data_7SFP # _entry.id 7SFP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7SFP pdb_00007sfp 10.2210/pdb7sfp/pdb WWPDB D_1000260179 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7SFP _pdbx_database_status.recvd_initial_deposition_date 2021-10-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bilyk, O.' 1 0000-0002-8159-8088 'Leadlay, P.F.' 2 0000-0002-3247-509X 'Dias, M.V.B.' 3 0000-0002-5312-0191 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 144 _citation.language ? _citation.page_first 14555 _citation.page_last 14563 _citation.title 'Enzyme-Catalyzed Spiroacetal Formation in Polyketide Antibiotic Biosynthesis.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.2c03313 _citation.pdbx_database_id_PubMed 35921248 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bilyk, O.' 1 ? primary 'Oliveira, G.S.' 2 ? primary 'de Angelo, R.M.' 3 ? primary 'Almeida, M.O.' 4 ? primary 'Honorio, K.M.' 5 ? primary 'Leeper, F.J.' 6 0000-0003-3408-5199 primary 'Dias, M.V.B.' 7 0000-0002-5312-0191 primary 'Leadlay, P.F.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7SFP _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.953 _cell.length_a_esd ? _cell.length_b 53.953 _cell.length_b_esd ? _cell.length_c 245.110 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7SFP _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Spirocyclase 23832.330 1 ? ? ? ? 2 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMWSHPQFEKENLYFQSMSAQPIQSSDDALRDSVPAESGEVAFPGRPDVAVEMRQLDFLLG DFRIEYTNLTTETVTTGEATCSTRPLADGRFYELTQRVPVPGLVATWLIGWSDVDNRFVSFYYDDWGHHGRFTGPGWVDG HFKLTGDSAVFGARHGFVEDFEIVDSDHLVKHGFVVVGDDLVPGDILHFHRI ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMWSHPQFEKENLYFQSMSAQPIQSSDDALRDSVPAESGEVAFPGRPDVAVEMRQLDFLLG DFRIEYTNLTTETVTTGEATCSTRPLADGRFYELTQRVPVPGLVATWLIGWSDVDNRFVSFYYDDWGHHGRFTGPGWVDG HFKLTGDSAVFGARHGFVEDFEIVDSDHLVKHGFVVVGDDLVPGDILHFHRI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 TRP n 1 23 SER n 1 24 HIS n 1 25 PRO n 1 26 GLN n 1 27 PHE n 1 28 GLU n 1 29 LYS n 1 30 GLU n 1 31 ASN n 1 32 LEU n 1 33 TYR n 1 34 PHE n 1 35 GLN n 1 36 SER n 1 37 MET n 1 38 SER n 1 39 ALA n 1 40 GLN n 1 41 PRO n 1 42 ILE n 1 43 GLN n 1 44 SER n 1 45 SER n 1 46 ASP n 1 47 ASP n 1 48 ALA n 1 49 LEU n 1 50 ARG n 1 51 ASP n 1 52 SER n 1 53 VAL n 1 54 PRO n 1 55 ALA n 1 56 GLU n 1 57 SER n 1 58 GLY n 1 59 GLU n 1 60 VAL n 1 61 ALA n 1 62 PHE n 1 63 PRO n 1 64 GLY n 1 65 ARG n 1 66 PRO n 1 67 ASP n 1 68 VAL n 1 69 ALA n 1 70 VAL n 1 71 GLU n 1 72 MET n 1 73 ARG n 1 74 GLN n 1 75 LEU n 1 76 ASP n 1 77 PHE n 1 78 LEU n 1 79 LEU n 1 80 GLY n 1 81 ASP n 1 82 PHE n 1 83 ARG n 1 84 ILE n 1 85 GLU n 1 86 TYR n 1 87 THR n 1 88 ASN n 1 89 LEU n 1 90 THR n 1 91 THR n 1 92 GLU n 1 93 THR n 1 94 VAL n 1 95 THR n 1 96 THR n 1 97 GLY n 1 98 GLU n 1 99 ALA n 1 100 THR n 1 101 CYS n 1 102 SER n 1 103 THR n 1 104 ARG n 1 105 PRO n 1 106 LEU n 1 107 ALA n 1 108 ASP n 1 109 GLY n 1 110 ARG n 1 111 PHE n 1 112 TYR n 1 113 GLU n 1 114 LEU n 1 115 THR n 1 116 GLN n 1 117 ARG n 1 118 VAL n 1 119 PRO n 1 120 VAL n 1 121 PRO n 1 122 GLY n 1 123 LEU n 1 124 VAL n 1 125 ALA n 1 126 THR n 1 127 TRP n 1 128 LEU n 