data_7SHH # _entry.id 7SHH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7SHH pdb_00007shh 10.2210/pdb7shh/pdb WWPDB D_1000260283 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-13 2 'Structure model' 1 1 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7SHH _pdbx_database_status.recvd_initial_deposition_date 2021-10-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 1 _pdbx_contact_author.email marcus.fischer@stjude.org _pdbx_contact_author.name_first Marcus _pdbx_contact_author.name_last Fischer _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7179-2581 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nithianantham, S.' 1 ? 'Fischer, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 475 _citation.page_last 482 _citation.title 'Development of Potent and Selective Janus Kinase 2/3 Directing PG-PROTACs.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.1c00650 _citation.pdbx_database_id_PubMed 35300081 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Alcock, L.J.' 1 ? primary 'Chang, Y.' 2 ? primary 'Jarusiewicz, J.A.' 3 ? primary 'Actis, M.' 4 ? primary 'Nithianantham, S.' 5 ? primary 'Mayasundari, A.' 6 ? primary 'Min, J.' 7 0000-0002-0083-3198 primary 'Maxwell, D.' 8 ? primary 'Hunt, J.' 9 ? primary 'Smart, B.' 10 ? primary 'Yang, J.J.' 11 ? primary 'Nishiguchi, G.' 12 ? primary 'Fischer, M.' 13 ? primary 'Mullighan, C.G.' 14 ? primary 'Rankovic, Z.' 15 0000-0001-6866-4290 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cereblon isoform 4' 13689.552 3 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 non-polymer syn '(3R)-3-(4-methoxyphenyl)piperidine-2,6-dione' 219.237 3 ? ? ? ? 4 water nat water 18.015 70 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMPLDAGGQNSTQMVLAPGASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRLIGAPSGEFSW FKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPAD ; _entity_poly.pdbx_seq_one_letter_code_can ;GMPLDAGGQNSTQMVLAPGASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRLIGAPSGEFSW FKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPAD ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '(3R)-3-(4-methoxyphenyl)piperidine-2,6-dione' 9FT 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 PRO n 1 4 LEU n 1 5 ASP n 1 6 ALA n 1 7 GLY n 1 8 GLY n 1 9 GLN n 1 10 ASN n 1 11 SER n 1 12 THR n 1 13 GLN n 1 14 MET n 1 15 VAL n 1 16 LEU n 1 17 ALA n 1 18 PRO n 1 19 GLY n 1 20 ALA n 1 21 SER n 1 22 ILE n 1 23 PHE n 1 24 ARG n 1 25 CYS n 1 26 ARG n 1 27 GLN n 1 28 CYS n 1 29 GLY n 1 30 GLN n 1 31 THR n 1 32 ILE n 1 33 SER n 1 34 ARG n 1 35 ARG n 1 36 ASP n 1 37 TRP n 1 38 LEU n 1 39 LEU n 1 40 PRO n 1 41 MET n 1 42 GLY n 1 43 GLY n 1 44 ASP n 1 45 HIS n 1 46 GLU n 1 47 HIS n 1 48 VAL n 1 49 VAL n 1 50 PHE n 1 51 ASN n 1 52 PRO n 1 53 ALA n 1 54 GLY n 1 55 MET n 1 56 ILE n 1 57 PHE n 1 58 ARG n 1 59 VAL n 1 60 TRP n 1 61 CYS n 1 62 PHE n 1 63 SER n 1 64 LEU n 1 65 ALA n 1 66 GLN n 1 67 GLY n 1 68 LEU n 1 69 ARG n 1 70 LEU n 1 71 ILE n 1 72 GLY n 1 73 ALA n 1 74 PRO n 1 75 SER n 1 76 GLY n 1 77 GLU n 1 78 PHE n 1 79 SER n 1 80 TRP n 1 81 PHE n 1 82 LYS n 1 83 GLY n 1 84 TYR n 1 85 ASP n 1 86 TRP n 1 87 THR n 1 88 ILE n 1 89 ALA n 1 90 LEU n 1 91 CYS n 1 92 GLY n 1 93 GLN n 1 94 CYS n 1 95 GLY n 1 96 SER n 1 97 HIS n 1 98 LEU n 1 99 GLY n 1 100 TRP n 1 101 HIS n 1 102 TYR n 1 103 GLU n 1 104 GLY n 1 105 GLY n 1 106 SER n 1 107 GLN n 1 108 PRO n 1 109 GLN n 1 110 THR n 1 111 PHE n 1 112 PHE n 1 113 GLY n 1 114 LEU n 1 115 ILE n 1 116 LYS n 1 117 ASP n 1 118 ARG n 1 119 LEU n 1 120 ALA n 1 121 GLU n 1 122 GLY n 1 123 PRO n 1 124 ALA n 1 125 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MGR_0879 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Magnetospirillum gryphiswaldense' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 55518 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9FT non-polymer . '(3R)-3-(4-methoxyphenyl)piperidine-2,6-dione' ? 'C12 H13 N O3' 219.237 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 PRO 3 2 ? ? ? A . n A 1 4 LEU 4 3 ? ? ? A . n A 1 5 ASP 5 4 ? ? ? A . n A 1 6 ALA 6 5 ? ? ? A . n A 1 7 GLY 7 6 ? ? ? A . n A 1 8 GLY 8 7 ? ? ? A . n A 1 9 GLN 9 8 ? ? ? A . n A 1 10 ASN 10 9 ? ? ? A . n A 1 11 SER 11 10 ? ? ? A . n A 1 12 THR 12 11 ? ? ? A . n A 1 13 GLN 13 12 ? ? ? A . n A 1 14 MET 14 13 ? ? ? A . n A 1 15 VAL 15 14 ? ? ? A . n A 1 16 LEU 16 15 ? ? ? A . n A 1 17 ALA 17 16 ? ? ? A . n A 1 18 PRO 18 17 ? ? ? A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 SER 21 20 20 SER SER A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 PHE 23 22 22 PHE PHE A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 CYS 25 24 24 CYS CYS A . n A 1 26 ARG 26 25 25 ARG ARG A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 CYS 28 27 27 CYS CYS A . n A 1 29 GLY 29 28 28 GLY GLY A . n A 1 30 GLN 30 29 29 GLN GLN A . n A 1 31 THR 31 30 30 THR THR A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 SER 33 32 32 SER SER A . n A 1 34 ARG 34 33 33 ARG ARG A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 ASP 36 35 35 ASP ASP A . n A 1 37 TRP 37 36 36 TRP TRP A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 PRO 40 39 39 PRO PRO A . n A 1 41 MET 41 40 40 MET MET A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 HIS 45 44 44 HIS HIS A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 HIS 47 46 46 HIS HIS A . n A 1 48 VAL 48 47 47 VAL VAL A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 PHE 50 49 49 PHE PHE A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 PRO 52 51 51 PRO PRO A . n A 1 53 ALA 53 52 52 ALA ALA A . n A 1 54 GLY 54 53 53 GLY GLY A . n A 1 55 MET 55 54 54 MET MET A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 PHE 57 56 56 PHE PHE A . n A 1 58 ARG 58 57 57 ARG ARG A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 TRP 60 59 59 TRP TRP A . n A 1 61 CYS 61 60 60 CYS CYS A . n A 1 62 PHE 62 61 61 PHE PHE A . n A 1 63 SER 63 62 62 SER SER A . n A 1 64 LEU 64 63 63 LEU LEU A . n A 1 65 ALA 65 64 64 ALA ALA A . n A 1 66 GLN 66 65 65 GLN GLN A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 LEU 68 67 67 LEU LEU A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 ILE 71 70 70 ILE ILE A . n A 1 72 GLY 72 71 71 GLY GLY A . n A 1 73 ALA 73 72 72 ALA ALA A . n A 1 74 PRO 74 73 73 PRO PRO A . n A 1 75 SER 75 74 74 SER SER A . n A 1 76 GLY 76 75 75 GLY GLY A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 PHE 78 77 77 PHE PHE A . n A 1 79 SER 79 78 78 SER SER A . n A 1 80 TRP 80 79 79 TRP TRP A . n A 1 81 PHE 81 80 80 PHE PHE A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 GLY 83 82 82 GLY GLY A . n A 1 84 TYR 84 83 83 TYR TYR A . n A 1 85 ASP 85 84 84 ASP ASP A . n A 1 86 TRP 86 85 85 TRP TRP A . n A 1 87 THR 87 86 86 THR THR A . n A 1 88 ILE 88 87 87 ILE ILE A . n A 1 89 ALA 89 88 88 ALA ALA A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 CYS 91 90 90 CYS CYS A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 GLN 93 92 92 