data_7SOV # _entry.id 7SOV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7SOV pdb_00007sov 10.2210/pdb7sov/pdb WWPDB D_1000260839 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'same protein without bound RNA' 7SOO unspecified PDB 'same protein with bound AAAUAA RNA' 7SOP unspecified PDB 'same protein with bound AAA RNA' 7SOQ unspecified PDB 'same protein with bound AAA RNA in a different crystal form' 7SOR unspecified PDB 'same protein with bound AAAA RNA' 7SOS unspecified PDB 'same protein with bound AAAAAA RNA' 7SOT unspecified PDB 'same protein with bound AAAAAA RNA with a different RNA conformation' 7SOU unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7SOV _pdbx_database_status.recvd_initial_deposition_date 2021-11-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kozlov, G.' 1 ? 'Gehring, K.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 50 _citation.language ? _citation.page_first 9534 _citation.page_last 9547 _citation.title ;Structural basis of 3'-end poly(A) RNA recognition by LARP1. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkac696 _citation.pdbx_database_id_PubMed 35979957 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kozlov, G.' 1 ? primary 'Mattijssen, S.' 2 ? primary 'Jiang, J.' 3 ? primary 'Nyandwi, S.' 4 ? primary 'Sprules, T.' 5 ? primary 'Iben, J.R.' 6 ? primary 'Coon, S.L.' 7 ? primary 'Gaidamakov, S.' 8 ? primary 'Noronha, A.M.' 9 ? primary 'Wilds, C.J.' 10 ? primary 'Maraia, R.J.' 11 ? primary 'Gehring, K.' 12 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7SOV _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.785 _cell.length_a_esd ? _cell.length_b 46.307 _cell.length_b_esd ? _cell.length_c 58.625 _cell.length_c_esd ? _cell.volume 99862.001 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7SOV _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform 2 of La-related protein 1' 11806.507 1 ? ? 'Residues 323-410' ? 2 polymer syn ;RNA (5'-R(P*AP*AP*AP*AP*AP*AP*AP*AP*AP*AP*A)-3') ; 3576.306 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 63 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'La ribonucleoprotein domain family member 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGSSHHHHHHSQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVE IVDEKVRRREEPEKWPLPP ; ;MGSSHHHHHHSQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVE IVDEKVRRREEPEKWPLPP ; A ? 2 polyribonucleotide no no AAAAAAAAAAA AAAAAAAAAAA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 GLN n 1 13 GLU n 1 14 LEU n 1 15 LEU n 1 16 LYS n 1 17 ASP n 1 18 TYR n 1 19 ILE n 1 20 LYS n 1 21 ARG n 1 22 GLN n 1 23 ILE n 1 24 GLU n 1 25 TYR n 1 26 TYR n 1 27 PHE n 1 28 SER n 1 29 VAL n 1 30 ASP n 1 31 ASN n 1 32 LEU n 1 33 GLU n 1 34 ARG n 1 35 ASP n 1 36 PHE n 1 37 PHE n 1 38 LEU n 1 39 ARG n 1 40 ARG n 1 41 LYS n 1 42 MET n 1 43 ASP n 1 44 ALA n 1 45 ASP n 1 46 GLY n 