1 129 ILE n 1 130 GLY n 1 131 TRP n 1 132 SER n 1 133 ASP n 1 134 VAL n 1 135 ASP n 1 136 ASN n 1 137 ARG n 1 138 PHE n 1 139 VAL n 1 140 SER n 1 141 PHE n 1 142 TYR n 1 143 TYR n 1 144 ASP n 1 145 ASP n 1 146 TRP n 1 147 GLY n 1 148 HIS n 1 149 HIS n 1 150 GLY n 1 151 ARG n 1 152 PHE n 1 153 THR n 1 154 GLY n 1 155 PRO n 1 156 GLY n 1 157 TRP n 1 158 VAL n 1 159 ASP n 1 160 GLY n 1 161 HIS n 1 162 PHE n 1 163 LYS n 1 164 LEU n 1 165 THR n 1 166 GLY n 1 167 ASP n 1 168 SER n 1 169 ALA n 1 170 VAL n 1 171 PHE n 1 172 GLY n 1 173 ALA n 1 174 ARG n 1 175 HIS n 1 176 GLY n 1 177 PHE n 1 178 VAL n 1 179 GLU n 1 180 ASP n 1 181 PHE n 1 182 GLU n 1 183 ILE n 1 184 VAL n 1 185 ASP n 1 186 SER n 1 187 ASP n 1 188 HIS n 1 189 LEU n 1 190 VAL n 1 191 LYS n 1 192 HIS n 1 193 GLY n 1 194 PHE n 1 195 VAL n 1 196 VAL n 1 197 VAL n 1 198 GLY n 1 199 ASP n 1 200 ASP n 1 201 LEU n 1 202 VAL n 1 203 PRO n 1 204 GLY n 1 205 ASP n 1 206 ILE n 1 207 LEU n 1 208 HIS n 1 209 PHE n 1 210 HIS n 1 211 ARG n 1 212 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 212 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ossO _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces ossamyceticus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 249581 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A481S8L7_9ACTN _struct_ref.pdbx_db_accession A0A481S8L7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSAQPIQSSDDALRDSVPAESGEVAFPGRPDVAVEMRQLDFLLGDFRIEYTNLTTETVTTGEATCSTRPLADGRFYELTQ RVPVPGLVATWLIGWSDVDNRFVSFYYDDWGHHGRFTGPGWVDGHFKLTGDSAVFGARHGFVEDFEIVDSDHLVKHGFVV VGDDLVPGDILHFHRI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7SFP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 37 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 212 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A481S8L7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 176 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 176 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7SFP MET A 1 ? UNP A0A481S8L7 ? ? 'expression tag' -35 1 1 7SFP GLY A 2 ? UNP A0A481S8L7 ? ? 'expression tag' -34 2 1 7SFP SER A 3 ? UNP A0A481S8L7 ? ? 'expression tag' -33 3 1 7SFP SER A 4 ? UNP A0A481S8L7 ? ? 'expression tag' -32 4 1 7SFP HIS A 5 ? UNP A0A481S8L7 ? ? 'expression tag' -31 5 1 7SFP HIS A 6 ? UNP A0A481S8L7 ? ? 'expression tag' -30 6 1 7SFP HIS A 7 ? UNP A0A481S8L7 ? ? 'expression tag' -29 7 1 7SFP HIS A 8 ? UNP A0A481S8L7 ? ? 'expression tag' -28 8 1 7SFP HIS A 9 ? UNP A0A481S8L7 ? ? 'expression tag' -27 9 1 7SFP HIS A 10 ? UNP A0A481S8L7 ? ? 'expression tag' -26 10 1 7SFP SER A 11 ? UNP A0A481S8L7 ? ? 'expression tag' -25 11 1 7SFP SER A 12 ? UNP A0A481S8L7 ? ? 'expression tag' -24 12 1 7SFP GLY A 13 ? UNP A0A481S8L7 ? ? 'expression tag' -23 13 1 7SFP LEU A 14 ? UNP A0A481S8L7 ? ? 'expression tag' -22 14 1 7SFP VAL A 15 ? UNP A0A481S8L7 ? ? 'expression tag' -21 15 1 7SFP PRO A 16 ? UNP A0A481S8L7 ? ? 'expression tag' -20 16 1 7SFP ARG A 17 ? UNP A0A481S8L7 ? ? 'expression tag' -19 17 1 7SFP GLY A 18 ? UNP A0A481S8L7 ? ? 'expression tag' -18 18 1 7SFP SER A 19 ? UNP A0A481S8L7 ? ? 'expression tag' -17 19 1 7SFP HIS A 20 ? UNP A0A481S8L7 ? ? 