GLN GLN A . n A 1 94 CYS 94 93 93 CYS CYS A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 HIS 97 96 96 HIS HIS A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 GLY 99 98 98 GLY GLY A . n A 1 100 TRP 100 99 99 TRP TRP A . n A 1 101 HIS 101 100 100 HIS HIS A . n A 1 102 TYR 102 101 101 TYR TYR A . n A 1 103 GLU 103 102 102 GLU GLU A . n A 1 104 GLY 104 103 103 GLY GLY A . n A 1 105 GLY 105 104 104 GLY GLY A . n A 1 106 SER 106 105 105 SER SER A . n A 1 107 GLN 107 106 106 GLN GLN A . n A 1 108 PRO 108 107 107 PRO PRO A . n A 1 109 GLN 109 108 108 GLN GLN A . n A 1 110 THR 110 109 109 THR THR A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 PHE 112 111 111 PHE PHE A . n A 1 113 GLY 113 112 112 GLY GLY A . n A 1 114 LEU 114 113 113 LEU LEU A . n A 1 115 ILE 115 114 114 ILE ILE A . n A 1 116 LYS 116 115 115 LYS LYS A . n A 1 117 ASP 117 116 116 ASP ASP A . n A 1 118 ARG 118 117 117 ARG ARG A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 ALA 120 119 119 ALA ALA A . n A 1 121 GLU 121 120 120 GLU GLU A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 PRO 123 122 122 PRO PRO A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 ASP 125 124 ? ? ? A . n B 1 1 GLY 1 0 ? ? ? B . n B 1 2 MET 2 1 ? ? ? B . n B 1 3 PRO 3 2 ? ? ? B . n B 1 4 LEU 4 3 ? ? ? B . n B 1 5 ASP 5 4 ? ? ? B . n B 1 6 ALA 6 5 ? ? ? B . n B 1 7 GLY 7 6 ? ? ? B . n B 1 8 GLY 8 7 ? ? ? B . n B 1 9 GLN 9 8 ? ? ? B . n B 1 10 ASN 10 9 ? ? ? B . n B 1 11 SER 11 10 ? ? ? B . n B 1 12 THR 12 11 ? ? ? B . n B 1 13 GLN 13 12 ? ? ? B . n B 1 14 MET 14 13 ? ? ? B . n B 1 15 VAL 15 14 ? ? ? B . n B 1 16 LEU 16 15 ? ? ? B . n B 1 17 ALA 17 16 ? ? ? B . n B 1 18 PRO 18 17 ? ? ? B . n B 1 19 GLY 19 18 ? ? ? B . n B 1 20 ALA 20 19 19 ALA ALA B . n B 1 21 SER 21 20 20 SER SER B . n B 1 22 ILE 22 21 21 ILE ILE B . n B 1 23 PHE 23 22 22 PHE PHE B . n B 1 24 ARG 24 23 23 ARG ARG B . n B 1 25 CYS 25 24 24 CYS CYS B . n B 1 26 ARG 26 25 25 ARG ARG B . n B 1 27 GLN 27 26 26 GLN GLN B . n B 1 28 CYS 28 27 27 CYS CYS B . n B 1 29 GLY 29 28 28 GLY GLY B . n B 1 30 GLN 30 29 29 GLN GLN B . n B 1 31 THR 31 30 30 THR THR B . n B 1 32 ILE 32 31 31 ILE ILE B . n B 1 33 SER 33 32 32 SER SER B . n B 1 34 ARG 34 33 33 ARG ARG B . n B 1 35 ARG 35 34 34 ARG ARG B . n B 1 36 ASP 36 35 35 ASP ASP B . n B 1 37 TRP 37 36 36 TRP TRP B . n B 1 38 LEU 38 37 37 LEU LEU B . n B 1 39 LEU 39 38 38 LEU LEU B . n B 1 40 PRO 40 39 39 PRO PRO B . n B 1 41 MET 41 40 40 MET MET B . n B 1 42 GLY 42 41 41 GLY GLY B . n B 1 43 GLY 43 42 42 GLY GLY B . n B 1 44 ASP 44 43 43 ASP ASP B . n B 1 45 HIS 45 44 44 HIS HIS B . n B 1 46 GLU 46 45 45 GLU GLU B . n B 1 47 HIS 47 46 46 HIS HIS B . n B 1 48 VAL 48 47 47 VAL VAL B . n B 1 49 VAL 49 48 48 VAL VAL B . n B 1 50 PHE 50 49 49 PHE PHE B . n B 1 51 ASN 51 50 50 ASN ASN B . n B 1 52 PRO 52 51 51 PRO PRO B . n B 1 53 ALA 53 52 52 ALA ALA B . n B 1 54 GLY 54 53 53 GLY GLY B . n B 1 55 MET 55 54 54 MET MET B . n B 1 56 ILE 56 55 55 ILE ILE B . n B 1 57 PHE 57 56 56 PHE PHE B . n B 1 58 ARG 58 57 57 ARG ARG B . n B 1 59 VAL 59 58 58 VAL VAL B . n B 1 60 TRP 60 59 59 TRP TRP B . n B 1 61 CYS 61 60 60 CYS CYS B . n B 1 62 PHE 62 61 61 PHE PHE B . n B 1 63 SER 63 62 62 SER SER B . n B 1 64 LEU 64 63 63 LEU LEU B . n B 1 65 ALA 65 64 64 ALA ALA B . n B 1 66 GLN 66 65 65 GLN GLN B . n B 1 67 GLY 67 66 66 GLY GLY B . n B 1 68 LEU 68 67 67 LEU LEU B . n B 1 69 ARG 69 68 68 ARG ARG B . n B 1 70 LEU 70 69 69 LEU LEU B . n B 1 71 ILE 71 70 70 ILE ILE B . n B 1 72 GLY 72 71 71 GLY GLY B . n B 1 73 ALA 73 72 72 ALA ALA B . n B 1 74 PRO 74 73 73 PRO PRO B . n B 1 75 SER 75 74 74 SER SER B . n B 1 76 GLY 76 75 75 GLY GLY B . n B 1 77 GLU 77 76 76 GLU GLU B . n B 1 78 PHE 78 77 77 PHE PHE B . n B 1 79 SER 79 78 78 SER SER B . n B 1 80 TRP 80 79 79 TRP TRP B . n B 1 81 PHE 81 80 80 PHE PHE B . n B 1 82 LYS 82 81 81 LYS LYS B . n B 1 83 GLY 83 82 82 GLY GLY B . n B 1 84 TYR 84 83 83 TYR TYR B . n B 1 85 ASP 85 84 84 ASP ASP B . n B 1 86 TRP 86 85 85 TRP TRP B . n B 1 87 THR 87 86 86 THR THR B . n B 1 88 ILE 88 87 87 ILE ILE B . n B 1 89 ALA 89 88 88 ALA ALA B . n B 1 90 LEU 90 89 89 LEU LEU B . n B 1 91 CYS 91 90 90 CYS CYS B . n B 1 92 GLY 92 91 91 GLY GLY B . n B 1 93 GLN 93 92 92 GLN GLN B . n B 1 94 CYS 94 93 93 CYS CYS B . n B 1 95 GLY 95 94 94 GLY GLY B . n B 1 96 SER 96 95 95 SER SER B . n B 1 97 HIS 97 96 96 HIS HIS B . n B 1 98 LEU 98 97 97 LEU LEU B . n B 1 99 GLY 99 98 98 GLY GLY B . n B 1 100 TRP 100 99 99 TRP TRP B . n B 1 101 HIS 101 100 100 HIS HIS B . n B 1 102 TYR 102 101 101 TYR TYR B . n B 1 103 GLU 103 102 102 GLU GLU B . n B 1 104 GLY 104 103 103 GLY GLY B . n B 1 105 GLY 105 104 104 GLY GLY B . n B 1 106 SER 106 105 105 SER SER B . n B 1 107 GLN 107 106 106 GLN GLN B . n B 1 108 PRO 108 107 107 PRO PRO B . n B 1 109 GLN 109 108 108 GLN GLN B . n B 1 110 THR 110 109 109 THR THR B . n B 1 111 PHE 111 110 110 PHE PHE B . n B 1 112 PHE 112 111 111 PHE PHE B . n B 1 113 GLY 113 112 112 GLY GLY B . n B 1 114 LEU 114 113 113 LEU LEU B . n B 1 115 ILE 115 114 114 ILE ILE B . n B 1 116 LYS 116 115 115 LYS LYS B . n B 1 117 ASP 117 116 116 ASP ASP B . n B 1 118 ARG 118 117 117 ARG ARG B . n B 1 119 LEU 119 118 118 LEU LEU B . n B 1 120 ALA 120 119 119 ALA ALA B . n B 1 121 GLU 121 120 120 GLU GLU B . n B 1 122 GLY 122 121 121 GLY GLY B . n B 1 123 PRO 123 122 122 PRO PRO B . n B 1 124 ALA 124 123 123 ALA ALA B . n B 1 125 ASP 125 124 ? ? ? B . n C 1 1 GLY 1 0 ? ? ? C . n C 1 2 MET 2 1 ? ? ? C . n C 1 3 PRO 3 2 ? ? ? C . n C 1 4 LEU 4 3 ? ? ? C . n C 1 5 ASP 5 4 ? ? ? C . n C 1 6 ALA 6 5 ? ? ? C . n C 1 7 GLY 7 6 ? ? ? C . n C 1 8 GLY 8 7 ? ? ? C . n C 1 9 GLN 9 8 ? ? ? C . n C 1 10 ASN 10 9 ? ? ? C . n C 1 11 SER 11 10 ? ? ? C . n C 1 12 THR 12 11 ? ? ? C . n C 1 13 GLN 13 12 ? ? ? C . n C 1 14 MET 14 13 ? ? ? C . n C 1 15 VAL 15 14 ? ? ? C . n C 1 16 LEU 16 15 ? ? ? C . n C 1 17 ALA 17 16 ? ? ? C . n C 1 18 PRO 18 17 ? ? ? C . n C 1 19 GLY 19 18 18 GLY GLY C . n C 1 20 ALA 20 19 19 ALA ALA C . n C 1 21 SER 21 20 20 SER SER C . n C 1 22 ILE 22 21 21 ILE ILE C . n C 1 23 PHE 23 22 22 PHE PHE C . n C 1 24 ARG 24 23 23 ARG ARG C . n C 1 25 CYS 25 24 24 CYS CYS C . n C 1 26 ARG 26 25 25 ARG ARG C . n C 1 27 GLN 27 26 26 GLN GLN C . n C 1 28 CYS 28 27 27 CYS CYS C . n C 1 29 GLY 29 28 28 GLY GLY C . n C 1 30 GLN 30 29 29 GLN GLN C . n C 1 31 THR 31 30 30 THR THR C . n C 1 32 ILE 32 31 31 ILE ILE C . n C 1 33 SER 33 32 32 SER SER C . n C 1 34 ARG 34 33 33 ARG ARG C . n C 1 35 ARG 35 34 34 ARG ARG C . n C 1 36 ASP 36 35 35 ASP ASP C . n C 1 37 TRP 37 36 36 TRP TRP C . n C 1 38 LEU 38 37 37 LEU LEU C . n C 1 39 LEU 39 38 38 LEU LEU C . n C 1 40 PRO 40 39 39 PRO PRO C . n C 1 41 MET 41 40 40 MET MET C . n C 1 42 GLY 42 41 ? ? ? C . n C 1 43 GLY 43 42 ? ? ? C . n C 1 44 ASP 44 43 ? ? ? C . n C 1 45 HIS 45 44 ? ? ? C . n C 1 46 GLU 46 45 45 GLU GLU C . n C 1 47 HIS 47 46 46 HIS HIS C . n C 1 48 VAL 48 47 47 VAL VAL C . n C 1 49 VAL 49 48 48 VAL VAL C . n C 1 50 