data_7SMJ # _entry.id 7SMJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7SMJ pdb_00007smj 10.2210/pdb7smj/pdb WWPDB D_1000260727 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-16 2 'Structure model' 1 1 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7SMJ _pdbx_database_status.recvd_initial_deposition_date 2021-10-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 4 _pdbx_contact_author.email possu@stanford.edu _pdbx_contact_author.name_first Possu _pdbx_contact_author.name_last Huang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7948-2895 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mathews, I.I.' 1 ? 'Anand-Achim, N.' 2 ? 'Huang, P.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 746 _citation.page_last 746 _citation.title 'Protein sequence design with a learned potential.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-022-28313-9 _citation.pdbx_database_id_PubMed 35136054 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Anand, N.' 1 0000-0002-2766-8954 primary 'Eguchi, R.' 2 0000-0002-2704-8464 primary 'Mathews, I.I.' 3 ? primary 'Perez, C.P.' 4 0000-0002-9154-2360 primary 'Derry, A.' 5 0000-0003-2076-1184 primary 'Altman, R.B.' 6 ? primary 'Huang, P.S.' 7 0000-0002-7948-2895 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'AI-designed TIM-barrel F2N' 21340.412 1 ? ? ? ? 2 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHENLYFQSDIAIVDADNPADAIQQVKDLRKYGAKLIAYKSKSSEELKLALKAGADIAIVDADNPADAIQQVKDLR KYGAKLIAYKSKSSEELKLALKAGADIAIVDADNPADAIQQVKDLRKYGAKLIAYKSKSSEELKLALKAGADIAIVDADN PADAIQQVKDLRKYGAKLIAYKSKSSEELKLALKAG ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHENLYFQSDIAIVDADNPADAIQQVKDLRKYGAKLIAYKSKSSEELKLALKAGADIAIVDADNPADAIQQVKDLR KYGAKLIAYKSKSSEELKLALKAGADIAIVDADNPADAIQQVKDLRKYGAKLIAYKSKSSEELKLALKAGADIAIVDADN PADAIQQVKDLRKYGAKLIAYKSKSSEELKLALKAG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 GLU n 1 8 ASN n 1 9 LEU n 1 10 TYR n 1 11 PHE n 1 12 GLN n 1 13 SER n 1 14 ASP n 1 15 ILE n 1 16 ALA n 1 17 ILE n 1 18 VAL n 1 19 ASP n 1 20 ALA n 1 21 ASP n 1 22 ASN n 1 23 PRO n 1 24 ALA n 1 25 ASP n 1 26 ALA n 1 27 ILE n 1 28 GLN n 1 29 GLN n 1 30 VAL n 1 31 LYS n 1 32 ASP n 1 33 LEU n 1 34 ARG n 1 35 LYS n 1 36 TYR n 1 37 GLY n 1 38 ALA n 1 39 LYS n 1 40 LEU n 1 41 ILE n 1 42 ALA n 1 43 TYR n 1 44 LYS n 1 45 SER n 1 46 LYS n 1 47 SER n 1 48 SER n 1 49 GLU n 1 50 GLU n 1 51 LEU n 1 52 LYS n 1 53 LEU n 1 54 ALA n 1 55 LEU n 1 56 LYS n 1 57 ALA n 1 58 GLY n 1 59 ALA n 1 60 ASP n 1 61 ILE n 1 62 ALA n 1 63 ILE n 1 64 VAL n 1 65 ASP n 1 66 ALA n 1 67 ASP n 1 68 ASN n 1 69 PRO n 1 70 ALA n 1 71 ASP n 1 72 ALA n 1 73 ILE n 1 74 GLN n 1 75 GLN n 1 76 VAL n 1 77 LYS n 1 78 ASP n 1 79 LEU n 1 80 ARG n 1 81 LYS n 1 82 TYR n 1 83 GLY n 1 84 ALA n 1 85 LYS n 1 86 LEU n 1 87 ILE n 1 88 ALA n 1 89 TYR n 1 90 LYS n 1 91 SER n 1 92 LYS n 1 93 SER n 1 94 SER n 1 95 GLU n 1 96 GLU n 1 97 LEU n 1 98 LYS n 1 99 LEU n 1 100 ALA n 1 101 LEU n 1 102 LYS n 1 103 ALA n 1 104 GLY n 1 105 ALA n 1 106 ASP n 1 107 ILE n 1 108 ALA n 1 109 ILE n 1 110 VAL n 1 111 ASP n 1 