'expression tag' -16 20 1 7SFP MET A 21 ? UNP A0A481S8L7 ? ? 'expression tag' -15 21 1 7SFP TRP A 22 ? UNP A0A481S8L7 ? ? 'expression tag' -14 22 1 7SFP SER A 23 ? UNP A0A481S8L7 ? ? 'expression tag' -13 23 1 7SFP HIS A 24 ? UNP A0A481S8L7 ? ? 'expression tag' -12 24 1 7SFP PRO A 25 ? UNP A0A481S8L7 ? ? 'expression tag' -11 25 1 7SFP GLN A 26 ? UNP A0A481S8L7 ? ? 'expression tag' -10 26 1 7SFP PHE A 27 ? UNP A0A481S8L7 ? ? 'expression tag' -9 27 1 7SFP GLU A 28 ? UNP A0A481S8L7 ? ? 'expression tag' -8 28 1 7SFP LYS A 29 ? UNP A0A481S8L7 ? ? 'expression tag' -7 29 1 7SFP GLU A 30 ? UNP A0A481S8L7 ? ? 'expression tag' -6 30 1 7SFP ASN A 31 ? UNP A0A481S8L7 ? ? 'expression tag' -5 31 1 7SFP LEU A 32 ? UNP A0A481S8L7 ? ? 'expression tag' -4 32 1 7SFP TYR A 33 ? UNP A0A481S8L7 ? ? 'expression tag' -3 33 1 7SFP PHE A 34 ? UNP A0A481S8L7 ? ? 'expression tag' -2 34 1 7SFP GLN A 35 ? UNP A0A481S8L7 ? ? 'expression tag' -1 35 1 7SFP SER A 36 ? UNP A0A481S8L7 ? ? 'expression tag' 0 36 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7SFP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;20 %w/v PEG 8K, 0.1 M 0.2 M MgCl2 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 R 100K-A' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979500 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979500 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7SFP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 49.020 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11716 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 50.000 _reflns.pdbx_Rmerge_I_obs 0.123 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.124 _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 586280 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.200 2.270 ? ? 52612 ? ? ? 990 99.900 ? ? ? ? 3.211 ? ? ? ? ? ? ? ? 53.100 ? ? ? 1.500 3.242 0.441 ? 1 1 0.887 ? ? ? ? ? ? ? ? ? ? 9.070 49.020 ? ? 7900 ? ? ? 240 99.900 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 32.900 ? ? ? 85.800 0.035 0.006 ? 2 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 133.380 _refine.B_iso_mean 68.0770 _refine.B_iso_min 40.800 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7SFP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 46.7250 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11589 _refine.ls_number_reflns_R_free 565 _refine.ls_number_reflns_R_work 11024 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6300 _refine.ls_percent_reflns_R_free 4.8800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2217 _refine.ls_R_factor_R_free 0.2728 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2190 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7SFN _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.9500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 46.7250 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1223 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 151 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 77.92 _refine_hist.pdbx_number_atoms_protein 1200 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2000 2.4214 . . 130 2651 99.0000 . . . 