PHE 50 49 49 PHE PHE C . n C 1 51 ASN 51 50 50 ASN ASN C . n C 1 52 PRO 52 51 51 PRO PRO C . n C 1 53 ALA 53 52 ? ? ? C . n C 1 54 GLY 54 53 53 GLY GLY C . n C 1 55 MET 55 54 54 MET MET C . n C 1 56 ILE 56 55 55 ILE ILE C . n C 1 57 PHE 57 56 56 PHE PHE C . n C 1 58 ARG 58 57 57 ARG ARG C . n C 1 59 VAL 59 58 58 VAL VAL C . n C 1 60 TRP 60 59 59 TRP TRP C . n C 1 61 CYS 61 60 60 CYS CYS C . n C 1 62 PHE 62 61 61 PHE PHE C . n C 1 63 SER 63 62 62 SER SER C . n C 1 64 LEU 64 63 63 LEU LEU C . n C 1 65 ALA 65 64 64 ALA ALA C . n C 1 66 GLN 66 65 65 GLN GLN C . n C 1 67 GLY 67 66 66 GLY GLY C . n C 1 68 LEU 68 67 67 LEU LEU C . n C 1 69 ARG 69 68 68 ARG ARG C . n C 1 70 LEU 70 69 69 LEU LEU C . n C 1 71 ILE 71 70 70 ILE ILE C . n C 1 72 GLY 72 71 71 GLY GLY C . n C 1 73 ALA 73 72 72 ALA ALA C . n C 1 74 PRO 74 73 73 PRO PRO C . n C 1 75 SER 75 74 74 SER SER C . n C 1 76 GLY 76 75 75 GLY GLY C . n C 1 77 GLU 77 76 76 GLU GLU C . n C 1 78 PHE 78 77 77 PHE PHE C . n C 1 79 SER 79 78 78 SER SER C . n C 1 80 TRP 80 79 79 TRP TRP C . n C 1 81 PHE 81 80 80 PHE PHE C . n C 1 82 LYS 82 81 81 LYS LYS C . n C 1 83 GLY 83 82 82 GLY GLY C . n C 1 84 TYR 84 83 83 TYR TYR C . n C 1 85 ASP 85 84 84 ASP ASP C . n C 1 86 TRP 86 85 85 TRP TRP C . n C 1 87 THR 87 86 86 THR THR C . n C 1 88 ILE 88 87 87 ILE ILE C . n C 1 89 ALA 89 88 88 ALA ALA C . n C 1 90 LEU 90 89 89 LEU LEU C . n C 1 91 CYS 91 90 90 CYS CYS C . n C 1 92 GLY 92 91 91 GLY GLY C . n C 1 93 GLN 93 92 92 GLN GLN C . n C 1 94 CYS 94 93 93 CYS CYS C . n C 1 95 GLY 95 94 94 GLY GLY C . n C 1 96 SER 96 95 95 SER SER C . n C 1 97 HIS 97 96 96 HIS HIS C . n C 1 98 LEU 98 97 97 LEU LEU C . n C 1 99 GLY 99 98 98 GLY GLY C . n C 1 100 TRP 100 99 99 TRP TRP C . n C 1 101 HIS 101 100 100 HIS HIS C . n C 1 102 TYR 102 101 101 TYR TYR C . n C 1 103 GLU 103 102 102 GLU GLU C . n C 1 104 GLY 104 103 103 GLY GLY C . n C 1 105 GLY 105 104 104 GLY GLY C . n C 1 106 SER 106 105 105 SER SER C . n C 1 107 GLN 107 106 ? ? ? C . n C 1 108 PRO 108 107 107 PRO PRO C . n C 1 109 GLN 109 108 108 GLN GLN C . n C 1 110 THR 110 109 109 THR THR C . n C 1 111 PHE 111 110 110 PHE PHE C . n C 1 112 PHE 112 111 111 PHE PHE C . n C 1 113 GLY 113 112 112 GLY GLY C . n C 1 114 LEU 114 113 113 LEU LEU C . n C 1 115 ILE 115 114 114 ILE ILE C . n C 1 116 LYS 116 115 115 LYS LYS C . n C 1 117 ASP 117 116 116 ASP ASP C . n C 1 118 ARG 118 117 117 ARG ARG C . n C 1 119 LEU 119 118 118 LEU LEU C . n C 1 120 ALA 120 119 119 ALA ALA C . n C 1 121 GLU 121 120 120 GLU GLU C . n C 1 122 GLY 122 121 121 GLY GLY C . n C 1 123 PRO 123 122 122 PRO PRO C . n C 1 124 ALA 124 123 123 ALA ALA C . n C 1 125 ASP 125 124 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 ZN 1 201 150 ZN ZN A . E 3 9FT 1 202 301 9FT PG1 A . F 2 ZN 1 201 150 ZN ZN B . G 3 9FT 1 202 201 9FT PG1 B . H 2 ZN 1 201 150 ZN ZN C . I 3 9FT 1 202 201 9FT PG1 C . J 4 HOH 1 301 23 HOH HOH A . J 4 HOH 2 302 17 HOH HOH A . J 4 HOH 3 303 20 HOH HOH A . J 4 HOH 4 304 14 HOH HOH A . J 4 HOH 5 305 54 HOH HOH A . J 4 HOH 6 306 11 HOH HOH A . J 4 HOH 7 307 9 HOH HOH A . J 4 HOH 8 308 31 HOH HOH A . J 4 HOH 9 309 25 HOH HOH A . J 4 HOH 10 310 6 HOH HOH A . J 4 HOH 11 311 5 HOH HOH A . J 4 HOH 12 312 57 HOH HOH A . J 4 HOH 13 313 59 HOH HOH A . J 4 HOH 14 314 28 HOH HOH A . J 4 HOH 15 315 47 HOH HOH A . J 4 HOH 16 316 13 HOH HOH A . J 4 HOH 17 317 53 HOH HOH A . J 4 HOH 18 318 12 HOH HOH A . J 4 HOH 19 319 22 HOH HOH A . J 4 HOH 20 320 32 HOH HOH A . J 4 HOH 21 321 26 HOH HOH A . J 4 HOH 22 322 38 HOH HOH A . J 4 HOH 23 323 61 HOH HOH A . J 4 HOH 24 324 56 HOH HOH A . J 4 HOH 25 325 39 HOH HOH A . J 4 HOH 26 326 41 HOH HOH A . J 4 HOH 27 327 66 HOH HOH A . J 4 HOH 28 328 58 HOH HOH A . J 4 HOH 29 329 49 HOH HOH A . J 4 HOH 30 330 60 HOH HOH A . J 4 HOH 31 331 42 HOH HOH A . K 4 HOH 1 301 1 HOH HOH B . K 4 HOH 2 302 51 HOH HOH B . K 4 HOH 3 303 43 HOH HOH B . K 4 HOH 4 304 37 HOH HOH B . K 4 HOH 5 305 18 HOH HOH B . K 4 HOH 6 306 35 HOH HOH B . K 4 HOH 7 307 29 HOH HOH B . K 4 HOH 8 308 36 HOH HOH B . K 4 HOH 9 309 55 HOH HOH B . K 4 HOH 10 310 4 HOH HOH B . K 4 HOH 11 311 68 HOH HOH B . K 4 HOH 12 312 44 HOH HOH B . K 4 HOH 13 313 2 HOH HOH B . K 4 HOH 14 314 16 HOH HOH B . K 4 HOH 15 315 3 HOH HOH B . K 4 HOH 16 316 10 HOH HOH B . K 4 HOH 17 317 48 HOH HOH B . K 4 HOH 18 318 7 HOH HOH B . K 4 HOH 19 319 52 HOH HOH B . K 4 HOH 20 320 15 HOH HOH B . K 4 HOH 21 321 27 HOH HOH B . K 4 HOH 22 322 33 HOH HOH B . K 4 HOH 23 323 34 HOH HOH B . K 4 HOH 24 324 67 HOH HOH B . K 4 HOH 25 325 24 HOH HOH B . K 4 HOH 26 326 62 HOH HOH B . K 4 HOH 27 327 8 HOH HOH B . K 4 HOH 28 328 40 HOH HOH B . K 4 HOH 29 329 45 HOH HOH B . K 4 HOH 30 330 65 HOH HOH B . K 4 HOH 31 331 64 HOH HOH B . K 4 HOH 32 332 69 HOH HOH B . K 4 HOH 33 333 63 HOH HOH B . L 4 HOH 1 301 50 HOH HOH C . L 4 HOH 2 302 19 HOH HOH C . L 4 HOH 3 303 21 HOH HOH C . L 4 HOH 4 304 30 HOH HOH C . L 4 HOH 5 305 70 HOH HOH C . L 4 HOH 6 306 46 HOH HOH C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 57 ? NE ? A ARG 58 NE 2 1 Y 1 A ARG 57 ? CZ ? A ARG 58 CZ 3 1 Y 1 A ARG 57 ? NH1 ? A ARG 58 NH1 4 1 Y 1 A ARG 57 ? NH2 ? A ARG 58 NH2 5 1 Y 1 A GLN 106 ? CG ? A GLN 107 CG 6 1 Y 1 A GLN 106 ? CD ? A GLN 107 CD 7 1 Y 1 A GLN 106 ? OE1 ? A GLN 107 OE1 8 1 Y 1 A GLN 106 ? NE2 ? A GLN 107 NE2 9 1 Y 1 A LYS 115 ? CD ? A LYS 116 CD 10 1 Y 1 A LYS 115 ? CE ? A LYS 116 CE 11 1 Y 1 A LYS 115 ? NZ ? A LYS 116 NZ 12 1 Y 1 B LYS 81 ? CG ? B LYS 82 CG 13 1 Y 1 B LYS 81 ? CD ? B LYS 82 CD 14 1 Y 1 B LYS 81 ? CE ? B LYS 82 CE 15 1 Y 1 B LYS 81 ? NZ ? B LYS 82 NZ 16 1 Y 1 B GLN 106 ? CG ? B GLN 107 CG 17 1 Y 1 B GLN 106 ? CD ? B GLN 107 CD 18 1 Y 1 B GLN 106 ? OE1 ? B GLN 107 OE1 19 1 Y 1 B GLN 106 ? NE2 ? B GLN 107 NE2 20 1 Y 1 C ARG 33 ? NE ? C ARG 34 NE 21 1 Y 1 C ARG 33 ? CZ ? C ARG 34 CZ 22 1 Y 1 C ARG 33 ? NH1 ? C ARG 34 NH1 23 1 Y 1 C ARG 33 ? NH2 ? C ARG 34 NH2 24 1 Y 1 C ARG 34 ? CG ? C ARG 35 CG 25 1 Y 1 C ARG 34 ? CD ? C ARG 35 CD 26 1 Y 1 C ARG 34 ? NE ? C ARG 35 NE 27 1 Y 1 C ARG 34 ? CZ ? C ARG 35 CZ 28 1 Y 1 C ARG 34 ? NH1 ? C ARG 35 NH1 29 1 Y 1 C ARG 34 ? NH2 ? C ARG 35 NH2 30 1 Y 1 C PRO 39 ? CG ? C PRO 40 CG 31 1 Y 1 C PRO 39 ? CD ? C PRO 40 CD 32 1 Y 1 C GLU 45 ? CG ? C GLU 46 CG 33 1 Y 1 C GLU 45 ? CD ? C GLU 46 CD 34 1 Y 1 C GLU 45 ? OE1 ? C GLU 46 OE1 35 1 Y 1 C GLU 45 ? OE2 ? C GLU 46 OE2 36 1 Y 1 C PHE 49 ? CG ? C PHE 50 CG 37 1 Y 1 C PHE 49 ? CD1 ? C PHE 50 CD1 38 1 Y 1 C PHE 49 ? CD2 ? C PHE 50 CD2 39 1 Y 1 C PHE 49 ? CE1 ? C PHE 50 CE1 40 1 Y 1 C PHE 49 ? CE2 ? C PHE 50 CE2 41 1 Y 1 C PHE 49 ? CZ ? C PHE 50 CZ 42 1 Y 1 C MET 54 ? CG ? C MET 55 CG 43 1 Y 1 C MET 54 ? SD ? C MET 55 SD 44 1 Y 1 C MET 54 ? CE ? C MET 55 CE 45 1 Y 1 C ARG 57 ? CG ? C ARG 58 CG 46 1 Y 1 C ARG 57 ? CD ? C ARG 58 CD 47 1 Y 1 C ARG 57 ? NE ? C ARG 58 NE 48 1 Y 1 C ARG 57 ? CZ ? C ARG 58 CZ 49 1 Y 1 C ARG 57 ? NH1 ? C ARG 58 NH1 50 1 Y 1 C ARG 57 ? NH2 ? C ARG 58 NH2 51 1 Y 1 C GLU 76 ? CG ? C GLU 77 CG 52 1 Y 1 C GLU 76 ? CD ? C GLU 77 CD 53 