . 0.2207 . 0.2161 . . . . . . . . . . . # _struct.entry_id 7S3L _struct.title 'Structure of Bacillus subtilis CcrZ (previously called YtmP)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7S3L _struct_keywords.text 'Kinase, DNA replication, DNA damage, cell division, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 46 ? GLU A 54 ? PRO A 46 GLU A 54 1 ? 9 HELX_P HELX_P2 AA2 LYS A 84 ? SER A 89 ? LYS A 84 SER A 89 5 ? 6 HELX_P HELX_P3 AA3 GLY A 90 ? SER A 103 ? GLY A 90 SER A 103 1 ? 14 HELX_P HELX_P4 AA4 SER A 103 ? LEU A 113 ? SER A 103 LEU A 113 1 ? 11 HELX_P HELX_P5 AA5 ASN A 119 ? LEU A 127 ? ASN A 119 LEU A 127 1 ? 9 HELX_P HELX_P6 AA6 SER A 138 ? GLU A 150 ? SER A 138 GLU A 150 1 ? 13 HELX_P HELX_P7 AA7 HIS A 151 ? VAL A 155 ? HIS A 151 VAL A 155 5 ? 5 HELX_P HELX_P8 AA8 ASN A 168 ? ASN A 170 ? ASN A 168 ASN A 170 5 ? 3 HELX_P HELX_P9 AA9 PRO A 193 ? VAL A 205 ? PRO A 193 VAL A 205 1 ? 13 HELX_P HELX_P10 AB1 GLU A 206 ? PRO A 208 ? GLU A 206 PRO A 208 5 ? 3 HELX_P HELX_P11 AB2 ALA A 209 ? GLY A 218 ? ALA A 209 GLY A 218 1 ? 10 HELX_P HELX_P12 AB3 THR A 222 ? HIS A 244 ? THR A 222 HIS A 244 1 ? 23 HELX_P HELX_P13 AB4 GLU A 252 ? ILE A 267 ? GLU A 252 ILE A 267 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 4 C ? ? ? 1_555 A MSE 5 N ? ? A ASP 4 A MSE 5 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A MSE 5 C ? ? ? 1_555 A ASN 6 N ? ? A MSE 5 A ASN 6 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A ARG 65 C ? ? ? 1_555 A MSE 66 N ? ? A ARG 65 A MSE 66 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale4 covale both ? A MSE 66 C ? ? ? 1_555 A GLU 67 N ? ? A MSE 66 A GLU 67 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale5 covale both ? A TRP 77 C ? ? ? 1_555 A MSE 78 N ? ? A TRP 77 A MSE 78 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale6 covale both ? A MSE 78 C ? ? ? 1_555 A THR 79 N ? ? A MSE 78 A THR 79 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale7 covale none ? A LYS 86 NZ ? ? ? 1_555 B ANP . O1B ? ? A LYS 86 A ANP 301 4_555 ? ? ? ? ? ? ? 1.304 ? ? covale8 covale both ? A ASP 87 C ? ? ? 1_555 A MSE 88 N ? ? A ASP 87 A MSE 88 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale9 covale both ? A MSE 88 C ? ? ? 1_555 A SER 89 N ? ? A MSE 88 A SER 89 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale10 covale both ? A ASP 108 C ? ? ? 1_555 A MSE 109 N ? ? A ASP 108 A MSE 109 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale11 covale both ? A MSE 109 C ? ? ? 1_555 A LEU 110 N ? ? A MSE 109 A LEU 110 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale12 covale both ? A ALA 188 C ? ? ? 1_555 A MSE 189 N ? ? A ALA 188 A MSE 189 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale13 covale both ? A MSE 189 C ? ? ? 1_555 A ILE 190 N ? ? A MSE 189 A ILE 190 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale14 covale both ? A ALA 194 C ? ? ? 1_555 A MSE 195 N ? ? A ALA 194 A MSE 195 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale15 covale both ? A MSE 195 C ? ? ? 1_555 A ASP 196 N ? ? A MSE 195 A ASP 196 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale16 covale both ? A SER 215 C ? ? ? 1_555 A MSE 216 N ? ? A SER 215 A MSE 216 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale17 covale both ? A MSE 216 C ? ? ? 1_555 A TYR 217 N ? ? A MSE 216 A TYR 217 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale18 covale both ? A ARG 228 C ? ? ? 1_555 A MSE 229 N ? ? A ARG 228 A MSE 229 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale19 covale both ? A MSE 229 C ? ? ? 