1 47 PHE n 1 48 LEU n 1 49 PRO n 1 50 ILE n 1 51 THR n 1 52 LEU n 1 53 ILE n 1 54 ALA n 1 55 SER n 1 56 PHE n 1 57 HIS n 1 58 ARG n 1 59 VAL n 1 60 GLN n 1 61 ALA n 1 62 LEU n 1 63 THR n 1 64 THR n 1 65 ASP n 1 66 ILE n 1 67 SER n 1 68 LEU n 1 69 ILE n 1 70 PHE n 1 71 ALA n 1 72 ALA n 1 73 LEU n 1 74 LYS n 1 75 ASP n 1 76 SER n 1 77 LYS n 1 78 VAL n 1 79 VAL n 1 80 GLU n 1 81 ILE n 1 82 VAL n 1 83 ASP n 1 84 GLU n 1 85 LYS n 1 86 VAL n 1 87 ARG n 1 88 ARG n 1 89 ARG n 1 90 GLU n 1 91 GLU n 1 92 PRO n 1 93 GLU n 1 94 LYS n 1 95 TRP n 1 96 PRO n 1 97 LEU n 1 98 PRO n 1 99 PRO n 2 1 A n 2 2 A n 2 3 A n 2 4 A n 2 5 A n 2 6 A n 2 7 A n 2 8 A n 2 9 A n 2 10 A n 2 11 A n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 99 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LARP1, KIAA0731, LARP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 11 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP LARP1-3_HUMAN Q6PKG0-3 ? 1 ;QELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREE PEKWPLPP ; 323 2 PDB 7SOV 7SOV ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7SOV A 12 ? 99 ? Q6PKG0-3 323 ? 410 ? 323 410 2 2 7SOV B 1 ? 11 ? 7SOV -11 ? -1 ? -11 -1 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7SOV MET A 1 ? UNP Q6PKG0-3 ? ? 'initiating methionine' 312 1 1 7SOV GLY A 2 ? UNP Q6PKG0-3 ? ? 'expression tag' 313 2 1 7SOV SER A 3 ? UNP Q6PKG0-3 ? ? 'expression tag' 314 3 1 7SOV SER A 4 ? UNP Q6PKG0-3 ? ? 'expression tag' 315 4 1 7SOV HIS A 5 ? UNP Q6PKG0-3 ? ? 'expression tag' 316 5 1 7SOV HIS A 6 ? UNP Q6PKG0-3 ? ? 'expression tag' 317 6 1 7SOV HIS A 7 ? UNP Q6PKG0-3 ? ? 'expression tag' 318 7 1 7SOV HIS A 8 ? UNP Q6PKG0-3 ? ? 'expression tag' 319 8 1 7SOV HIS A 9 ? UNP Q6PKG0-3 ? ? 'expression tag' 320 9 1 7SOV HIS A 10 ? UNP Q6PKG0-3 ? ? 'expression tag' 321 10 1 7SOV SER A 11 ? UNP Q6PKG0-3 ? ? 'expression tag' 322 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7SOV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.62 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 24.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M BICINE pH 9.0, 1.6 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 20.56 _reflns.entry_id 7SOV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.45 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17326 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.086 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.45 _reflns_shell.d_res_low 1.48 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1586 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.595 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 28.31 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7SOV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.45 _refine.ls_d_res_low 36.34 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17326 _refine.ls_number_reflns_R_free 906 _refine.ls_number_reflns_R_work 