1 Y 1 C GLU 76 ? OE1 ? C GLU 77 OE1 54 1 Y 1 C GLU 76 ? OE2 ? C GLU 77 OE2 55 1 Y 1 C PHE 77 ? CG ? C PHE 78 CG 56 1 Y 1 C PHE 77 ? CD1 ? C PHE 78 CD1 57 1 Y 1 C PHE 77 ? CD2 ? C PHE 78 CD2 58 1 Y 1 C PHE 77 ? CE1 ? C PHE 78 CE1 59 1 Y 1 C PHE 77 ? CE2 ? C PHE 78 CE2 60 1 Y 1 C PHE 77 ? CZ ? C PHE 78 CZ 61 1 Y 1 C LYS 81 ? CG ? C LYS 82 CG 62 1 Y 1 C LYS 81 ? CD ? C LYS 82 CD 63 1 Y 1 C LYS 81 ? CE ? C LYS 82 CE 64 1 Y 1 C LYS 81 ? NZ ? C LYS 82 NZ 65 1 Y 1 C LYS 115 ? CG ? C LYS 116 CG 66 1 Y 1 C LYS 115 ? CD ? C LYS 116 CD 67 1 Y 1 C LYS 115 ? CE ? C LYS 116 CE 68 1 Y 1 C LYS 115 ? NZ ? C LYS 116 NZ 69 1 Y 1 C GLU 120 ? CG ? C GLU 121 CG 70 1 Y 1 C GLU 120 ? CD ? C GLU 121 CD 71 1 Y 1 C GLU 120 ? OE1 ? C GLU 121 OE1 72 1 Y 1 C GLU 120 ? OE2 ? C GLU 121 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 0.7.4 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7SHH _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.311 _cell.length_a_esd ? _cell.length_b 59.586 _cell.length_b_esd ? _cell.length_c 87.706 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7SHH _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7SHH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0. 1M sodium acetate and 16% PEG 6000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-07-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 35.080 _reflns.entry_id 7SHH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 56.310 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23597 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.200 _reflns.pdbx_Rmerge_I_obs 0.083 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.086 _reflns.pdbx_Rpim_I_all 0.024 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 311502 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.900 1.940 ? ? 20760 ? ? ? 1476 98.300 ? ? ? ? 1.104 ? ? ? ? ? ? ? ? 14.100 ? ? ? 2.600 1.145 0.302 ? 1 1 0.843 ? ? ? ? ? ? ? ? ? ? 9.110 56.310 ? ? 2772 ? ? ? 266 99.300 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 10.400 ? ? ? 41.900 0.049 0.014 ? 2 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 137.530 _refine.B_iso_mean 52.6615 _refine.B_iso_min 23.250 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7SHH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9000 _refine.ls_d_res_low 49.2870 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23555 _refine.ls_number_reflns_R_free 1242 _refine.ls_number_reflns_R_work 22313 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.5400 _refine.ls_percent_reflns_R_free 5.2700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1927 _refine.ls_R_factor_R_free 0.2161 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1915 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.3300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9000 _refine_hist.d_res_low 49.2870 _refine_hist.number_atoms_solvent 70 _refine_hist.number_atoms_total 2498 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 311 _refine_hist.pdbx_B_iso_mean_ligand 50.38 _refine_hist.pdbx_B_iso_mean_solvent 49.72 _refine_hist.pdbx_number_atoms_protein 2377 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 51 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 2594 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.807 ? 3536 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 349 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 459 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 3.504 ? 1914 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1104 11.671 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1104 11.671 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 1104 11.671 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9000 1.9761 . . 122 2425 98.0000 . . . 0.2690 0.0000 0.2594 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9761 2.0660 . . 159 2407 98.0000 . . . 0.2789 0.0000 0.2369 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0660 2.1750 . . 132 2466 99.0000 . . . 0.2761 0.0000 0.2168 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1750 2.3112 . . 148 2389 97.0000 . . . 0.2384 0.0000 0.2114 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3112 2.4897 . . 125 2490 99.0000 . . . 0.2345 0.0000 0.1996 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4897 2.7402 . . 125 2501 99.0000 . . . 0.2232 0.0000 0.1976 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7402 3.1367 . . 149 2500 99.0000 . . . 0.2283 0.0000 0.1934 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1367 3.9516 . . 117 2523 99.0000 . . . 0.2085 0.0000 0.1724 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9516 49.287 . . 165 2612 98.0000 . . . 0.1890 0.0000 0.1837 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 301)) ; 1 2 ;(chain B and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 201)) ; 1 3 ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A ALA 20 . A GLY 29 . A ALA 19 A GLY 28 ? ;(chain A and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 301)) ; 1 1 2 A THR 31 . A SER 33 . A THR 30 A SER 32 ? ;(chain A and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 301)) ; 1 1 3 A ARG 34 . A ARG 34 . A ARG 33 A ARG 33 ? ;(chain A and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 301)) ; 1 1 4 A GLY 19 . A ALA 124 . A GLY 18 A ALA 123 ? ;(chain A and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 301)) ; 1 1 5 A GLY 19 . A ALA 124 . A GLY 18 A ALA 123 ? ;(chain A and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 301)) ; 1 1 6 A GLY 19 . A ALA 124 . A GLY 18 A ALA 123 ? ;(chain A and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 301)) ; 1 1 7 A GLY 19 . A ALA 124 . A GLY 18 A ALA 123 ? ;(chain A and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 301)) ; 1 2 1 B ALA 20 . B GLY 29 . B ALA 19 B GLY 28 ? ;(chain B and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 201)) ; 1 2 2 B THR 31 . B SER 33 . B THR 30 B SER 32 ? ;(chain B and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 201)) ; 1 2 3 B ARG 34 . B ARG 34 . B ARG 33 B ARG 33 ? ;(chain B and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 201)) ; 1 2 4 B ALA 20 . B ALA 124 . B ALA 19 B ALA 123 ? ;(chain B and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 201)) ; 1 2 5 B ALA 20 . B ALA 124 . B ALA 19 B ALA 123 ? ;(chain B and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 201)) ; 1 2 6 B ALA 20 . B ALA 124 . B ALA 19 B ALA 123 ? ;(chain B and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 201)) ; 1 2 7 B ALA 20 . B ALA 124 . B ALA 19 B ALA 123 ? ;(chain B and (resid 19 through 28 or resid 30 through 32 or (resid 33 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 38 or resid 40 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 53 or resid 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 61 or resid 63 through 67 or resid 69 or resid 71 through 75 or (resid 76 through 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 85 or resid 87 through 108 