0.3288 0.0000 0.2751 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4214 2.7717 . . 137 2682 100.0000 . . . 0.3626 0.0000 0.2496 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7717 3.4919 . . 137 2742 100.0000 . . . 0.2828 0.0000 0.2329 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4919 46.72 . . 161 2949 100.0000 . . . 0.2517 0.0000 0.2034 . . . . . . . . . . . # _struct.entry_id 7SFP _struct.title 'Crystal structure of OssO, a spirocyclase involved in the biosynthesis of ossamycin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7SFP _struct_keywords.text 'cyclase, spyrocyclase, oligomycin, calycin, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 69 ? LEU A 79 ? ALA A 33 LEU A 43 5 ? 11 HELX_P HELX_P2 AA2 ALA A 107 ? ARG A 110 ? ALA A 71 ARG A 74 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 157 ? VAL A 158 ? TRP A 121 VAL A 122 AA1 2 HIS A 161 ? VAL A 170 ? HIS A 125 VAL A 134 AA1 3 ALA A 173 ? ASP A 185 ? ALA A 137 ASP A 149 AA1 4 HIS A 188 ? VAL A 197 ? HIS A 152 VAL A 161 AA1 5 ASP A 200 ? ARG A 211 ? ASP A 164 ARG A 175 AA1 6 GLY A 80 ? ASN A 88 ? GLY A 44 ASN A 52 AA1 7 GLY A 97 ? LEU A 106 ? GLY A 61 LEU A 70 AA1 8 PHE A 111 ? VAL A 118 ? PHE A 75 VAL A 82 AA1 9 LEU A 123 ? SER A 132 ? LEU A 87 SER A 96 AA1 10 ARG A 137 ? ASP A 144 ? ARG A 101 ASP A 108 AA1 11 HIS A 149 ? GLY A 154 ? HIS A 113 GLY A 118 AA1 12 HIS A 161 ? VAL A 170 ? HIS A 125 VAL A 134 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 158 ? N VAL A 122 O HIS A 161 ? O HIS A 125 AA1 2 3 N GLY A 166 ? N GLY A 130 O PHE A 177 ? O PHE A 141 AA1 3 4 N ASP A 180 ? N ASP A 144 O HIS A 192 ? O HIS A 156 AA1 4 5 N LEU A 189 ? N LEU A 153 O PHE A 209 ? O PHE A 173 AA1 5 6 O HIS A 210 ? O HIS A 174 N ARG A 83 ? N ARG A 47 AA1 6 7 N ILE A 84 ? N ILE A 48 O ALA A 99 ? O ALA A 63 AA1 7 8 N LEU A 106 ? N LEU A 70 O PHE A 111 ? O PHE A 75 AA1 8 9 N GLN A 116 ? N GLN A 80 O ALA A 125 ? O ALA A 89 AA1 9 10 N THR A 126 ? N THR A 90 O TYR A 143 ? O TYR A 107 AA1 10 11 N PHE A 138 ? N PHE A 102 O GLY A 154 ? O GLY A 118 AA1 11 12 N THR A 153 ? N THR A 117 O THR A 165 ? O THR A 129 # _atom_sites.entry_id 7SFP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018535 _atom_sites.fract_transf_matrix[1][2] 0.010701 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021402 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004080 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -35 ? ? ? A . n A 1 2 GLY 2 -34 ? ? ? A . n A 1 3 SER 3 -33 ? ? ? A . n A 1 4 SER 4 -32 ? ? ? A . n A 1 5 HIS 5 -31 ? ? ? A . n A 1 6 HIS 6 -30 ? ? ? A . n A 1 7 HIS 7 -29 ? ? ? A . n A 1 8 HIS 8 -28 ? ? ? A . n A 1 9 HIS 9 -27 ? ? ? A . n A 1 10 HIS 10 -26 ? ? ? A . n A 1 11 SER 11 -25 ? ? ? A . n A 1 12 SER 12 -24 ? ? ? A . n A 1 13 GLY 13 -23 ? ? ? A . n A 1 14 LEU 14 -22 ? ? ? A . n A 1 15 VAL 15 -21 ? ? ? A . n A 1 16 PRO 16 -20 ? ? ? A . n A 1 17 ARG 17 -19 ? ? ? A . n A 1 18 GLY 18 -18 ? ? ? A . n A 1 19 SER 19 -17 ? ? ? A . n A 1 20 HIS 20 -16 ? ? ? A . n A 1 21 MET 21 -15 ? ? ? A . n A 1 22 TRP 22 -14 ? ? ? A . n A 1 23 SER 23 -13 ? ? ? A . n A 1 24 HIS 24 -12 ? ? ? A . n A 1 25 PRO 25 -11 ? ? ? A . n