1_555 A ALA 230 N ? ? A MSE 229 A ALA 230 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale20 covale both ? A ALA 256 C ? ? ? 1_555 A MSE 257 N ? ? A ALA 256 A MSE 257 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale21 covale both ? A MSE 257 C ? ? ? 1_555 A GLU 258 N ? ? A MSE 257 A GLU 258 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale22 covale both ? A LEU 263 C ? ? ? 1_555 A MSE 264 N ? ? A LEU 263 A MSE 264 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale23 covale both ? A MSE 264 C ? ? ? 1_555 A LYS 265 N ? ? A MSE 264 A LYS 265 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 17 ? PRO A 20 ? GLU A 17 PRO A 20 AA1 2 ALA A 28 ? HIS A 33 ? ALA A 28 HIS A 33 AA1 3 GLN A 36 ? ARG A 42 ? GLN A 36 ARG A 42 AA1 4 VAL A 71 ? HIS A 76 ? VAL A 71 HIS A 76 AA1 5 LEU A 60 ? ARG A 65 ? LEU A 60 ARG A 65 AA2 1 GLY A 80 ? GLU A 82 ? GLY A 80 GLU A 82 AA2 2 TRP A 172 ? SER A 175 ? TRP A 172 SER A 175 AA2 3 LEU A 180 ? LEU A 182 ? LEU A 180 LEU A 182 AA3 1 VAL A 161 ? CYS A 163 ? VAL A 161 CYS A 163 AA3 2 MSE A 189 ? ALA A 191 ? MSE A 189 ALA A 191 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 19 ? N PHE A 19 O TYR A 30 ? O TYR A 30 AA1 2 3 N TYR A 29 ? N TYR A 29 O LEU A 40 ? O LEU A 40 AA1 3 4 N PHE A 39 ? N PHE A 39 O GLN A 75 ? O GLN A 75 AA1 4 5 O ALA A 74 ? O ALA A 74 N VAL A 61 ? N VAL A 61 AA2 1 2 N ARG A 81 ? N ARG A 81 O LEU A 174 ? O LEU A 174 AA2 2 3 N LEU A 173 ? N LEU A 173 O TYR A 181 ? O TYR A 181 AA3 1 2 N VAL A 161 ? N VAL A 161 O ALA A 191 ? O ALA A 191 # _atom_sites.entry_id 7S3L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010192 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010192 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014466 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 MSE 5 5 5 MSE MSE A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 GLN 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 GLY 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 MSE 66 66 66 MSE MSE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 MSE 78 78 78 MSE MSE A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 MSE 88 88 88 MSE MSE A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 MSE 109 109 109 MSE MSE A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 ALA 130 130 ? ? ? A . n A 1 131 VAL 131 131 ? ? ? A . n A 1 132 PHE 132 132 ? ? ? A . n A 1 133 ALA 133 133 ? ? ? A . n A 1 134 VAL 134 134 ? ? ? A . n A 1 135 GLN 135 135 ? ? ? A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 CYS 163 163 163 CYS CYS A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 CYS 165 165 165 CYS CYS A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 HIS 169 169 169 HIS HIS A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 TRP 172 172 172 TRP TRP A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 GLN 179 179 179 GLN GLN A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 ASP 184 184 184 ASP ASP A . n A 1 185 TRP 185 185 185 TRP TRP A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 MSE 189 189 189 MSE MSE A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 PRO 193 193 193 PRO PRO A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 MSE 195 195 195 MSE MSE A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 HIS 203 203 203 HIS HIS A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 TRP 210 210 210 TRP TRP A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 TRP 213 213 213 TRP TRP A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 MSE 216 216 216 MSE MSE