or resid 110 through 114 or (resid 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 123 or resid 201)) ; 1 3 1 C ALA 20 . C GLY 29 . C ALA 19 C GLY 28 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 2 C THR 31 . C LEU 39 . C THR 30 C LEU 38 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 3 C MET 41 . C GLY 54 . C MET 40 C GLY 53 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 4 C PHE 57 . C PHE 62 . C PHE 56 C PHE 61 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 5 C LEU 64 . C LEU 68 . C LEU 63 C LEU 67 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 6 C LEU 70 . C LEU 70 . C LEU 69 C LEU 69 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 7 C GLY 72 . C TRP 86 . C GLY 71 C TRP 85 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 8 C ILE 88 . C GLN 109 . C ILE 87 C GLN 108 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 9 C PHE 111 . C ALA 124 . C PHE 110 C ALA 123 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; 1 3 10 H ZN . . H ZN . . C ZN 201 C ZN 201 ? ;(chain C and (resid 19 through 28 or resid 30 through 38 or resid 40 through 53 or resid 56 through 61 or resid 63 through 67 or resid 69 or resid 71 through 85 or resid 87 through 108 or resid 110 through 123 or resid 201)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7SHH _struct.title 'Bacterial cereblon homologue in complex with (R)-3-(4-methoxyphenyl)piperidine-2,6-dione' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7SHH _struct_keywords.text 'Cereblon, PROTAC, targeted protein degradation, TBD, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 2 ? G N N 3 ? H N N 2 ? I N N 3 ? J N N 4 ? K N N 4 ? L N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4TVL0_9PROT _struct_ref.pdbx_db_accession A4TVL0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPLDAGGQNSTQMVLAPGASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRLIGAPSGEFSWF KGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPAD ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7SHH A 2 ? 125 ? A4TVL0 1 ? 124 ? 1 124 2 1 7SHH B 2 ? 125 ? A4TVL0 1 ? 124 ? 1 124 3 1 7SHH C 2 ? 125 ? A4TVL0 1 ? 124 ? 1 124 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7SHH GLY A 1 ? UNP A4TVL0 ? ? 'expression tag' 0 1 2 7SHH GLY B 1 ? UNP A4TVL0 ? ? 'expression tag' 0 2 3 7SHH GLY C 1 ? UNP A4TVL0 ? ? 'expression tag' 0 3 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 3 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D,E,J 2 1 B,F,G,K 3 1 C,H,I,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 36 ? LEU A 38 ? ASP A 35 LEU A 37 5 ? 3 HELX_P HELX_P2 AA2 ASP B 36 ? LEU B 38 ? ASP B 35 LEU B 37 5 ? 3 HELX_P HELX_P3 AA3 PRO B 40 ? ASP B 44 ? PRO B 39 ASP B 43 5 ? 5 HELX_P HELX_P4 AA4 ASP C 36 ? LEU C 38 ? ASP C 35 LEU C 37 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 25 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 24 A ZN 201 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc2 metalc ? ? A CYS 28 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 27 A ZN 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc3 metalc ? ? A CYS 91 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 90 A ZN 201 1_555 ? ? ? ? ? ? ? 2.345 ? ? metalc4 metalc ? ? A CYS 94 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 93 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc5 metalc ? ? B CYS 25 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 24 B ZN 201 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc6 metalc ? ? B CYS 28 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 27 B ZN 201 1_555 ? ? ? ? ? ? ? 2.276 ? ? metalc7 metalc ? ? B CYS 91 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 90 B ZN 201 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc8 metalc ? ? B CYS 94 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 93 B ZN 201 1_555 ? ? ? ? ? ? ? 2.280 ? ? metalc9 metalc ? ? C CYS 25 SG ? ? ? 1_555 H ZN . ZN ? ? C CYS 24 C ZN 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc10 metalc ? ? C CYS 28 SG ? ? ? 1_555 H ZN . ZN ? ? C CYS 27 C ZN 201 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc11 metalc ? ? C CYS 91 SG ? ? ? 1_555 H ZN . ZN ? ? C CYS 90 C ZN 201 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc12 metalc ? ? C CYS 94 SG ? ? ? 1_555 H ZN . ZN ? ? C CYS 93 C ZN 201 1_555 ? ? ? ? ? ? ? 2.355 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 25 ? A CYS 24 ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 SG ? A CYS 28 ? A CYS 27 ? 1_555 112.9 ? 2 SG ? A CYS 25 ? A CYS 24 ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 SG ? A CYS 91 ? A CYS 90 ? 1_555 107.4 ? 3 SG ? A CYS 28 ? A CYS 27 ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 SG ? A CYS 91 ? A CYS 90 ? 1_555 101.3 ? 4 SG ? A CYS 25 ? A CYS 24 ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 93 ? 1_555 109.8 ? 5 SG ? A CYS 28 ? A CYS 27 ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 93 ? 1_555 113.2 ? 6 SG ? A CYS 91 ? A CYS 90 ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 SG ? A CYS 94 ? A CYS 93 ? 1_555 111.8 ? 7 SG ? B CYS 25 ? B CYS 24 ? 1_555 ZN ? F ZN . ? B ZN 201 ? 1_555 SG ? B CYS 28 ? B CYS 27 ? 1_555 113.8 ? 8 SG ? B CYS 25 ? B CYS 24 ? 1_555 ZN ? F ZN . ? B ZN 201 ? 1_555 SG ? B CYS 91 ? B CYS 90 ? 1_555 110.7 ? 9 SG ? B CYS 28 ? B CYS 27 ? 1_555 ZN ? F ZN . ? B ZN 201 ? 1_555 SG ? B CYS 91 ? B CYS 90 ? 1_555 103.5 ? 10 SG ? B CYS 25 ? B CYS 24 ? 1_555 ZN ? F ZN . ? B ZN 201 ? 1_555 SG ? B CYS 94 ? B CYS 93 ? 1_555 102.2 ? 11 SG ? B CYS 28 ? B CYS 27 ? 1_555 ZN ? F ZN . ? B ZN 201 ? 1_555 SG ? B CYS 94 ? B CYS 93 ? 1_555 114.2 ? 12 SG ? B CYS 91 ? B CYS 90 ? 1_555 ZN ? F ZN . ? B ZN 201 ? 1_555 SG ? B CYS 94 ? B CYS 93 ? 1_555 112.9 ? 13 SG ? C CYS 25 ? C CYS 24 ? 1_555 ZN ? H ZN . ? C ZN 201 ? 1_555 SG ? C CYS 28 ? C CYS 27 ? 1_555 115.5 ? 14 SG ? C CYS 25 ? C CYS 24 ? 1_555 ZN ? H ZN . ? C ZN 201 ? 1_555 SG ? C CYS 91 ? C CYS 90 ? 1_555 109.8 ? 15 SG ? C CYS 28 ? C CYS 27 ? 1_555 ZN ? H ZN . ? C ZN 201 ? 1_555 SG ? C CYS 91 ? C CYS 90 ? 1_555 100.4 ? 16 SG ? C CYS 25 ? C CYS 24 ? 1_555 ZN ? H ZN . ? C ZN 201 ? 1_555 SG ? C CYS 94 ? C CYS 93 ? 1_555 105.4 ? 17 SG ? C CYS 28 ? C CYS 27 ? 1_555 ZN ? H ZN . ? C ZN 201 ? 1_555 SG ? C CYS 94 ? C CYS 93 ? 1_555 111.1 ? 18 SG ? C CYS 91 ? C CYS 90 ? 1_555 ZN ? H ZN . ? C ZN 201 ? 1_555 SG ? C CYS 94 ? C CYS 93 ? 1_555 114.9 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 107 A . ? GLN 106 A PRO 108 A ? PRO 107 A 1 9.51 2 GLN 107 B . ? GLN 106 B PRO 108 B ? PRO 107 B 1 -0.84 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 6 ? AA3 ? 3 ? AA4 ? 6 ? AA5 ? 