A 1 26 GLN 26 -10 ? ? ? A . n A 1 27 PHE 27 -9 ? ? ? A . n A 1 28 GLU 28 -8 ? ? ? A . n A 1 29 LYS 29 -7 ? ? ? A . n A 1 30 GLU 30 -6 ? ? ? A . n A 1 31 ASN 31 -5 ? ? ? A . n A 1 32 LEU 32 -4 ? ? ? A . n A 1 33 TYR 33 -3 ? ? ? A . n A 1 34 PHE 34 -2 ? ? ? A . n A 1 35 GLN 35 -1 ? ? ? A . n A 1 36 SER 36 0 ? ? ? A . n A 1 37 MET 37 1 ? ? ? A . n A 1 38 SER 38 2 ? ? ? A . n A 1 39 ALA 39 3 ? ? ? A . n A 1 40 GLN 40 4 ? ? ? A . n A 1 41 PRO 41 5 ? ? ? A . n A 1 42 ILE 42 6 ? ? ? A . n A 1 43 GLN 43 7 ? ? ? A . n A 1 44 SER 44 8 ? ? ? A . n A 1 45 SER 45 9 ? ? ? A . n A 1 46 ASP 46 10 ? ? ? A . n A 1 47 ASP 47 11 ? ? ? A . n A 1 48 ALA 48 12 ? ? ? A . n A 1 49 LEU 49 13 ? ? ? A . n A 1 50 ARG 50 14 ? ? ? A . n A 1 51 ASP 51 15 ? ? ? A . n A 1 52 SER 52 16 ? ? ? A . n A 1 53 VAL 53 17 ? ? ? A . n A 1 54 PRO 54 18 ? ? ? A . n A 1 55 ALA 55 19 ? ? ? A . n A 1 56 GLU 56 20 ? ? ? A . n A 1 57 SER 57 21 ? ? ? A . n A 1 58 GLY 58 22 ? ? ? A . n A 1 59 GLU 59 23 ? ? ? A . n A 1 60 VAL 60 24 ? ? ? A . n A 1 61 ALA 61 25 ? ? ? A . n A 1 62 PHE 62 26 26 PHE PHE A . n A 1 63 PRO 63 27 27 PRO PRO A . n A 1 64 GLY 64 28 28 GLY GLY A . n A 1 65 ARG 65 29 29 ARG ARG A . n A 1 66 PRO 66 30 30 PRO PRO A . n A 1 67 ASP 67 31 31 ASP ASP A . n A 1 68 VAL 68 32 32 VAL VAL A . n A 1 69 ALA 69 33 33 ALA ALA A . n A 1 70 VAL 70 34 34 VAL VAL A . n A 1 71 GLU 71 35 35 GLU GLU A . n A 1 72 MET 72 36 36 MET MET A . n A 1 73 ARG 73 37 37 ARG ARG A . n A 1 74 GLN 74 38 38 GLN GLN A . n A 1 75 LEU 75 39 39 LEU LEU A . n A 1 76 ASP 76 40 40 ASP ASP A . n A 1 77 PHE 77 41 41 PHE PHE A . n A 1 78 LEU 78 42 42 LEU LEU A . n A 1 79 LEU 79 43 43 LEU LEU A . n A 1 80 GLY 80 44 44 GLY GLY A . n A 1 81 ASP 81 45 45 ASP ASP A . n A 1 82 PHE 82 46 46 PHE PHE A . n A 1 83 ARG 83 47 47 ARG ARG A . n A 1 84 ILE 84 48 48 ILE ILE A . n A 1 85 GLU 85 49 49 GLU GLU A . n A 1 86 TYR 86 50 50 TYR TYR A . n A 1 87 THR 87 51 51 THR THR A . n A 1 88 ASN 88 52 52 ASN ASN A . n A 1 89 LEU 89 53 53 LEU LEU A . n A 1 90 THR 90 54 54 THR THR A . n A 1 91 THR 91 55 55 THR THR A . n A 1 92 GLU 92 56 56 GLU GLU A . n A 1 93 THR 93 57 57 THR THR A . n A 1 94 VAL 94 58 58 VAL VAL A . n A 1 95 THR 95 59 59 THR THR A . n A 1 96 THR 96 60 60 THR THR A . n A 1 97 GLY 97 61 61 GLY GLY A . n A 1 98 GLU 98 62 62 GLU GLU A . n A 1 99 ALA 99 63 63 ALA ALA A . n A 1 100 THR 100 64 64 THR THR A . n A 1 101 CYS 101 65 65 CYS CYS A . n A 1 102 SER 102 66 66 SER SER A . n A 1 103 THR 103 67 67 THR THR A . n A 1 104 ARG 104 68 68 ARG ARG A . n A 1 105 PRO 105 69 69 PRO PRO A . n A 1 106 LEU 106 70 70 LEU LEU A . n A 1 107 ALA 107 71 71 ALA ALA A . n A 1 108 ASP 108 72 72 ASP ASP A . n A 1 109 GLY 109 73 73 GLY GLY A . n A 1 110 ARG 110 74 74 ARG ARG A . n A 1 111 PHE 111 75 75 PHE PHE A . n A 1 112 TYR 112 76 76 TYR TYR A . n A 1 113 GLU 113 77 77 GLU GLU A . n A 1 114 LEU 114 78 78 LEU LEU A . n A 1 115 THR 115 79 79 THR THR A . n A 1 116 GLN 116 80 80 GLN GLN A . n A 1 117 ARG 117 81 81 ARG ARG A . n A 1 118 VAL 118 82 82 VAL VAL A . n A 1 119 PRO 119 83 83 PRO PRO A . n A 1 120 VAL 120 84 84 VAL VAL A . n A 1 121 PRO 121 85 85 PRO PRO A . n A 1 122 GLY 122 86 86 