112 ALA n 1 113 ASP n 1 114 ASN n 1 115 PRO n 1 116 ALA n 1 117 ASP n 1 118 ALA n 1 119 ILE n 1 120 GLN n 1 121 GLN n 1 122 VAL n 1 123 LYS n 1 124 ASP n 1 125 LEU n 1 126 ARG n 1 127 LYS n 1 128 TYR n 1 129 GLY n 1 130 ALA n 1 131 LYS n 1 132 LEU n 1 133 ILE n 1 134 ALA n 1 135 TYR n 1 136 LYS n 1 137 SER n 1 138 LYS n 1 139 SER n 1 140 SER n 1 141 GLU n 1 142 GLU n 1 143 LEU n 1 144 LYS n 1 145 LEU n 1 146 ALA n 1 147 LEU n 1 148 LYS n 1 149 ALA n 1 150 GLY n 1 151 ALA n 1 152 ASP n 1 153 ILE n 1 154 ALA n 1 155 ILE n 1 156 VAL n 1 157 ASP n 1 158 ALA n 1 159 ASP n 1 160 ASN n 1 161 PRO n 1 162 ALA n 1 163 ASP n 1 164 ALA n 1 165 ILE n 1 166 GLN n 1 167 GLN n 1 168 VAL n 1 169 LYS n 1 170 ASP n 1 171 LEU n 1 172 ARG n 1 173 LYS n 1 174 TYR n 1 175 GLY n 1 176 ALA n 1 177 LYS n 1 178 LEU n 1 179 ILE n 1 180 ALA n 1 181 TYR n 1 182 LYS n 1 183 SER n 1 184 LYS n 1 185 SER n 1 186 SER n 1 187 GLU n 1 188 GLU n 1 189 LEU n 1 190 LYS n 1 191 LEU n 1 192 ALA n 1 193 LEU n 1 194 LYS n 1 195 ALA n 1 196 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 196 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -12 ? ? ? A . n A 1 2 HIS 2 -11 ? ? ? A . n A 1 3 HIS 3 -10 ? ? ? A . n A 1 4 HIS 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 GLU 7 -6 ? ? ? A . n A 1 8 ASN 8 -5 ? ? ? A . n A 1 9 LEU 9 -4 ? ? ? A . n A 1 10 TYR 10 -3 -3 TYR TYR A . n A 1 11 PHE 11 -2 -2 PHE PHE A . n A 1 12 GLN 12 -1 -1 GLN GLN A . n A 1 13 SER 13 0 0 SER SER A . n A 1 14 ASP 14 1 1 ASP ASP A . n A 1 15 ILE 15 2 2 ILE ILE A . n A 1 16 ALA 16 3 3 ALA ALA A . n A 1 17 ILE 17 4 4 ILE ILE A . n A 1 18 VAL 18 5 5 VAL VAL A . n A 1 19 ASP 19 6 6 ASP ASP A . n A 1 20 ALA 20 7 7 ALA ALA A . n A 1 21 ASP 21 8 8 ASP ASP A . n A 1 22 ASN 22 9 9 ASN ASN A . n A 1 23 PRO 23 10 10 PRO PRO A . n A 1 24 ALA 24 11 11 ALA ALA A . n A 1 25 ASP 25 12 12 ASP ASP A . n A 1 26 ALA 26 13 13 ALA ALA A . n A 1 27 ILE 27 14 14 ILE ILE A . n A 1 28 GLN 28 15 15 GLN GLN A . n A 1 29 GLN 29 16 16 GLN GLN A . n A 1 30 VAL 30 17 17 VAL VAL A . n A 1 31 LYS 31 18 18 LYS LYS A . n A 1 32 ASP 32 19 19 ASP ASP A . n A 1 33 LEU 33 20 20 LEU LEU A . n A 1 34 ARG 34 21 21 ARG ARG A . n A 1 35 LYS 35 22 22 LYS LYS A . n A 1 36 TYR 36 23 23 TYR TYR A . n A 1 37 GLY 37 24 24 GLY GLY A . n A 1 38 ALA 38 25 25 ALA ALA A . n A 1 39 LYS 39 26 26 LYS LYS A . n A 1 40 LEU 40 27 27 LEU LEU A . n A 1 41 ILE 41 28 28 ILE ILE A . n A 1 42 ALA 42 29 29 ALA ALA A . n A 1 43 TYR 43 30 30 TYR TYR A . n A 1 44 LYS 44 31 31 LYS LYS A . n A 1 45 SER 45 32 32 SER SER A . n A 1 46 LYS 46 33 33 LYS LYS A . n A 1 47 SER 47 34 34 SER SER A . n A 1 48 SER 48 35 35 SER SER A . n A 1 49 GLU 49 36 36 GLU GLU A . n A 1 50 GLU 50 37 37 GLU GLU A . n A 1 51 LEU 51 38 38 LEU LEU A . n A 1 52 LYS 52 39 39 LYS LYS A . n A 1 53 LEU 53 40 40 LEU LEU A . n A 1 54 ALA 54 41 41 ALA ALA A . n A 1 55 LEU 55 42 42 LEU LEU A . n A 1 56 LYS 56 43 43 LYS LYS A . n A 1 57 ALA 57 44 44 ALA ALA A . n A 1 58 GLY 58 45 45 GLY GLY A . n A 1 59 ALA 59 46 46 ALA ALA A . n A 1 60 ASP 60 47 47 ASP ASP A . n A 1 61 ILE 