3 ? AA6 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA6 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 31 ? ARG A 34 ? THR A 30 ARG A 33 AA1 2 ILE A 22 ? CYS A 25 ? ILE A 21 CYS A 24 AA1 3 LEU A 119 ? GLY A 122 ? LEU A 118 GLY A 121 AA2 1 GLU A 46 ? PHE A 50 ? GLU A 45 PHE A 49 AA2 2 ILE A 56 ? PHE A 62 ? ILE A 55 PHE A 61 AA2 3 PHE A 111 ? ILE A 115 ? PHE A 110 ILE A 114 AA2 4 HIS A 97 ? GLU A 103 ? HIS A 96 GLU A 102 AA2 5 ASP A 85 ? CYS A 91 ? ASP A 84 CYS A 90 AA2 6 LEU A 68 ? SER A 75 ? LEU A 67 SER A 74 AA3 1 THR B 31 ? ARG B 34 ? THR B 30 ARG B 33 AA3 2 SER B 21 ? CYS B 25 ? SER B 20 CYS B 24 AA3 3 LEU B 119 ? PRO B 123 ? LEU B 118 PRO B 122 AA4 1 GLU B 46 ? PHE B 50 ? GLU B 45 PHE B 49 AA4 2 ILE B 56 ? PHE B 62 ? ILE B 55 PHE B 61 AA4 3 PHE B 111 ? ILE B 115 ? PHE B 110 ILE B 114 AA4 4 HIS B 97 ? GLU B 103 ? HIS B 96 GLU B 102 AA4 5 ASP B 85 ? CYS B 91 ? ASP B 84 CYS B 90 AA4 6 LEU B 68 ? SER B 75 ? LEU B 67 SER B 74 AA5 1 THR C 31 ? ARG C 34 ? THR C 30 ARG C 33 AA5 2 ILE C 22 ? CYS C 25 ? ILE C 21 CYS C 24 AA5 3 LEU C 119 ? GLY C 122 ? LEU C 118 GLY C 121 AA6 1 HIS C 47 ? PHE C 50 ? HIS C 46 PHE C 49 AA6 2 ILE C 56 ? PHE C 62 ? ILE C 55 PHE C 61 AA6 3 PHE C 111 ? ILE C 115 ? PHE C 110 ILE C 114 AA6 4 HIS C 97 ? GLU C 103 ? HIS C 96 GLU C 102 AA6 5 ASP C 85 ? CYS C 91 ? ASP C 84 CYS C 90 AA6 6 LEU C 68 ? SER C 75 ? LEU C 67 SER C 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O SER A 33 ? O SER A 32 N PHE A 23 ? N PHE A 22 AA1 2 3 N ILE A 22 ? N ILE A 21 O GLY A 122 ? O GLY A 121 AA2 1 2 N HIS A 47 ? N HIS A 46 O VAL A 59 ? O VAL A 58 AA2 2 3 N TRP A 60 ? N TRP A 59 O LEU A 114 ? O LEU A 113 AA2 3 4 O PHE A 111 ? O PHE A 110 N TYR A 102 ? N TYR A 101 AA2 4 5 O GLU A 103 ? O GLU A 102 N ASP A 85 ? N ASP A 84 AA2 5 6 O TRP A 86 ? O TRP A 85 N SER A 75 ? N SER A 74 AA3 1 2 O SER B 33 ? O SER B 32 N PHE B 23 ? N PHE B 22 AA3 2 3 N ILE B 22 ? N ILE B 21 O GLY B 122 ? O GLY B 121 AA4 1 2 N HIS B 47 ? N HIS B 46 O VAL B 59 ? O VAL B 58 AA4 2 3 N PHE B 62 ? N PHE B 61 O PHE B 112 ? O PHE B 111 AA4 3 4 O PHE B 111 ? O PHE B 110 N TYR B 102 ? N TYR B 101 AA4 4 5 O HIS B 101 ? O HIS B 100 N THR B 87 ? N THR B 86 AA4 5 6 O TRP B 86 ? O TRP B 85 N SER B 75 ? N SER B 74 AA5 1 2 O SER C 33 ? O SER C 32 N PHE C 23 ? N PHE C 22 AA5 2 3 N ARG C 24 ? N ARG C 23 O ALA C 120 ? O ALA C 119 AA6 1 2 N VAL C 49 ? N VAL C 48 O PHE C 57 ? O PHE C 56 AA6 2 3 N PHE C 62 ? N PHE C 61 O PHE C 112 ? O PHE C 111 AA6 3 4 O PHE C 111 ? O PHE C 110 N TYR C 102 ? N TYR C 101 AA6 4 5 O HIS C 101 ? O HIS C 100 N THR C 87 ? N THR C 86 AA6 5 6 O TRP C 86 ? O TRP C 85 N SER C 75 ? N SER C 74 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 19 ? ? -150.84 61.47 2 1 SER B 105 ? ? -135.17 -39.27 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 16.5924 16.2936 10.0286 0.2636 ? -0.0274 ? 0.0092 ? 0.3199 ? -0.0370 ? 0.2899 ? 6.1972 ? 1.3122 ? 1.1947 ? 5.0178 ? -0.8078 ? 3.6481 ? 0.0366 ? 0.0320 ? -0.6636 ? -0.1301 ? 0.1368 ? 0.1036 ? 0.3214 ? -0.4546 ? -0.1214 ? 2 'X-RAY DIFFRACTION' ? refined 25.7684 12.4980 -0.8918 0.3146 ? 0.0701 ? -0.0431 ? 0.4892 ? -0.1764 ? 0.4312 ? 6.9644 ? -0.8091 ? -4.5223 ? 2.2463 ? 0.9651 ? 5.2243 ? -0.3346 ? 0.3815 ? -0.5848 ? 0.1774 ? 0.4126 ? -0.6152 ? 0.7004 ? 0.8343 ? -0.1442 ? 3 'X-RAY DIFFRACTION' ? refined 18.0720 20.3370 -0.7859 0.2174 ? 0.0436 ? -0.0156 ? 0.2880 ? -0.0680 ? 0.2516 ? 4.4175 ? 1.0603 ? 1.1429 ? 3.4109 ? 0.4620 ? 3.6978 ? 0.0093 ? 0.4530 ? -0.2150 ? -0.3943 ? 0.0435 ? 0.2430 ? -0.1222 ? -0.1187 ? -0.0365 ? 4 'X-RAY DIFFRACTION' ? refined 42.3314 4.5489 22.2108 0.2601 ? 0.0048 ? 0.0429 ? 0.2962 ? 0.0645 ? 0.2978 ? 6.9713 ? 4.1047 ? 2.8778 ? 6.5555 ? 1.3763 ? 6.9836 ? -0.1757 ? 0.1929 ? -0.1471 ? -0.4262 ? 0.0408 ? -0.7701 ? -0.1948 ? 0.8201 ? 0.1014 ? 5 'X-RAY DIFFRACTION' ? refined 27.7894 3.1334 14.2092 0.4288 ? -0.0322 ? -0.0961 ? 0.3455 ? -0.0300 ? 0.4252 ? 2.0062 ? -1.6322 ? 2.8048 ? 2.0081 ? -2.0080 ? 7.3738 ? 0.3403 ? 0.0901 ? 0.2104 ? -1.0686 ? -0.1097 ? 0.8756 ? 0.3390 ? -0.9705 ? -0.1743 ? 6 'X-RAY DIFFRACTION' ? refined 24.8935 17.4581 20.0658 0.2271 ? 0.0021 ? -0.0096 ? 0.1665 ? 0.0468 ? 0.2154 ? 4.3371 ? -3.9629 ? -2.8669 ? 9.7858 ? 5.9948 ? 9.4077 ? -0.1302 ? 0.0267 ? 0.2308 ? 0.6032 ? 0.1958 ? -0.0794 ? 0.0452 ? 0.3666 ? -0.0088 ? 7 'X-RAY DIFFRACTION' ? refined 27.6568 8.0212 25.9722 0.3000 ? -0.0116 ? 0.0510 ? 0.2113 ? 0.0283 ? 0.2938 ? 2.3446 ? -1.1961 ? 0.6905 ? 2.2218 ? -0.6854 ? 2.0474 ? -0.0054 ? -0.2769 ? -0.0658 ? 0.3124 ? 0.0323 ? 0.3086 ? -0.0869 ? -0.1186 ? -0.0537 ? 8 'X-RAY DIFFRACTION' ? refined 31.4224 9.2174 30.2075 0.2979 ? -0.0015 ? 0.0493 ? 0.2035 ? 0.0508 ? 0.2536 ? 4.8119 ? -1.2270 ? 2.2265 ? 1.3905 ? 0.1417 ? 2.9667 ? -0.1512 ? -0.2689 ? -0.3540 ? 0.3848 ? 0.1248 ? 0.1383 ? -0.1352 ? -0.0335 ? 0.0500 ? 9 'X-RAY DIFFRACTION' ? refined 32.8929 4.9330 22.0311 0.2749 ? 0.0126 ? 0.0180 ? 0.2106 ? 0.0183 ? 0.2588 ? 6.9393 ? 1.5904 ? -2.2433 ? 3.8112 ? -0.8243 ? 4.7353 ? -0.3147 ? 0.2286 ? -0.3987 ? -0.2738 ? 0.0969 ? -0.0429 ? 0.1469 ? -0.1104 ? 0.2077 ? 10 'X-RAY DIFFRACTION' ? refined 28.9513 5.4308 -9.5839 0.4889 ? -0.0191 ? -0.0073 ? 0.9823 ? -0.2919 ? 0.7559 ? 3.4362 ? -1.9404 ? 3.6813 ? 2.6675 ? -2.7773 ? 6.8972 ? 0.3539 ? -0.0668 ? -0.5005 ? -0.0050 ? 0.1206 ? 0.5163 ? -0.8876 ? 0.2998 ? -0.4609 ? 11 'X-RAY DIFFRACTION' ? refined 31.9089 1.8134 -9.0673 0.4798 ? -0.0093 ? -0.0227 ? 0.4835 ? -0.1355 ? 0.6305 ? 9.0307 ? -0.1518 ? 2.0451 ? 6.6073 ? 0.2362 ? 6.0710 ? 0.3692 ? 0.5124 ? 0.3574 ? -0.0987 ? -0.5339 ? 0.9989 ? -0.0616 ? -0.6159 ? 0.2573 ? 12 'X-RAY DIFFRACTION' ? refined 18.5937 -9.0567 -5.2641 1.0862 ? -0.1404 ? 0.0083 ? 0.7198 ? 0.1119 ? 1.2790 ? 4.8144 ? -1.4282 ? -2.3123 ? 2.0394 ? 2.2764 ? 1.5789 ? -0.3887 ? 0.6792 ? -0.6128 ? 1.4456 ? 0.9880 ? 0.9075 ? 0.9345 ? -0.4227 ? -0.5815 ? 13 'X-RAY DIFFRACTION' ? refined 21.4921 -5.2866 -5.2225 0.7742 ? -0.3615 ? 0.0276 ? 1.1824 ? -0.1309 ? 0.9279 ? 6.6834 ? 0.5958 ? -3.5782 ? 4.8936 ? -0.4613 ? 6.7851 ? -0.5173 ? -0.8596 ? -0.4043 ? -0.5352 ? 0.1692 ? -0.4411 ? -0.2993 ? 0.0467 ? 0.3059 ? 14 'X-RAY DIFFRACTION' ? refined 36.2964 -7.0436 -9.1267 0.6090 ? -0.1486 ? 0.1348 ? 0.6457 ? -0.0896 ? 0.7068 ? 2.0290 ? -2.3220 ? 1.9941 ? 8.6276 ? -2.2620 ? 2.0204 ? -0.0438 ? 0.1205 ? 0.5431 ? 0.3634 ? -0.9677 ? -0.0001 ? 1.0787 ? -0.1125 ? 0.8863 ? 15 'X-RAY DIFFRACTION' ? refined 25.5578 -18.3178 -6.0140 1.3573 ? -0.2946 ? 0.0411 ? 0.9411 ? -0.0268 ? 1.1804 ? 0.8721 ? -0.0191 ? -0.3603 ? 1.8539 ? -0.0657 ? 3.2978 ? 0.2117 ? 0.2010 ? -0.1552 ? -0.3564 ? 0.7458 ? -0.2300 ? -0.4527 ? 0.1909 ? -0.8376 ? 16 'X-RAY DIFFRACTION' ? refined 31.6555 -11.5860 -6.7754 0.8392 ? -0.2529 ? 0.1220 ? 0.7165 ? -0.1652 ? 0.8628 ? 4.6931 ? 1.1853 ? 0.1062 ? 5.5857 ? -0.1518 ? 3.5005 ? 0.3629 ? 0.0615 ? -1.0676 ? 0.4505 ? -0.5312 ? 0.7294 ? 1.5305 ? -0.9992 ? 0.1486 ? 17 'X-RAY DIFFRACTION' ? refined 27.4300 -1.1728 -6.4799 0.6700 ? -0.0042 ? 0.1356 ? 0.7599 ? -0.2316 ? 0.8096 ? 3.0726 ? -0.7883 ? 1.0924 ? 7.6804 ? 0.0597 ? 2.3528 ? -0.1513 ? 0.0674 ? -0.6314 ? 0.0553 ? -0.2354 ? 0.6704 ? -0.2520 ? -1.1626 ? 