GLY GLY A . n A 1 123 LEU 123 87 87 LEU LEU A . n A 1 124 VAL 124 88 88 VAL VAL A . n A 1 125 ALA 125 89 89 ALA ALA A . n A 1 126 THR 126 90 90 THR THR A . n A 1 127 TRP 127 91 91 TRP TRP A . n A 1 128 LEU 128 92 92 LEU LEU A . n A 1 129 ILE 129 93 93 ILE ILE A . n A 1 130 GLY 130 94 94 GLY GLY A . n A 1 131 TRP 131 95 95 TRP TRP A . n A 1 132 SER 132 96 96 SER SER A . n A 1 133 ASP 133 97 97 ASP ASP A . n A 1 134 VAL 134 98 98 VAL VAL A . n A 1 135 ASP 135 99 99 ASP ASP A . n A 1 136 ASN 136 100 100 ASN ASN A . n A 1 137 ARG 137 101 101 ARG ARG A . n A 1 138 PHE 138 102 102 PHE PHE A . n A 1 139 VAL 139 103 103 VAL VAL A . n A 1 140 SER 140 104 104 SER SER A . n A 1 141 PHE 141 105 105 PHE PHE A . n A 1 142 TYR 142 106 106 TYR TYR A . n A 1 143 TYR 143 107 107 TYR TYR A . n A 1 144 ASP 144 108 108 ASP ASP A . n A 1 145 ASP 145 109 109 ASP ASP A . n A 1 146 TRP 146 110 110 TRP TRP A . n A 1 147 GLY 147 111 111 GLY GLY A . n A 1 148 HIS 148 112 112 HIS HIS A . n A 1 149 HIS 149 113 113 HIS HIS A . n A 1 150 GLY 150 114 114 GLY GLY A . n A 1 151 ARG 151 115 115 ARG ARG A . n A 1 152 PHE 152 116 116 PHE PHE A . n A 1 153 THR 153 117 117 THR THR A . n A 1 154 GLY 154 118 118 GLY GLY A . n A 1 155 PRO 155 119 119 PRO PRO A . n A 1 156 GLY 156 120 120 GLY GLY A . n A 1 157 TRP 157 121 121 TRP TRP A . n A 1 158 VAL 158 122 122 VAL VAL A . n A 1 159 ASP 159 123 123 ASP ASP A . n A 1 160 GLY 160 124 124 GLY GLY A . n A 1 161 HIS 161 125 125 HIS HIS A . n A 1 162 PHE 162 126 126 PHE PHE A . n A 1 163 LYS 163 127 127 LYS LYS A . n A 1 164 LEU 164 128 128 LEU LEU A . n A 1 165 THR 165 129 129 THR THR A . n A 1 166 GLY 166 130 130 GLY GLY A . n A 1 167 ASP 167 131 131 ASP ASP A . n A 1 168 SER 168 132 132 SER SER A . n A 1 169 ALA 169 133 133 ALA ALA A . n A 1 170 VAL 170 134 134 VAL VAL A . n A 1 171 PHE 171 135 135 PHE PHE A . n A 1 172 GLY 172 136 136 GLY GLY A . n A 1 173 ALA 173 137 137 ALA ALA A . n A 1 174 ARG 174 138 138 ARG ARG A . n A 1 175 HIS 175 139 139 HIS HIS A . n A 1 176 GLY 176 140 140 GLY GLY A . n A 1 177 PHE 177 141 141 PHE PHE A . n A 1 178 VAL 178 142 142 VAL VAL A . n A 1 179 GLU 179 143 143 GLU GLU A . n A 1 180 ASP 180 144 144 ASP ASP A . n A 1 181 PHE 181 145 145 PHE PHE A . n A 1 182 GLU 182 146 146 GLU GLU A . n A 1 183 ILE 183 147 147 ILE ILE A . n A 1 184 VAL 184 148 148 VAL VAL A . n A 1 185 ASP 185 149 149 ASP ASP A . n A 1 186 SER 186 150 150 SER SER A . n A 1 187 ASP 187 151 151 ASP ASP A . n A 1 188 HIS 188 152 152 HIS HIS A . n A 1 189 LEU 189 153 153 LEU LEU A . n A 1 190 VAL 190 154 154 VAL VAL A . n A 1 191 LYS 191 155 155 LYS LYS A . n A 1 192 HIS 192 156 156 HIS HIS A . n A 1 193 GLY 193 157 157 GLY GLY A . n A 1 194 PHE 194 158 158 PHE PHE A . n A 1 195 VAL 195 159 159 VAL VAL A . n A 1 196 VAL 196 160 160 VAL VAL A . n A 1 197 VAL 197 161 161 VAL VAL A . n A 1 198 GLY 198 162 162 GLY GLY A . n A 1 199 ASP 199 163 163 ASP ASP A . n A 1 200 ASP 200 164 164 ASP ASP A . n A 1 201 LEU 201 165 165 LEU LEU A . n A 1 202 VAL 202 166 166 VAL VAL A . n A 1 203 PRO 203 167 167 PRO PRO A . n A 1 204 GLY 204 168 168 GLY GLY A . n A 1 205 ASP 205 169 169 ASP ASP A . n