61 48 48 ILE ILE A . n A 1 62 ALA 62 49 49 ALA ALA A . n A 1 63 ILE 63 50 50 ILE ILE A . n A 1 64 VAL 64 51 51 VAL VAL A . n A 1 65 ASP 65 52 52 ASP ASP A . n A 1 66 ALA 66 53 53 ALA ALA A . n A 1 67 ASP 67 54 54 ASP ASP A . n A 1 68 ASN 68 55 55 ASN ASN A . n A 1 69 PRO 69 56 56 PRO PRO A . n A 1 70 ALA 70 57 57 ALA ALA A . n A 1 71 ASP 71 58 58 ASP ASP A . n A 1 72 ALA 72 59 59 ALA ALA A . n A 1 73 ILE 73 60 60 ILE ILE A . n A 1 74 GLN 74 61 61 GLN GLN A . n A 1 75 GLN 75 62 62 GLN GLN A . n A 1 76 VAL 76 63 63 VAL VAL A . n A 1 77 LYS 77 64 64 LYS LYS A . n A 1 78 ASP 78 65 65 ASP ASP A . n A 1 79 LEU 79 66 66 LEU LEU A . n A 1 80 ARG 80 67 67 ARG ARG A . n A 1 81 LYS 81 68 68 LYS LYS A . n A 1 82 TYR 82 69 69 TYR TYR A . n A 1 83 GLY 83 70 70 GLY GLY A . n A 1 84 ALA 84 71 71 ALA ALA A . n A 1 85 LYS 85 72 72 LYS LYS A . n A 1 86 LEU 86 73 73 LEU LEU A . n A 1 87 ILE 87 74 74 ILE ILE A . n A 1 88 ALA 88 75 75 ALA ALA A . n A 1 89 TYR 89 76 76 TYR TYR A . n A 1 90 LYS 90 77 77 LYS LYS A . n A 1 91 SER 91 78 78 SER SER A . n A 1 92 LYS 92 79 79 LYS LYS A . n A 1 93 SER 93 80 80 SER SER A . n A 1 94 SER 94 81 81 SER SER A . n A 1 95 GLU 95 82 82 GLU GLU A . n A 1 96 GLU 96 83 83 GLU GLU A . n A 1 97 LEU 97 84 84 LEU LEU A . n A 1 98 LYS 98 85 85 LYS LYS A . n A 1 99 LEU 99 86 86 LEU LEU A . n A 1 100 ALA 100 87 87 ALA ALA A . n A 1 101 LEU 101 88 88 LEU LEU A . n A 1 102 LYS 102 89 89 LYS LYS A . n A 1 103 ALA 103 90 90 ALA ALA A . n A 1 104 GLY 104 91 91 GLY GLY A . n A 1 105 ALA 105 92 92 ALA ALA A . n A 1 106 ASP 106 93 93 ASP ASP A . n A 1 107 ILE 107 94 94 ILE ILE A . n A 1 108 ALA 108 95 95 ALA ALA A . n A 1 109 ILE 109 96 96 ILE ILE A . n A 1 110 VAL 110 97 97 VAL VAL A . n A 1 111 ASP 111 98 98 ASP ASP A . n A 1 112 ALA 112 99 99 ALA ALA A . n A 1 113 ASP 113 100 100 ASP ASP A . n A 1 114 ASN 114 101 101 ASN ASN A . n A 1 115 PRO 115 102 102 PRO PRO A . n A 1 116 ALA 116 103 103 ALA ALA A . n A 1 117 ASP 117 104 104 ASP ASP A . n A 1 118 ALA 118 105 105 ALA ALA A . n A 1 119 ILE 119 106 106 ILE ILE A . n A 1 120 GLN 120 107 107 GLN GLN A . n A 1 121 GLN 121 108 108 GLN GLN A . n A 1 122 VAL 122 109 109 VAL VAL A . n A 1 123 LYS 123 110 110 LYS LYS A . n A 1 124 ASP 124 111 111 ASP ASP A . n A 1 125 LEU 125 112 112 LEU LEU A . n A 1 126 ARG 126 113 113 ARG ARG A . n A 1 127 LYS 127 114 114 LYS LYS A . n A 1 128 TYR 128 115 115 TYR TYR A . n A 1 129 GLY 129 116 116 GLY GLY A . n A 1 130 ALA 130 117 117 ALA ALA A . n A 1 131 LYS 131 118 118 LYS LYS A . n A 1 132 LEU 132 119 119 LEU LEU A . n A 1 133 ILE 133 120 120 ILE ILE A . n A 1 134 ALA 134 121 121 ALA ALA A . n A 1 135 TYR 135 122 122 TYR TYR A . n A 1 136 LYS 136 123 123 LYS LYS A . n A 1 137 SER 137 124 124 SER SER A . n A 1 138 LYS 138 125 125 LYS LYS A . n A 1 139 SER 139 126 126 SER SER A . n A 1 140 SER 140 127 127 SER SER A . n A 1 141 GLU 141 128 128 GLU GLU A . n A 1 142 GLU 142 129 129 GLU GLU A . n A 1 143 LEU 143 130 130 LEU LEU A . n A 1 144 LYS 144 131 131 LYS LYS A . n A 1 145 LEU 145 132 132 LEU LEU A . n A 1 146 ALA 146 133 133 