0.4857 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 18 ? ? ? A 44 ? ? ;chain 'A' and (resid 18 through 44 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 45 ? ? ? A 61 ? ? ;chain 'A' and (resid 45 through 61 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 62 ? ? ? A 123 ? ? ;chain 'A' and (resid 62 through 123 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? B 19 ? ? ? B 36 ? ? ;chain 'B' and (resid 19 through 36 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 37 ? ? ? B 44 ? ? ;chain 'B' and (resid 37 through 44 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 45 ? ? ? B 54 ? ? ;chain 'B' and (resid 45 through 54 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 55 ? ? ? B 83 ? ? ;chain 'B' and (resid 55 through 83 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 84 ? ? ? B 102 ? ? ;chain 'B' and (resid 84 through 102 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 103 ? ? ? B 123 ? ? ;chain 'B' and (resid 103 through 123 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? C 18 ? ? ? C 24 ? ? ;chain 'C' and (resid 18 through 24 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? C 25 ? ? ? C 36 ? ? ;chain 'C' and (resid 25 through 36 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? C 37 ? ? ? C 54 ? ? ;chain 'C' and (resid 37 through 54 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? C 55 ? ? ? C 61 ? ? ;chain 'C' and (resid 55 through 61 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? C 62 ? ? ? C 70 ? ? ;chain 'C' and (resid 62 through 70 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? C 71 ? ? ? C 83 ? ? ;chain 'C' and (resid 71 through 83 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? C 84 ? ? ? C 109 ? ? ;chain 'C' and (resid 84 through 109 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? C 110 ? ? ? C 123 ? ? ;chain 'C' and (resid 110 through 123 ) ; # _pdbx_entry_details.entry_id 7SHH _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A PRO 2 ? A PRO 3 4 1 Y 1 A LEU 3 ? A LEU 4 5 1 Y 1 A ASP 4 ? A ASP 5 6 1 Y 1 A ALA 5 ? A ALA 6 7 1 Y 1 A GLY 6 ? A GLY 7 8 1 Y 1 A GLY 7 ? A GLY 8 9 1 Y 1 A GLN 8 ? A GLN 9 10 1 Y 1 A ASN 9 ? A ASN 10 11 1 Y 1 A SER 10 ? A SER 11 12 1 Y 1 A THR 11 ? A THR 12 13 1 Y 1 A GLN 12 ? A GLN 13 14 1 Y 1 A MET 13 ? A MET 14 15 1 Y 1 A VAL 14 ? A VAL 15 16 1 Y 1 A LEU 15 ? A LEU 16 17 1 Y 1 A ALA 16 ? A ALA 17 18 1 Y 1 A PRO 17 ? A PRO 18 19 1 Y 1 A ASP 124 ? A ASP 125 20 1 Y 1 B GLY 0 ? B GLY 1 21 1 Y 1 B MET 1 ? B MET 2 22 1 Y 1 B PRO 2 ? B PRO 3 23 1 Y 1 B LEU 3 ? B LEU 4 24 1 Y 1 B ASP 4 ? B ASP 5 25 1 Y 1 B ALA 5 ? B ALA 6 26 1 Y 1 B GLY 6 ? B GLY 7 27 1 Y 1 B GLY 7 ? B GLY 8 28 1 Y 1 B GLN 8 ? B GLN 9 29 1 Y 1 B ASN 9 ? B ASN 10 30 1 Y 1 B SER 10 ? B SER 11 31 1 Y 1 B THR 11 ? B THR 12 32 1 Y 1 B GLN 12 ? B GLN 13 33 1 Y 1 B MET 13 ? B MET 14 34 1 Y 1 B VAL 14 ? B VAL 15 35 1 Y 1 B LEU 15 ? B LEU 16 36 1 Y 1 B ALA 16 ? B ALA 17 37 1 Y 1 B PRO 17 ? B PRO 18 38 1 Y 1 B GLY 18 ? B GLY 19 39 1 Y 1 B ASP 124 ? B ASP 125 40 1 Y 1 C GLY 0 ? C GLY 1 41 1 Y 1 C MET 1 ? C MET 2 42 1 Y 1 C PRO 2 ? C PRO 3 43 1 Y 1 C LEU 3 ? C LEU 4 44 1 Y 1 C ASP 4 ? C ASP 5 45 1 Y 1 C ALA 5 ? C ALA 6 46 1 Y 1 C GLY 6 ? C GLY 7 47 1 Y 1 C GLY 7 ? C GLY 8 48 1 Y 1 C GLN 8 ? C GLN 9 49 1 Y 1 C ASN 9 ? C ASN 10 50 1 Y 1 C SER 10 ? C SER 11 51 1 Y 1 C THR 11 ? C THR 12 52 1 Y 1 C GLN 12 ? C GLN 13 53 1 Y 1 C MET 13 ? C MET 14 54 1 Y 1 C VAL 14 ? C VAL 15 55 1 Y 1 C LEU 15 ? C LEU 16 56 1 Y 1 C ALA 16 ? C ALA 17 57 1 Y 1 C PRO 17 ? C PRO 18 58 1 Y 1 C GLY 41 ? C GLY 42 59 1 Y 1 C GLY 42 ? C GLY 43 60 1 Y 1 C ASP 43 ? C ASP 44 61 1 Y 1 C HIS 44 ? C HIS 45 62 1 Y 1 C ALA 52 ? C ALA 53 63 1 Y 1 C GLN 106 ? C GLN 107 64 1 Y 1 C ASP 124 ? C ASP 125 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 9FT C2 C N N 1 9FT C3 C N N 2 9FT C5 C N N 3 9FT C6 C Y N 4 9FT C7 C Y N 5 9FT C9 C Y N 6 9FT C10 C Y N 7 9FT C11 C Y N 8 9FT C1 C N N 9 9FT C12 C N N 10 9FT C4 C N R 11 9FT C8 C Y N 12 9FT N1 N N N 13 9FT O1 O N N 14 9FT O2 O N N 15 9FT O3 O N N 16 9FT H1 H N N 17 9FT H2 H N N 18 9FT H3 H N N 19 9FT H4 H N N 20 9FT H5 H N N 21 9FT H6 H N N 22 9FT H7 H N N 23 9FT H8 H N N 24 9FT H9 H N N 25 9FT H10 H N N 26 9FT H11 H N N 27 9FT H12 H N N 28 9FT H13 H N N 29 ALA N N N N 30 ALA CA C N S 31 ALA C C N N 32 ALA O O N N 33 ALA CB C N N 34 ALA OXT O N N 35 ALA H H N N 36 ALA H2 H N N 37 ALA HA H N N 38 ALA HB1 H N N 39 ALA HB2 H N N 40 ALA HB3 H N N 41 ALA HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CYS N N N N 103 CYS CA C N R 104 CYS C C N N 105 CYS O O N N 106 CYS CB C N N 107 CYS SG S N N 108 CYS OXT O N N 109 CYS H H N N 110 CYS H2 H N N 111 CYS HA H N N 112 CYS HB2 H N N 113 CYS HB3 H N N 114 CYS HG H N N 115 CYS HXT H N N 116 GLN N N N N 117 GLN CA C N S 118 GLN C C N N 119 GLN O O N N 120 GLN CB C N N 121 GLN CG C N N 122 GLN CD C N N 123 GLN OE1 O N N 124 GLN NE2 N N N 125 GLN OXT O N N 126 GLN H H N N 127 GLN H2 H N N 128 GLN HA H N N 129 GLN HB2 H N N 130 GLN HB3 H N N 131 GLN HG2 H N N 132 GLN HG3 H N N 133 GLN HE21 H N N 134 GLN HE22 H N N 135 GLN HXT H N N 136 GLU N N N N 137 GLU CA C N S 138 GLU C C N N 139 GLU O O N N 140 GLU CB C N N 141 GLU CG C N N 142 GLU CD C N N 143 GLU OE1 O N N 144 GLU OE2 O N N 145 GLU OXT O N N 146 GLU H H N N 147 GLU H2 H N N 148 GLU HA H N N 149 GLU HB2 H N N 150 GLU HB3 H N N 151 GLU HG2 H N N 152 GLU HG3 H N N 153 GLU HE2 H N N 154 GLU HXT H N N 155 GLY N N N N 156 GLY CA C N N 157 GLY C C N N 158 GLY O O N N 159 GLY OXT O N N 160 GLY H H N N 161 GLY H2 H N N 162 GLY HA2 H N N 163 GLY HA3 H N N 164 GLY HXT H N N 165 HIS N N N N 166 HIS CA C N S 167 HIS C C N N 168 HIS O O N N 169 HIS CB C N N 170 HIS CG C Y N 171 HIS ND1 N Y N 172 HIS CD2 C Y N 173 HIS CE1 C Y N 174 HIS NE2 N Y N 175 HIS OXT O N N 176 HIS H H N N 177 HIS H2 H N N 178 HIS HA H N N 179 HIS HB2 H N N 180 HIS HB3 H N N 181 HIS HD1 H N N 182 HIS HD2 H N N 183 HIS HE1 H N N 184 HIS HE2 H N N 185 HIS HXT H N N 186 HOH O O N N 187 HOH H1 H N N 188 HOH H2 H N N 189 ILE N N N N 190 ILE CA C N S 191 ILE C C N N 192 ILE O O N N 193 ILE CB C N S 194 ILE CG1 C N N 195 ILE CG2 C N N 196 ILE CD1 C N N 197 ILE OXT O N N 198 ILE H H N N 199 ILE H2 H N N 200 ILE HA H N N 201 ILE HB H N N 202 ILE HG12 H N N 203 ILE HG13 H N N 204 ILE HG21 H N N 205 ILE HG22 H N N 206 ILE HG23 H N N 207 ILE HD11 H N N 208 ILE HD12 H N N 209 ILE HD13 H N N 210 ILE HXT H N N 211 LEU N N N N 212 LEU CA C N S 213 LEU C C N N 214 LEU O O N N 215 LEU CB C N N 216 LEU CG C N N 217 LEU CD1 C N N 218 LEU CD2 C N N 219 LEU OXT O N N 220 LEU H H N N 221 LEU H2 H N N 222 LEU HA H N N 223 LEU HB2 H N N 224 LEU HB3 H N N 225 LEU HG H N N 226 LEU HD11 H N N 227 LEU HD12 H N N 228 LEU HD13 H N N 229 LEU HD21 H N N 230 LEU HD22 H N N 231 LEU HD23 H N N 232 LEU HXT H N N 233 LYS N N N N 234 LYS CA C N S 235 LYS C C N N 236 LYS O O N N 237 LYS CB C N N 238 LYS CG C N N 239 LYS CD C N N 240 LYS CE C N N 241 LYS NZ N N N 242 LYS OXT O N N 243 LYS H H N N 244 LYS H2 H N N 245 LYS HA H N N 246 LYS HB2 H N N 247 LYS HB3 H N N 248 LYS HG2 H N N 249 LYS HG3 H N N 250 LYS HD2 H N N 251 LYS HD3 H N N 252 LYS HE2 H N N 253 LYS HE3 H N N 254 LYS HZ1 H N N 255 LYS HZ2 H N N 256 LYS HZ3 H N N 257 LYS HXT H N N 258 MET N N N N 