A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ARG 228 228 228 ARG ARG A . n A 1 229 MSE 229 229 229 MSE MSE A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 TRP 231 231 231 TRP TRP A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 GLU 236 236 236 GLU GLU A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 TRP 243 243 243 TRP TRP A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 LYS 247 247 ? ? ? A . n A 1 248 GLY 248 248 ? ? ? A . n A 1 249 ASN 249 249 249 ASN ASN A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 LYS 251 251 251 LYS LYS A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 PHE 253 253 253 PHE PHE A . n A 1 254 HIS 254 254 254 HIS HIS A . n A 1 255 ASP 255 255 255 ASP ASP A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 MSE 257 257 257 MSE MSE A . n A 1 258 GLU 258 258 258 GLU GLU A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 HIS 261 261 261 HIS HIS A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 MSE 264 264 264 MSE MSE A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 ARG 266 266 266 ARG ARG A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 ASP 269 269 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ANP 1 301 301 ANP ANP A . C 3 HOH 1 401 1 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 5 A MSE 5 ? MET 'modified residue' 2 A MSE 66 A MSE 66 ? MET 'modified residue' 3 A MSE 78 A MSE 78 ? MET 'modified residue' 4 A MSE 88 A MSE 88 ? MET 'modified residue' 5 A MSE 109 A MSE 109 ? MET 'modified residue' 6 A MSE 189 A MSE 189 ? MET 'modified residue' 7 A MSE 195 A MSE 195 ? MET 'modified residue' 8 A MSE 216 A MSE 216 ? MET 'modified residue' 9 A MSE 229 A MSE 229 ? MET 'modified residue' 10 A MSE 257 A MSE 257 ? MET 'modified residue' 11 A MSE 264 A MSE 264 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 590 ? 1 MORE -2 ? 1 'SSA (A^2)' 14770 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-05-11 2 'Structure model' 1 1 2022-06-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 1.17.1_3660 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 5 # _pdbx_entry_details.entry_id 7S3L _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 65 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 111 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_665 _pdbx_validate_symm_contact.dist 2.03 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MSE A 5 ? ? -157.59 49.78 2 1 ASN A 34 ? ? 57.20 -129.32 3 1 LEU A 127 ? ? -67.84 74.17 4 1 VAL A 155 ? ? -108.54 60.44 5 1 CYS A 165 ? ? 84.53 3.84 6 1 ASP A 184 ? ? 63.31 89.17 7 1 LYS A 251 ? ? -92.04 -67.41 8 1 ILE A 267 ? ? -101.10 59.11 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 9 ? A GLY 9 2 1 Y 1 A GLN 10 ? A GLN 10 3 1 Y 1 A LEU 11 ? A LEU 11 4 1 Y 1 A GLY 22 ? A GLY 22 5 1 Y 1 A GLY 23 ? A GLY 23 6 1 Y 1 A ALA 24 ? A ALA 24 7 1 Y 1 A ALA 130 ? A ALA 130 8 1 Y 1 A VAL 131 ? A VAL 131 9 1 Y 1 A PHE 132 ? A PHE 132 10 1 Y 1 A ALA 133 ? A ALA 133 11 1 Y 1 A VAL 134 ? A VAL 134 12 1 Y 1 A GLN 135 ? A GLN 135 13 1 Y 1 A LYS 247 ? A LYS 247 14 1 Y 1 A GLY 248 ? A GLY 248 15 1 Y 1 A ASP 269 ? A ASP 269 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R35GM131772 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM120094 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' T32GM008353 3 'National Science Foundation (NSF, United States)' 'United States' 'DEG1256260)' 4 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ANP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ANP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 #