ALA ALA A . n A 1 147 LEU 147 134 134 LEU LEU A . n A 1 148 LYS 148 135 135 LYS LYS A . n A 1 149 ALA 149 136 136 ALA ALA A . n A 1 150 GLY 150 137 137 GLY GLY A . n A 1 151 ALA 151 138 138 ALA ALA A . n A 1 152 ASP 152 139 139 ASP ASP A . n A 1 153 ILE 153 140 140 ILE ILE A . n A 1 154 ALA 154 141 141 ALA ALA A . n A 1 155 ILE 155 142 142 ILE ILE A . n A 1 156 VAL 156 143 143 VAL VAL A . n A 1 157 ASP 157 144 144 ASP ASP A . n A 1 158 ALA 158 145 145 ALA ALA A . n A 1 159 ASP 159 146 146 ASP ASP A . n A 1 160 ASN 160 147 147 ASN ASN A . n A 1 161 PRO 161 148 148 PRO PRO A . n A 1 162 ALA 162 149 149 ALA ALA A . n A 1 163 ASP 163 150 150 ASP ASP A . n A 1 164 ALA 164 151 151 ALA ALA A . n A 1 165 ILE 165 152 152 ILE ILE A . n A 1 166 GLN 166 153 153 GLN GLN A . n A 1 167 GLN 167 154 154 GLN GLN A . n A 1 168 VAL 168 155 155 VAL VAL A . n A 1 169 LYS 169 156 156 LYS LYS A . n A 1 170 ASP 170 157 157 ASP ASP A . n A 1 171 LEU 171 158 158 LEU LEU A . n A 1 172 ARG 172 159 159 ARG ARG A . n A 1 173 LYS 173 160 160 LYS LYS A . n A 1 174 TYR 174 161 161 TYR TYR A . n A 1 175 GLY 175 162 162 GLY GLY A . n A 1 176 ALA 176 163 163 ALA ALA A . n A 1 177 LYS 177 164 164 LYS LYS A . n A 1 178 LEU 178 165 165 LEU LEU A . n A 1 179 ILE 179 166 166 ILE ILE A . n A 1 180 ALA 180 167 167 ALA ALA A . n A 1 181 TYR 181 168 168 TYR TYR A . n A 1 182 LYS 182 169 169 LYS LYS A . n A 1 183 SER 183 170 170 SER SER A . n A 1 184 LYS 184 171 ? ? ? A . n A 1 185 SER 185 172 ? ? ? A . n A 1 186 SER 186 173 ? ? ? A . n A 1 187 GLU 187 174 ? ? ? A . n A 1 188 GLU 188 175 ? ? ? A . n A 1 189 LEU 189 176 ? ? ? A . n A 1 190 LYS 190 177 ? ? ? A . n A 1 191 LEU 191 178 ? ? ? A . n A 1 192 ALA 192 179 ? ? ? A . n A 1 193 LEU 193 180 ? ? ? A . n A 1 194 LYS 194 181 ? ? ? A . n A 1 195 ALA 195 182 ? ? ? A . n A 1 196 GLY 196 183 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 24 HOH HOH A . B 2 HOH 2 202 16 HOH HOH A . B 2 HOH 3 203 13 HOH HOH A . B 2 HOH 4 204 30 HOH HOH A . B 2 HOH 5 205 29 HOH HOH A . B 2 HOH 6 206 1 HOH HOH A . B 2 HOH 7 207 25 HOH HOH A . B 2 HOH 8 208 2 HOH HOH A . B 2 HOH 9 209 6 HOH HOH A . B 2 HOH 10 210 17 HOH HOH A . B 2 HOH 11 211 15 HOH HOH A . B 2 HOH 12 212 9 HOH HOH A . B 2 HOH 13 213 23 HOH HOH A . B 2 HOH 14 214 28 HOH HOH A . B 2 HOH 15 215 14 HOH HOH A . B 2 HOH 16 216 20 HOH HOH A . B 2 HOH 17 217 12 HOH HOH A . B 2 HOH 18 218 19 HOH HOH A . B 2 HOH 19 219 22 HOH HOH A . B 2 HOH 20 220 4 HOH HOH A . B 2 HOH 21 221 3 HOH HOH A . B 2 HOH 22 222 8 HOH HOH A . B 2 HOH 23 223 5 HOH HOH A . B 2 HOH 24 224 11 HOH HOH A . B 2 HOH 25 225 10 HOH HOH A . B 2 HOH 26 226 26 HOH HOH A . B 2 HOH 27 227 31 HOH HOH A . B 2 HOH 28 228 21 HOH HOH A . B 2 HOH 29 229 27 HOH HOH A . B 2 HOH 30 230 18 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7SMJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.130 _cell.length_a_esd ? _cell.length_b 48.720 _cell.length_b_esd ? _cell.length_c 75.580 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7SMJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7SMJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.15 