259 MET CA C N S 260 MET C C N N 261 MET O O N N 262 MET CB C N N 263 MET CG C N N 264 MET SD S N N 265 MET CE C N N 266 MET OXT O N N 267 MET H H N N 268 MET H2 H N N 269 MET HA H N N 270 MET HB2 H N N 271 MET HB3 H N N 272 MET HG2 H N N 273 MET HG3 H N N 274 MET HE1 H N N 275 MET HE2 H N N 276 MET HE3 H N N 277 MET HXT H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 ZN ZN ZN N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 9FT C10 C9 doub Y N 1 9FT C10 C11 sing Y N 2 9FT O3 C9 sing N N 3 9FT O3 C12 sing N N 4 9FT C9 C8 sing Y N 5 9FT C11 C6 doub Y N 6 9FT O2 C3 doub N N 7 9FT C6 C7 sing Y N 8 9FT C6 C4 sing N N 9 9FT C3 N1 sing N N 10 9FT C3 C4 sing N N 11 9FT N1 C2 sing N N 12 9FT C8 C7 doub Y N 13 9FT C4 C5 sing N N 14 9FT C2 O1 doub N N 15 9FT C2 C1 sing N N 16 9FT C5 C1 sing N N 17 9FT C5 H1 sing N N 18 9FT C5 H2 sing N N 19 9FT C7 H3 sing N N 20 9FT C10 H4 sing N N 21 9FT C11 H5 sing N N 22 9FT C1 H6 sing N N 23 9FT C1 H7 sing N N 24 9FT C12 H8 sing N N 25 9FT C12 H9 sing N N 26 9FT C12 H10 sing N N 27 9FT C4 H11 sing N N 28 9FT C8 H12 sing N N 29 9FT N1 H13 sing N N 30 ALA N CA sing N N 31 ALA N H sing N N 32 ALA N H2 sing N N 33 ALA CA C sing N N 34 ALA CA CB sing N N 35 ALA CA HA sing N N 36 ALA C O doub N N 37 ALA C OXT sing N N 38 ALA CB HB1 sing N N 39 ALA CB HB2 sing N N 40 ALA CB HB3 sing N N 41 ALA OXT HXT sing N N 42 ARG N CA sing N N 43 ARG N H sing N N 44 ARG N H2 sing N N 45 ARG CA C sing N N 46 ARG CA CB sing N N 47 ARG CA HA sing N N 48 ARG C O doub N N 49 ARG C OXT sing N N 50 ARG CB CG sing N N 51 ARG CB HB2 sing N N 52 ARG CB HB3 sing N N 53 ARG CG CD sing N N 54 ARG CG HG2 sing N N 55 ARG CG HG3 sing N N 56 ARG CD NE sing N N 57 ARG CD HD2 sing N N 58 ARG CD HD3 sing N N 59 ARG NE CZ sing N N 60 ARG NE HE sing N N 61 ARG CZ NH1 sing N N 62 ARG CZ NH2 doub N N 63 ARG NH1 HH11 sing N N 64 ARG NH1 HH12 sing N N 65 ARG NH2 HH21 sing N N 66 ARG NH2 HH22 sing N N 67 ARG OXT HXT sing N N 68 ASN N CA sing N N 69 ASN N H sing N N 70 ASN N H2 sing N N 71 ASN CA C sing N N 72 ASN CA CB sing N N 73 ASN CA HA sing N N 74 ASN C O doub N N 75 ASN C OXT sing N N 76 ASN CB CG sing N N 77 ASN CB HB2 sing N N 78 ASN CB HB3 sing N N 79 ASN CG OD1 doub N N 80 ASN CG ND2 sing N N 81 ASN ND2 HD21 sing N N 82 ASN ND2 HD22 sing N N 83 ASN OXT HXT sing N N 84 ASP N CA sing N N 85 ASP N H sing N N 86 ASP N H2 sing N N 87 ASP CA C sing N N 88 ASP CA CB sing N N 89 ASP CA HA sing N N 90 ASP C O doub N N 91 ASP C OXT sing N N 92 ASP CB CG sing N N 93 ASP CB HB2 sing N N 94 ASP CB HB3 sing N N 95 ASP CG OD1 doub N N 96 ASP CG OD2 sing N N 97 ASP OD2 HD2 sing N N 98 ASP OXT HXT sing N N 99 CYS N CA sing N N 100 CYS N H sing N N 101 CYS N H2 sing N N 102 CYS CA C sing N N 103 CYS CA CB sing N N 104 CYS CA HA sing N N 105 CYS C O doub N N 106 CYS C OXT sing N N 107 CYS CB SG sing N N 108 CYS CB HB2 sing N N 109 CYS CB HB3 sing N N 110 CYS SG HG sing N N 111 CYS OXT HXT sing N N 112 GLN N CA sing N N 113 GLN N H sing N N 114 GLN N H2 sing N N 115 GLN CA C sing N N 116 GLN CA CB sing N N 117 GLN CA HA sing N N 118 GLN C O doub N N 119 GLN C OXT sing N N 120 GLN CB CG sing N N 121 GLN CB HB2 sing N N 122 GLN CB HB3 sing N N 123 GLN CG CD sing N N 124 GLN CG HG2 sing N N 125 GLN CG HG3 sing N N 126 GLN CD OE1 doub N N 127 GLN CD NE2 sing N N 128 GLN NE2 HE21 sing N N 129 GLN NE2 HE22 sing N N 130 GLN OXT HXT sing N N 131 GLU N CA sing N N 132 GLU N H sing N N 133 GLU N H2 sing N N 134 GLU CA C sing N N 135 GLU CA CB sing N N 136 GLU CA HA sing N N 137 GLU C O doub N N 138 GLU C OXT sing N N 139 GLU CB CG sing N N 140 GLU CB HB2 sing N N 141 GLU CB HB3 sing N N 142 GLU CG CD sing N N 143 GLU CG HG2 sing N N 144 GLU CG HG3 sing N N 145 GLU CD OE1 doub N N 146 GLU CD OE2 sing N N 147 GLU OE2 HE2 sing N N 148 GLU OXT HXT sing N N 149 GLY N CA sing N N 150 GLY N H sing N N 151 GLY N H2 sing N N 152 GLY CA C sing N N 153 GLY CA HA2 sing N N 154 GLY CA HA3 sing N N 155 GLY C O doub N N 156 GLY C OXT sing N N 157 GLY OXT HXT sing N N 158 HIS N CA sing N N 159 HIS N H sing N N 160 HIS N H2 sing N N 161 HIS CA C sing N N 162 HIS CA CB sing N N 163 HIS CA HA sing N N 164 HIS C O doub N N 165 HIS C OXT sing N N 166 HIS CB CG sing N N 167 HIS CB HB2 sing N N 168 HIS CB HB3 sing N N 169 HIS CG ND1 sing Y N 170 HIS CG CD2 doub Y N 171 HIS ND1 CE1 doub Y N 172 HIS ND1 HD1 sing N N 173 HIS CD2 NE2 sing Y N 174 HIS CD2 HD2 sing N N 175 HIS CE1 NE2 sing Y N 176 HIS CE1 HE1 sing N N 177 HIS NE2 HE2 sing N N 178 HIS OXT HXT sing N N 179 HOH O H1 sing N N 180 HOH O H2 sing N N 181 ILE N CA sing N N 182 ILE N H sing N N 183 ILE N H2 sing N N 184 ILE CA C sing N N 185 ILE CA CB sing N N 186 ILE CA HA sing N N 187 ILE C O doub N N 188 ILE C OXT sing N N 189 ILE CB CG1 sing N N 190 ILE CB CG2 sing N N 191 ILE CB HB sing N N 192 ILE CG1 CD1 sing N N 193 ILE CG1 HG12 sing N N 194 ILE CG1 HG13 sing N N 195 ILE CG2 HG21 sing N N 196 ILE CG2 HG22 sing N N 197 ILE CG2 HG23 sing N N 198 ILE CD1 HD11 sing N N 199 ILE CD1 HD12 sing N N 200 ILE CD1 HD13 sing N N 201 ILE OXT HXT sing N N 202 LEU N CA sing N N 203 LEU N H sing N N 204 LEU N H2 sing N N 205 LEU CA C sing N N 206 LEU CA CB sing N N 207 LEU CA HA sing N N 208 LEU C O doub N N 209 LEU C OXT sing N N 210 LEU CB CG sing N N 211 LEU CB HB2 sing N N 212 LEU CB HB3 sing N N 213 LEU CG CD1 sing N N 214 LEU CG CD2 sing N N 215 LEU CG HG sing N N 216 LEU CD1 HD11 sing N N 217 LEU CD1 HD12 sing N N 218 LEU CD1 HD13 sing N N 219 LEU CD2 HD21 sing N N 220 LEU CD2 HD22 sing N N 221 LEU CD2 HD23 sing N N 222 LEU OXT HXT sing N N 223 LYS N CA sing N N 224 LYS N H sing N N 225 LYS N H2 sing N N 226 LYS CA C sing N N 227 LYS CA CB sing N N 228 LYS CA HA sing N N 229 LYS C O doub N N 230 LYS C OXT sing N N 231 LYS CB CG sing N N 232 LYS CB HB2 sing N N 233 LYS CB HB3 sing N N 234 LYS CG CD sing N N 235 LYS CG HG2 sing N N 236 LYS CG HG3 sing N N 237 LYS CD CE sing N N 238 LYS CD HD2 sing N N 239 LYS CD HD3 sing N N 240 LYS CE NZ sing N N 241 LYS CE HE2 sing N N 242 LYS CE HE3 sing N N 243 LYS NZ HZ1 sing N N 244 LYS NZ HZ2 sing N N 245 LYS NZ HZ3 sing N N 246 LYS OXT HXT sing N N 247 MET N CA sing N N 248 MET N H sing N N 249 MET N H2 sing N N 250 MET CA C sing N N 251 MET CA CB sing N N 252 MET CA HA sing N N 253 MET C O doub N N 254 MET C OXT sing N N 255 MET CB CG sing N N 256 MET CB HB2 sing N N 257 MET CB HB3 sing N N 258 MET CG SD sing N N 259 MET CG HG2 sing N N 260 MET CG HG3 sing N N 261 MET SD CE sing N N 262 MET CE HE1 sing N N 263 MET CE HE2 sing N N 264 MET CE HE3 sing N N 265 MET OXT HXT sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 9FT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 9FT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 7SHH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017759 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016782 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011402 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ # loop_ #