16420 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.78 _refine.ls_percent_reflns_R_free 5.23 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1857 _refine.ls_R_factor_R_free 0.2231 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1835 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7SOO _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.1981 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1668 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.45 _refine_hist.d_res_low 36.34 _refine_hist.number_atoms_solvent 63 _refine_hist.number_atoms_total 885 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 732 _refine_hist.pdbx_number_atoms_nucleic_acid 79 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0093 ? 845 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2582 ? 1161 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.1019 ? 134 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0103 ? 135 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.9870 ? 146 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.45 1.54 . . 147 2643 92.75 . . . 0.2767 . 0.1528 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.54 1.66 . . 175 2783 99.06 . . . 0.2590 . 0.1657 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.66 1.83 . . 156 2792 98.46 . . . 0.2333 . 0.1432 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.83 2.09 . . 136 2779 96.20 . . . 0.2048 . 0.1623 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.09 2.64 . . 143 2709 93.54 . . . 0.2056 . 0.1912 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.64 36.34 . . 149 2714 89.16 . . . 0.2258 . 0.1970 . . . . . . . . . . . # _struct.entry_id 7SOV _struct.title 'LaM domain of human LARP1 in complex with AAAAAAAAAAA RNA polynucleotide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7SOV _struct_keywords.text 'Winged helix fold, RNA binding domain, RNA BINDING PROTEIN, RNA BINDING PROTEIN-RNA complex' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN/RNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? PHE A 27 ? SER A 322 PHE A 338 1 ? 17 HELX_P HELX_P2 AA2 SER A 28 ? GLU A 33 ? SER A 339 GLU A 344 1 ? 6 HELX_P HELX_P3 AA3 ASP A 35 ? MET A 42 ? ASP A 346 MET A 353 1 ? 8 HELX_P HELX_P4 AA4 ILE A 50 ? SER A 55 ? ILE A 361 SER A 366 1 ? 6 HELX_P HELX_P5 AA5 PHE A 56 ? THR A 63 ? PHE A 367 THR A 374 1 ? 8 HELX_P HELX_P6 AA6 ASP A 65 ? ASP A 75 ? ASP A 376 ASP A 386 1 ? 11 HELX_P HELX_P7 AA7 GLU A 91 ? TRP A 95 ? GLU A 402 TRP A 406 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 48 ? PRO A 49 ? LEU A 359 PRO A 360 AA1 2 LYS A 85 ? ARG A 88 ? LYS A 396 ARG A 399 AA1 3 VAL A 79 ? VAL A 82 ? VAL A 390 VAL A 393 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 48 ? N LEU A 359 O VAL A 86 ? O VAL A 397 AA1 2 3 O ARG A 87 ? O ARG A 398 N GLU A 80 ? N GLU A 391 # _atom_sites.entry_id 