MgOAc, 0.1 Bis TRIS pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Flat Si Rh coated M0, Kirkpatrick-Baez flat bent Si M1 & M2' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-01-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 43.357 _reflns.entry_id 7SMJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.580 _reflns.d_resolution_low 37.790 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24478 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 33.017 _reflns.pdbx_Rmerge_I_obs 0.050 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.230 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.894 _reflns.pdbx_scaling_rejects 1658 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.051 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 808181 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.580 1.620 ? 1.420 ? 25835 1784 ? 1782 99.900 ? ? ? ? 2.113 ? ? ? ? ? ? ? ? 14.498 ? ? ? ? 2.190 ? ? 1 1 0.818 ? ? ? ? ? ? ? ? ? ? 1.620 1.670 ? 2.230 ? 25647 1721 ? 1718 99.800 ? ? ? ? 1.355 ? ? ? ? ? ? ? ? 14.928 ? ? ? ? 1.403 ? ? 2 1 0.914 ? ? ? ? ? ? ? ? ? ? 1.670 1.710 ? 3.550 ? 51382 1688 ? 1686 99.900 ? ? ? ? 1.310 ? ? ? ? ? ? ? ? 30.476 ? ? ? ? 1.332 ? ? 3 1 0.969 ? ? ? ? ? ? ? ? ? ? 1.710 1.770 ? 5.370 ? 62496 1641 ? 1640 99.900 ? ? ? ? 0.957 ? ? ? ? ? ? ? ? 38.107 ? ? ? ? 0.969 ? ? 4 1 0.983 ? ? ? ? ? ? ? ? ? ? 1.770 1.820 ? 7.460 ? 58531 1599 ? 1597 99.900 ? ? ? ? 0.626 ? ? ? ? ? ? ? ? 36.651 ? ? ? ? 0.634 ? ? 5 1 0.991 ? ? ? ? ? ? ? ? ? ? 1.820 1.890 ? 11.480 ? 58106 1556 ? 1556 100.000 ? ? ? ? 0.378 ? ? ? ? ? ? ? ? 37.343 ? ? ? ? 0.383 ? ? 6 1 0.997 ? ? ? ? ? ? ? ? ? ? 1.890 1.960 ? 14.940 ? 54655 1483 ? 1475 99.500 ? ? ? ? 0.302 ? ? ? ? ? ? ? ? 37.054 ? ? ? ? 0.306 ? ? 7 1 0.998 ? ? ? ? ? ? ? ? ? ? 1.960 2.040 ? 22.270 ? 56447 1456 ? 1456 100.000 ? ? ? ? 0.182 ? ? ? ? ? ? ? ? 38.769 ? ? ? ? 0.184 ? ? 8 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.040 2.130 ? 28.320 ? 52184 1371 ? 1371 100.000 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 38.063 ? ? ? ? 0.138 ? ? 9 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.130 2.230 ? 36.960 ? 49560 1332 ? 1332 100.000 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 37.207 ? ? ? ? 0.100 ? ? 10 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.230 2.360 ? 45.570 ? 46582 1265 ? 1264 99.900 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 36.853 ? ? ? ? 0.080 ? ? 11 1 1.000 ? ? ? ? ? ? ? ? ? ? 2.360 2.500 ? 51.100 ? 42505 1183 ? 1183 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 35.930 ? ? ? ? 0.069 ? ? 12 1 1.000 ? ? ? ? ? ? ? ? ? ? 2.500 2.670 ? 61.430 ? 43118 1135 ? 1135 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 37.989 ? ? ? ? 0.059 ? ? 13 1 1.000 ? ? ? ? ? ? ? ? ? ? 2.670 2.880 ? 65.670 ? 38451 1063 ? 1063 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 36.172 ? ? ? ? 0.057 ? ? 14 1 1.000 ? ? ? ? ? ? ? ? ? ? 2.880 3.160 ? 76.250 ? 35412 982 ? 982 100.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 36.061 ? ? ? ? 0.053 ? ? 