A 1 206 ILE 206 170 170 ILE ILE A . n A 1 207 LEU 207 171 171 LEU LEU A . n A 1 208 HIS 208 172 172 HIS HIS A . n A 1 209 PHE 209 173 173 PHE PHE A . n A 1 210 HIS 210 174 174 HIS HIS A . n A 1 211 ARG 211 175 175 ARG ARG A . n A 1 212 ILE 212 176 176 ILE ILE A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email mvbdias@usp.br _pdbx_contact_author.name_first Marcio _pdbx_contact_author.name_last Dias _pdbx_contact_author.name_mi 'V B' _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5312-0191 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 4 HOH HOH A . B 2 HOH 2 202 2 HOH HOH A . B 2 HOH 3 203 3 HOH HOH A . B 2 HOH 4 204 5 HOH HOH A . B 2 HOH 5 205 1 HOH HOH A . B 2 HOH 6 206 18 HOH HOH A . B 2 HOH 7 207 7 HOH HOH A . B 2 HOH 8 208 8 HOH HOH A . B 2 HOH 9 209 17 HOH HOH A . B 2 HOH 10 210 12 HOH HOH A . B 2 HOH 11 211 23 HOH HOH A . B 2 HOH 12 212 6 HOH HOH A . B 2 HOH 13 213 14 HOH HOH A . B 2 HOH 14 214 15 HOH HOH A . B 2 HOH 15 215 20 HOH HOH A . B 2 HOH 16 216 10 HOH HOH A . B 2 HOH 17 217 9 HOH HOH A . B 2 HOH 18 218 11 HOH HOH A . B 2 HOH 19 219 16 HOH HOH A . B 2 HOH 20 220 22 HOH HOH A . B 2 HOH 21 221 19 HOH HOH A . B 2 HOH 22 222 13 HOH HOH A . B 2 HOH 23 223 21 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 214 ? B HOH . 2 1 A HOH 217 ? B HOH . 3 1 A HOH 218 ? B HOH . 4 1 A HOH 223 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-17 2 'Structure model' 1 1 2022-08-24 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 37.9770 _pdbx_refine_tls.origin_y 88.3981 _pdbx_refine_tls.origin_z 256.9182 _pdbx_refine_tls.T[1][1] 0.4281 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.1397 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0228 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.3265 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0025 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2809 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.4650 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.3941 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.0138 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 4.7495 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.9063 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 5.4370 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0562 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.1147 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.2598 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0166 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.2508 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.1740 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.3626 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.4944 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1831 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 26 ? ? ? A 176 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? S 1 ? ? ? S 23 ? ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.3.11 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 18.1.3875 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 208 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 221 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 220 ? ? 