7SOV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.027185 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021595 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017058 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 312 ? ? ? A . n A 1 2 GLY 2 313 ? ? ? A . n A 1 3 SER 3 314 ? ? ? A . n A 1 4 SER 4 315 ? ? ? A . n A 1 5 HIS 5 316 ? ? ? A . n A 1 6 HIS 6 317 ? ? ? A . n A 1 7 HIS 7 318 ? ? ? A . n A 1 8 HIS 8 319 ? ? ? A . n A 1 9 HIS 9 320 ? ? ? A . n A 1 10 HIS 10 321 ? ? ? A . n A 1 11 SER 11 322 322 SER SER A . n A 1 12 GLN 12 323 323 GLN GLN A . n A 1 13 GLU 13 324 324 GLU GLU A . n A 1 14 LEU 14 325 325 LEU LEU A . n A 1 15 LEU 15 326 326 LEU LEU A . n A 1 16 LYS 16 327 327 LYS LYS A . n A 1 17 ASP 17 328 328 ASP ASP A . n A 1 18 TYR 18 329 329 TYR TYR A . n A 1 19 ILE 19 330 330 ILE ILE A . n A 1 20 LYS 20 331 331 LYS LYS A . n A 1 21 ARG 21 332 332 ARG ARG A . n A 1 22 GLN 22 333 333 GLN GLN A . n A 1 23 ILE 23 334 334 ILE ILE A . n A 1 24 GLU 24 335 335 GLU GLU A . n A 1 25 TYR 25 336 336 TYR TYR A . n A 1 26 TYR 26 337 337 TYR TYR A . n A 1 27 PHE 27 338 338 PHE PHE A . n A 1 28 SER 28 339 339 SER SER A . n A 1 29 VAL 29 340 340 VAL VAL A . n A 1 30 ASP 30 341 341 ASP ASP A . n A 1 31 ASN 31 342 342 ASN ASN A . n A 1 32 LEU 32 343 343 LEU LEU A . n A 1 33 GLU 33 344 344 GLU GLU A . n A 1 34 ARG 34 345 345 ARG ARG A . n A 1 35 ASP 35 346 346 ASP ASP A . n A 1 36 PHE 36 347 347 PHE PHE A . n A 1 37 PHE 37 348 348 PHE PHE A . n A 1 38 LEU 38 349 349 LEU LEU A . n A 1 39 ARG 39 350 350 ARG ARG A . n A 1 40 ARG 40 351 351 ARG ARG A . n A 1 41 LYS 41 352 352 LYS LYS A . n A 1 42 MET 42 353 353 MET MET A . n A 1 43 ASP 43 354 354 ASP ASP A . n A 1 44 ALA 44 355 355 ALA ALA A . n A 1 45 ASP 45 356 356 ASP ASP A . n A 1 46 GLY 46 357 357 GLY GLY A . n A 1 47 PHE 47 358 358 PHE PHE A . n A 1 48 LEU 48 359 359 LEU LEU A . n A 1 49 PRO 49 360 360 PRO PRO A . n A 1 50 ILE 50 361 361 ILE ILE A . n A 1 51 THR 51 362 362 THR THR A . n A 1 52 LEU 52 363 363 LEU LEU A . n A 1 53 ILE 53 364 364 ILE ILE A . n A 1 54 ALA 54 365 365 ALA ALA A . n A 1 55 SER 55 366 366 SER SER A . n A 1 56 PHE 56 367 367 PHE PHE A . n A 1 57 HIS 57 368 368 HIS HIS A . n A 1 58 ARG 58 369 369 ARG ARG A . n A 1 59 VAL 59 370 370 VAL VAL A . n A 1 60 GLN 60 371 371 GLN GLN A . n A 1 61 ALA 61 372 372 ALA ALA A . n A 1 62 LEU 62 373 373 LEU LEU A . n A 1 63 THR 63 374 374 THR THR A . n A 1 64 THR 64 375 375 THR THR A . n A 1 65 ASP 65 376 376 ASP ASP A . n A 1 66 ILE 66 377 377 ILE ILE A . n A 1 67 SER 67 378 378 SER SER A . n A 1 68 LEU 68 379 379 LEU LEU A . n A 1 69 ILE 69 380 380 ILE ILE A . n A 1 70 PHE 70 381 381 PHE PHE A . n A 1 71 ALA 71 382 382 ALA ALA A . n A 1 72 ALA 72 383 383 ALA ALA A . n A 1 73 LEU 73 384 384 LEU LEU A . n A 1 74 LYS 74 385 385 LYS LYS A . n A 1 75 ASP 75 386 386 ASP ASP A . n A 1 76 SER 76 387 387 SER SER A . n A 1 