15 1 1.000 ? ? ? ? ? ? ? ? ? ? 3.160 3.530 ? 77.140 ? 29241 888 ? 888 100.000 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 32.929 ? ? ? ? 0.048 ? ? 16 1 1.000 ? ? ? ? ? ? ? ? ? ? 3.530 4.080 ? 82.130 ? 26895 803 ? 803 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 33.493 ? ? ? ? 0.044 ? ? 17 1 1.000 ? ? ? ? ? ? ? ? ? ? 4.080 5.000 ? 85.880 ? 23722 676 ? 676 100.000 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 35.092 ? ? ? ? 0.041 ? ? 18 1 1.000 ? ? ? ? ? ? ? ? ? ? 5.000 7.070 ? 80.270 ? 17090 543 ? 543 100.000 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 31.473 ? ? ? ? 0.043 ? ? 19 1 1.000 ? ? ? ? ? ? ? ? ? ? 7.070 37.790 ? 82.460 ? 10322 330 ? 328 99.400 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 31.470 ? ? ? ? 0.039 ? ? 20 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -0.7300 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.8700 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 1.6000 _refine.B_iso_max 147.910 _refine.B_iso_mean 50.0260 _refine.B_iso_min 27.170 _refine.correlation_coeff_Fo_to_Fc 0.9750 _refine.correlation_coeff_Fo_to_Fc_free 0.9650 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7SMJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5800 _refine.ls_d_res_low 37.7900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23254 _refine.ls_number_reflns_R_free 1224 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1779 _refine.ls_R_factor_R_free 0.2379 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1747 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'AI predicted model' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0970 _refine.pdbx_overall_ESU_R_Free 0.0920 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.9770 _refine.overall_SU_ML 0.1060 _refine.overall_SU_R_Cruickshank_DPI 0.0973 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.5800 _refine_hist.d_res_low 37.7900 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1352 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 174 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 48.99 _refine_hist.pdbx_number_atoms_protein 1322 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 1335 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.009 0.016 1365 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.535 1.629 1795 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.426 1.604 3156 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.797 5.000 173 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 42.827 25.439 57 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.178 15.000 261 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 29.361 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.070 0.200 183 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1496 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 256 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 6.379 3.000 1330 ? r_rigid_bond_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.5800 _refine_ls_shell.d_res_low 1.6210 _refine_ls_shell.number_reflns_all 