1_555 O A HOH 222 ? ? 10_997 2.06 2 1 O A HOH 210 ? ? 1_555 O A HOH 216 ? ? 10_997 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 59 ? ? -60.61 -71.67 2 1 THR A 60 ? ? 61.22 139.25 3 1 ASP A 109 ? ? -79.79 22.77 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 56 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 THR _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 57 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 148.66 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 223 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 7.41 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 26 ? CG ? A PHE 62 CG 2 1 Y 1 A PHE 26 ? CD1 ? A PHE 62 CD1 3 1 Y 1 A PHE 26 ? CD2 ? A PHE 62 CD2 4 1 Y 1 A PHE 26 ? CE1 ? A PHE 62 CE1 5 1 Y 1 A PHE 26 ? CE2 ? A PHE 62 CE2 6 1 Y 1 A PHE 26 ? CZ ? A PHE 62 CZ 7 1 Y 1 A GLU 62 ? CG ? A GLU 98 CG 8 1 Y 1 A GLU 62 ? CD ? A GLU 98 CD 9 1 Y 1 A GLU 62 ? OE1 ? A GLU 98 OE1 10 1 Y 1 A GLU 62 ? OE2 ? A GLU 98 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -35 ? A MET 1 2 1 Y 1 A GLY -34 ? A GLY 2 3 1 Y 1 A SER -33 ? A SER 3 4 1 Y 1 A SER -32 ? A SER 4 5 1 Y 1 A HIS -31 ? A HIS 5 6 1 Y 1 A HIS -30 ? A HIS 6 7 1 Y 1 A HIS -29 ? A HIS 7 8 1 Y 1 A HIS -28 ? A HIS 8 9 1 Y 1 A HIS -27 ? A HIS 9 10 1 Y 1 A HIS -26 ? A HIS 10 11 1 Y 1 A SER -25 ? A SER 11 12 1 Y 1 A SER -24 ? A SER 12 13 1 Y 1 A GLY -23 ? A GLY 13 14 1 Y 1 A LEU -22 ? A LEU 14 15 1 Y 1 A VAL -21 ? A VAL 15 16 1 Y 1 A PRO -20 ? A PRO 16 17 1 Y 1 A ARG -19 ? A ARG 17 18 1 Y 1 A GLY -18 ? A GLY 18 19 1 Y 1 A SER -17 ? A SER 19 20 1 Y 1 A HIS -16 ? A HIS 20 21 1 Y 1 A MET -15 ? A MET 21 22 1 Y 1 A TRP -14 ? A TRP 22 23 1 Y 1 A SER -13 ? A SER 23 24 1 Y 1 A HIS -12 ? A HIS 24 25 1 Y 1 A PRO -11 ? A PRO 25 26 1 Y 1 A GLN -10 ? A GLN 26 27 1 Y 1 A PHE -9 ? A PHE 27 28 1 Y 1 A GLU -8 ? A GLU 28 29 1 Y 1 A LYS -7 ? A LYS 29 30 1 Y 1 A GLU -6 ? A GLU 30 31 1 Y 1 A ASN -5 ? A ASN 31 32 1 Y 1 A LEU -4 ? A LEU 32 33 1 Y 1 A TYR -3 ? A TYR 33 34 1 Y 1 A PHE -2 ? A PHE 34 35 1 Y 1 A GLN -1 ? A GLN 35 36 1 Y 1 A SER 0 ? A SER 36 37 1 Y 1 A MET 1 ? A MET 37 38 1 Y 1 A SER 2 ? A SER 38 39 1 Y 1 A ALA 3 ? A ALA 39 40 1 Y 1 A GLN 4 ? A GLN 40 41 1 Y 1 A PRO 5 ? A PRO 41 42 1 Y 1 A ILE 6 ? A ILE 42 43 1 Y 1 A GLN 7 ? A GLN 43 44 1 Y 1 A SER 8 ? A SER 44 45 1 Y 1 A SER 9 ? A SER 45 46 1 Y 1 A ASP 10 ? A ASP 46 47 1 Y 1 A ASP 11 ? A ASP 47 48 1 Y 1 A ALA 12 ? A ALA 48 49 1 Y 1 A LEU 13 ? A LEU 49 50 1 Y 1 A ARG 14 ? A ARG 50 51 1 Y 1 A ASP 15 ? A ASP 51 52 1 Y 1 A SER 16 ? A SER 52 53 1 Y 1 A VAL 17 ? A VAL 53 54 1 Y 1 A PRO 18 ? A PRO 54 55 1 Y 1 A ALA 19 ? A ALA 55 56 1 Y 1 A GLU 20 ? A GLU 56 57 1 Y 1 A SER 21 ? A SER 57 58 1 Y 1 A GLY 22 ? A GLY 58 59 1 Y 1 A GLU 23 ? A GLU 59 60 1 Y 1 A VAL 24 ? A VAL 60 61 1 Y 1 A ALA 25 ? A ALA 61 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Sao Paulo Research Foundation (FAPESP)' Brazil 18/00351-1 1 'Sao Paulo Research Foundation (FAPESP)' Brazil 20/03850-9 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7SFN _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? #