77 LYS 77 388 388 LYS LYS A . n A 1 78 VAL 78 389 389 VAL VAL A . n A 1 79 VAL 79 390 390 VAL VAL A . n A 1 80 GLU 80 391 391 GLU GLU A . n A 1 81 ILE 81 392 392 ILE ILE A . n A 1 82 VAL 82 393 393 VAL VAL A . n A 1 83 ASP 83 394 394 ASP ASP A . n A 1 84 GLU 84 395 395 GLU GLU A . n A 1 85 LYS 85 396 396 LYS LYS A . n A 1 86 VAL 86 397 397 VAL VAL A . n A 1 87 ARG 87 398 398 ARG ARG A . n A 1 88 ARG 88 399 399 ARG ARG A . n A 1 89 ARG 89 400 400 ARG ARG A . n A 1 90 GLU 90 401 401 GLU GLU A . n A 1 91 GLU 91 402 402 GLU GLU A . n A 1 92 PRO 92 403 403 PRO PRO A . n A 1 93 GLU 93 404 404 GLU GLU A . n A 1 94 LYS 94 405 405 LYS LYS A . n A 1 95 TRP 95 406 406 TRP TRP A . n A 1 96 PRO 96 407 407 PRO PRO A . n A 1 97 LEU 97 408 408 LEU LEU A . n A 1 98 PRO 98 409 409 PRO PRO A . n A 1 99 PRO 99 410 410 PRO PRO A . n B 2 1 A 1 -11 ? ? ? B . n B 2 2 A 2 -10 ? ? ? B . n B 2 3 A 3 -9 ? ? ? B . n B 2 4 A 4 -8 ? ? ? B . n B 2 5 A 5 -7 ? ? ? B . n B 2 6 A 6 -6 ? ? ? B . n B 2 7 A 7 -5 ? ? ? B . n B 2 8 A 8 -4 -4 A A B . n B 2 9 A 9 -3 -3 A A B . n B 2 10 A 10 -2 -2 A A B . n B 2 11 A 11 -1 -1 A A B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email kalle.gehring@mcgill.ca _pdbx_contact_author.name_first Kalle _pdbx_contact_author.name_last Gehring _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6500-1184 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 501 1 SO4 SO4 A . D 4 GOL 1 502 1 GOL GOL A . E 5 HOH 1 601 31 HOH HOH A . E 5 HOH 2 602 11 HOH HOH A . E 5 HOH 3 603 58 HOH HOH A . E 5 HOH 4 604 35 HOH HOH A . E 5 HOH 5 605 57 HOH HOH A . E 5 HOH 6 606 29 HOH HOH A . E 5 HOH 7 607 50 HOH HOH A . E 5 HOH 8 608 21 HOH HOH A . E 5 HOH 9 609 66 HOH HOH A . E 5 HOH 10 610 27 HOH HOH A . E 5 HOH 11 611 14 HOH HOH A . E 5 HOH 12 612 4 HOH HOH A . E 5 HOH 13 613 38 HOH HOH A . E 5 HOH 14 614 17 HOH HOH A . E 5 HOH 15 615 5 HOH HOH A . E 5 HOH 16 616 18 HOH HOH A . E 5 HOH 17 617 12 HOH HOH A . E 5 HOH 18 618 20 HOH HOH A . E 5 HOH 19 619 19 HOH HOH A . E 5 HOH 20 620 9 HOH HOH A . E 5 HOH 21 621 63 HOH HOH A . E 5 HOH 22 622 22 HOH HOH A . E 5 HOH 23 623 64 HOH HOH A . E 5 HOH 24 624 40 HOH HOH A . E 5 HOH 25 625 32 HOH HOH A . E 5 HOH 26 626 3 HOH HOH A . E 5 HOH 27 627 15 HOH HOH A . E 5 HOH 28 628 41 HOH HOH A . E 5 HOH 29 629 34 HOH HOH A . E 5 HOH 30 630 55 HOH HOH A . E 5 HOH 31 631 56 HOH HOH A . E 5 HOH 32 632 48 HOH HOH A . E 5 HOH 33 633 6 HOH HOH A . E 5 HOH 34 634 47 HOH HOH A . E 5 HOH 35 635 13 HOH HOH A . E 5 HOH 36 636 65 HOH HOH A . E 5 HOH 37 637 23 HOH HOH A . E 5 HOH 38 638 61 HOH HOH A . E 5 HOH 39 639 52 HOH HOH A . E 5 HOH 40 640 26 HOH HOH A . E 5 HOH 41 641 36 HOH HOH A . E 5 HOH 42 642 7 HOH HOH A . E 5 HOH 43 643 24 HOH HOH A . E 5 HOH 44 644 43 HOH HOH A . E 5 HOH 45 645 45 HOH HOH A . E 5 HOH 46 646 30 HOH HOH A . E 5 HOH 47 647 49 HOH HOH A . E 5 HOH 48 648 62 HOH HOH A . E 5 HOH 49 649 25 HOH