1779 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 89 _refine_ls_shell.number_reflns_R_work 1690 _refine_ls_shell.percent_reflns_obs 99.7800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4210 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3810 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7SMJ _struct.title 'F2N structure, protein design with deep learning' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7SMJ _struct_keywords.text 'TIM-barrel, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7SMJ _struct_ref.pdbx_db_accession 7SMJ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7SMJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 196 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7SMJ _struct_ref_seq.db_align_beg -12 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -12 _struct_ref_seq.pdbx_auth_seq_align_end 183 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 22 ? GLY A 37 ? ASN A 9 GLY A 24 1 ? 16 HELX_P HELX_P2 AA2 SER A 47 ? ALA A 57 ? SER A 34 ALA A 44 1 ? 11 HELX_P HELX_P3 AA3 ASN A 68 ? GLY A 83 ? ASN A 55 GLY A 70 1 ? 16 HELX_P HELX_P4 AA4 SER A 93 ? GLY A 104 ? SER A 80 GLY A 91 1 ? 12 HELX_P HELX_P5 AA5 ASN A 114 ? GLY A 129 ? ASN A 101 GLY A 116 1 ? 16 HELX_P HELX_P6 AA6 SER A 139 ? ALA A 149 ? SER A 126 ALA A 136 1 ? 11 HELX_P HELX_P7 AA7 ASN A 160 ? GLY A 175 ? ASN A 147 GLY A 162 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 15 ? VAL A 18 ? ILE A 2 VAL A 5 AA1 2 LEU A 40 ? SER A 45 ? LEU A 27 SER A 32 AA1 3 ILE A 61 ? VAL A 64 ? ILE A 48 VAL A 51 AA1 4 LEU A 86 ? SER A 91 ? LEU A 73 SER A 78 AA1 5 ILE A 107 ? VAL A 110 ? ILE A 94 VAL A 97 AA1 6 LEU A 132 ? SER A 137 ? LEU A 119 SER A 124 AA1 7 ILE A 153 ? VAL A 156 ? ILE A 140 VAL A 143 AA1 8 LEU A 178 ? LYS A 182 ? LEU A 165 LYS A 169 AA1 9 ILE A 15 ? VAL A 18 ? ILE A 2 VAL A 5 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 16 ? N ALA A 3 O ALA A 42 ? O ALA A 29 AA1 2 3 N TYR A 43 ? N TYR A 30 O ILE A 63 ? O ILE A 50 AA1 3 4 N ALA A 62 ? N ALA A 49 O ALA A 88 ? O ALA A 75 AA1 4 5 N TYR A 89 ? N TYR A 76 O ILE A 109 ? O ILE A 96 AA1 5 6 N VAL A 110 ? N VAL A 97 O ALA A 134 ? O ALA A 121 AA1 6 7 N TYR A 135 ? N TYR A 122 O ILE A 155 ? O ILE A 142 AA1 7 8 N VAL A 156 ? N VAL A 143 O ALA A 180 ? O ALA A 167 AA1 8 9 O TYR A 181 ? O TYR A 168 N ILE A 17 ? N ILE A 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 67 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLY _pdbx_validate_close_contact.auth_seq_id_2 91 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 7 ? ? 16.34 124.27 2 1 LYS A 26 ? ? -96.90 -73.67 3 1 ASP A 98 ? ? -148.50 35.84 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS -12 ? A HIS 1 2 1 Y 1 A HIS -11 ? A HIS 2 3 1 Y 1 A HIS -10 ? A HIS 3 4 1 Y 1 A HIS -9 ? A HIS 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A GLU -6 ? A GLU 7 8 1 Y 1 A ASN -5 ? A ASN 8 9 1 Y 1 A LEU -4 ? A LEU 9 10 1 Y 1 A LYS 171 ? A LYS 184 11 1 Y 1 A SER 172 ? A SER 185 12 1 Y 1 A SER 173 ? A SER 186 13 1 Y 1 A GLU 174 ? A GLU 187 14 1 Y 1 A GLU 175 ? A GLU 188 15 1 Y 1 A LEU 176 ? A LEU 189 16 1 Y 1 A LYS 177 ? A LYS 190 17 1 Y 1 A LEU 178 ? A LEU 191 18 1 Y 1 A ALA 179 ? A ALA 192 19 1 Y 1 A LEU 180 ? A LEU 193 20 1 Y 1 A LYS 181 ? A LYS 194 21 1 Y 1 A ALA 182 ? A ALA 195 22 1 Y 1 A GLY 183 ? A GLY 196 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 TYR N N N N 270 TYR CA C N S 271 TYR C C N N 272 TYR O O N N 273 TYR CB C N N 274 TYR CG C Y N 275 TYR CD1 C Y N 276 TYR CD2 C Y N 277 TYR CE1 C Y N 278 TYR CE2 C Y N 279 TYR CZ C Y N 280 TYR OH O N N 281 TYR OXT O N N 282 TYR H H N N 283 TYR H2 H N N 284 TYR HA H N N 285 TYR HB2 H N N 286 TYR HB3 H N N 287 TYR HD1 H N N 288 TYR HD2 H N N 289 TYR HE1 H N N 290 TYR HE2 H N N 291 TYR HH H N N 292 TYR HXT H N N 293 VAL N N N N 294 VAL CA C N S 295 VAL C C N N 296 VAL O O N N 297 VAL CB C N N 298 VAL CG1 C N N 299 VAL CG2 C N N 300 VAL OXT O N N 301 VAL H H N N 302 VAL H2 H N N 303 VAL HA H N N 304 VAL HB H N N 305 VAL HG11 H N N 306 VAL HG12 H N N 307 VAL HG13 H N N 308 VAL HG21 H N N 309 VAL HG22 H N N 310 VAL HG23 H N N 311 VAL HXT H N N 312 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PRO N CA sing N N 228 PRO N CD sing N N 229 PRO N H sing N N 230 PRO CA C sing N N 231 PRO CA CB sing N N 232 PRO CA HA sing N N 233 PRO C O doub N N 234 PRO C OXT sing N N 235 PRO CB CG sing N N 236 PRO CB HB2 sing N N 237 PRO CB HB3 sing N N 238 PRO CG CD sing N N 239 PRO CG HG2 sing N N 240 PRO CG HG3 sing N N 241 PRO CD HD2 sing N N 242 PRO CD HD3 sing N N 243 PRO OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 TYR N CA sing N N 258 TYR N H sing N N 259 TYR N H2 sing N N 260 TYR CA C sing N N 261 TYR CA CB sing N N 262 TYR CA HA sing N N 263 TYR C O doub N N 264 TYR C OXT sing N N 265 TYR CB CG sing N N 266 TYR CB HB2 sing N N 267 TYR CB HB3 sing N N 268 TYR CG CD1 doub Y N 269 TYR CG CD2 sing Y N 270 TYR CD1 CE1 sing Y N 271 TYR CD1 HD1 sing N N 272 TYR CD2 CE2 doub Y N 273 TYR CD2 HD2 sing N N 274 TYR CE1 CZ doub Y N 275 TYR CE1 HE1 sing N N 276 TYR CE2 CZ sing Y N 277 TYR CE2 HE2 sing N N 278 TYR CZ OH sing N N 279 TYR OH HH sing N N 280 TYR OXT HXT sing N N 281 VAL N CA sing N N 282 VAL N H sing N N 283 VAL N H2 sing N N 284 VAL CA C sing N N 285 VAL CA CB sing N N 286 VAL CA HA sing N N 287 VAL C O doub N N 288 VAL C OXT sing N N 289 VAL CB CG1 sing N N 290 VAL CB CG2 sing N N 291 VAL CB HB sing N N 292 VAL CG1 HG11 sing N N 293 VAL CG1 HG12 sing N N 294 VAL CG1 HG13 sing N N 295 VAL CG2 HG21 sing N N 296 VAL CG2 HG22 sing N N 297 VAL CG2 HG23 sing N N 298 VAL OXT HXT sing N N 299 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Energy (DOE, United States)' 'United States' AC02-76SF00515 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P30GM133894 2 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.details 'AI predicted model' # _atom_sites.entry_id 7SMJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.021218 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020525 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013231 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O # loop_