HOH A . E 5 HOH 50 650 37 HOH HOH A . E 5 HOH 51 651 46 HOH HOH A . E 5 HOH 52 652 44 HOH HOH A . E 5 HOH 53 653 59 HOH HOH A . E 5 HOH 54 654 33 HOH HOH A . E 5 HOH 55 655 16 HOH HOH A . E 5 HOH 56 656 53 HOH HOH A . E 5 HOH 57 657 42 HOH HOH A . E 5 HOH 58 658 54 HOH HOH A . F 5 HOH 1 101 8 HOH HOH B . F 5 HOH 2 102 51 HOH HOH B . F 5 HOH 3 103 28 HOH HOH B . F 5 HOH 4 104 60 HOH HOH B . F 5 HOH 5 105 39 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1240 ? 1 MORE -14 ? 1 'SSA (A^2)' 5580 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-03 2 'Structure model' 1 1 2022-08-31 3 'Structure model' 1 2 2022-11-23 4 'Structure model' 1 3 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19_4092 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 7SOV _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 394 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 50.96 _pdbx_validate_torsion.psi -114.97 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 322 ? OG ? A SER 11 OG 2 1 Y 1 A LYS 385 ? CG ? A LYS 74 CG 3 1 Y 1 A LYS 385 ? CD ? A LYS 74 CD 4 1 Y 1 A LYS 385 ? CE ? A LYS 74 CE 5 1 Y 1 A LYS 385 ? NZ ? A LYS 74 NZ 6 1 Y 1 A LYS 388 ? CG ? A LYS 77 CG 7 1 Y 1 A LYS 388 ? CD ? A LYS 77 CD 8 1 Y 1 A LYS 388 ? CE ? A LYS 77 CE 9 1 Y 1 A LYS 388 ? NZ ? A LYS 77 NZ 10 1 Y 1 A LYS 396 ? CE ? A LYS 85 CE 11 1 Y 1 A LYS 396 ? NZ ? A LYS 85 NZ 12 1 Y 1 A GLU 404 ? CG ? A GLU 93 CG 13 1 Y 1 A GLU 404 ? CD ? A GLU 93 CD 14 1 Y 1 A GLU 404 ? OE1 ? A GLU 93 OE1 15 1 Y 1 A GLU 404 ? OE2 ? A GLU 93 OE2 16 1 Y 1 A LYS 405 ? CD ? A LYS 94 CD 17 1 Y 1 A LYS 405 ? CE ? A LYS 94 CE 18 1 Y 1 A LYS 405 ? NZ ? A LYS 94 NZ 19 1 Y 1 B A -3 ? C8 ? B A 9 C8 20 1 Y 1 B A -3 ? N7 ? B A 9 N7 21 1 Y 1 B A -3 ? C5 ? B A 9 C5 22 1 Y 1 B A -3 ? C6 ? B A 9 C6 23 1 Y 1 B A -3 ? N6 ? B A 9 N6 24 1 Y 1 B A -3 ? N1 ? B A 9 N1 25 1 Y 1 B A -3 ? C2 ? B A 9 C2 26 1 Y 1 B A -3 ? N3 ? B A 9 N3 27 1 Y 1 B A -3 ? C4 ? B A 9 C4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 312 ? A MET 1 2 1 Y 1 A GLY 313 ? A GLY 2 3 1 Y 1 A SER 314 ? A SER 3 4 1 Y 1 A SER 315 ? A SER 4 5 1 Y 1 A HIS 316 ? A HIS 5 6 1 Y 1 A HIS 317 ? A HIS 6 7 1 Y 1 A HIS 318 ? A HIS 7 8 1 Y 1 A HIS 319 ? A HIS 8 9 1 Y 1 A HIS 320 ? A HIS 9 10 1 Y 1 A HIS 321 ? A HIS 10 11 1 Y 1 B A -11 ? B A 1 12 1 Y 1 B A -10 ? B A 2 13 1 Y 1 B A -9 ? B A 3 14 1 Y 1 B A -8 ? B A 4 15 1 Y 1 B A -7 ? B A 5 16 1 Y 1 B A -6 ? B A 6 17 1 Y 1 B A -5 ? B A 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 GLN N N N N 111 GLN CA C N S 112 GLN C C N N 113 GLN O O N N 114 GLN CB C N N 115 GLN CG C N N 116 GLN CD C N N 117 GLN OE1 O N N 118 GLN NE2 N N N 119 GLN OXT O N N 120 GLN H H N N 121 GLN H2 H N N 122 GLN HA H N N 123 GLN HB2 H N N 124 GLN HB3 H N N 125 GLN HG2 H N N 126 GLN HG3 H N N 127 GLN HE21 H N N 128 GLN HE22 H N N 129 GLN HXT H N N 130 GLU N N N N 131 GLU CA C N S 132 GLU C C N N 133 GLU O O N N 134 GLU CB C N N 135 GLU CG C N N 136 GLU CD C N N 137 GLU OE1 O N N 138 GLU OE2 O N N 139 GLU OXT O N N 140 GLU H H N N 141 GLU H2 H N N 142 GLU HA H N N 143 GLU HB2 H N N 144 GLU HB3 H N N 145 GLU HG2 H N N 146 GLU HG3 H N N 147 GLU HE2 H N N 148 GLU HXT H N N 149 GLY N N N N 150 GLY CA C N N 151 GLY C C N N 152 GLY O O N N 153 GLY OXT O N N 154 GLY H H N N 155 GLY H2 H N N 156 GLY HA2 H N N 157 GLY HA3 H N N 158 GLY HXT H N N 159 GOL C1 C N N 160 GOL O1 O N N 161 GOL C2 C N N 162 GOL O2 O N N 163 GOL C3 C N N 164 GOL O3 O N N 165 GOL H11 H N N 166 GOL H12 H N N 167 GOL HO1 H N N 168 GOL H2 H N N 169 GOL HO2 H N N 170 GOL H31 H N N 171 GOL H32 H N N 172 GOL HO3 H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 HOH O O N N 195 HOH H1 H N N 196 HOH H2 H N N 197 ILE N N N N 198 ILE CA C N S 199 ILE C C N N 200 ILE O O N N 201 ILE CB C N S 202 ILE CG1 C N N 203 ILE CG2 C N N 204 ILE CD1 C N N 205 ILE OXT O N N 206 ILE H H N N 207 ILE H2 H N N 208 ILE HA H N N 209 ILE HB H N N 210 ILE HG12 H N N 211 ILE HG13 H N N 212 ILE HG21 H N N 213 ILE HG22 H N N 214 ILE HG23 H N N 215 ILE HD11 H N N 216 ILE HD12 H N N 217 ILE HD13 H N N 218 ILE HXT H N N 219 LEU N N N N 220 LEU CA C N S 221 LEU C C N N 222 LEU O O N N 223 LEU CB C N N 224 LEU CG C N N 225 LEU CD1 C N N 226 LEU CD2 C N N 227 LEU OXT O N N 228 LEU H H N N 229 LEU H2 H N N 230 LEU HA H N N 231 LEU HB2 H N N 232 LEU HB3 H N N 233 LEU HG H N N 234 LEU HD11 H N N 235 LEU HD12 H N N 236 LEU HD13 H N N 237 LEU HD21 H N N 238 LEU HD22 H N N 239 LEU HD23 H N N 240 LEU HXT H N N 241 LYS N N N N 242 LYS CA C N S 243 LYS C C N N 244 LYS O O N N 245 LYS CB C N N 246 LYS CG C N N 247 LYS CD C N N 248 LYS CE C N N 249 LYS NZ N N N 250 LYS OXT O N N 251 LYS H H N N 252 LYS H2 H N N 253 LYS HA H N N 254 LYS HB2 H N N 255 LYS HB3 H N N 256 LYS HG2 H N N 257 LYS HG3 H N N 258 LYS HD2 H N N 259 LYS HD3 H N N 260 LYS HE2 H N N 261 LYS HE3 H N N 262 LYS HZ1 H N N 263 LYS HZ2 H N N 264 LYS HZ3 H N N 265 LYS HXT H N N 266 MET N N N N 267 MET CA C N S 268 MET C C N N 269 MET O O N N 270 MET CB C N N 271 MET CG C N N 272 MET SD S N N 273 MET CE C N N 274 MET OXT O N N 275 MET H H N N 276 MET H2 H N N 277 MET HA H N N 278 MET HB2 H N N 279 MET HB3 H N N 280 MET HG2 H N N 281 MET HG3 H N N 282 MET HE1 H N N 283 MET HE2 H N N 284 MET HE3 H N N 285 MET HXT H N N 286 PHE N N N N 287 PHE CA C N S 288 PHE C C N N 289 PHE O O N N 290 PHE CB C N N 291 PHE CG C Y N 292 PHE CD1 C Y N 293 PHE CD2 C Y N 294 PHE CE1 C Y N 295 PHE CE2 C Y N 296 PHE CZ C Y N 297 PHE OXT O N N 298 PHE H H N N 299 PHE H2 H N N 300 PHE HA H N N 301 PHE HB2 H N N 302 PHE HB3 H N N 303 PHE HD1 H N N 304 PHE HD2 H N N 305 PHE HE1 H N N 306 PHE HE2 H N N 307 PHE HZ H N N 308 PHE HXT H N N 309 PRO N N N N 310 PRO CA C N S 311 PRO C C N N 312 PRO O O N N 313 PRO CB C N N 314 PRO CG C N N 315 PRO CD C N N 316 PRO OXT O N N 317 PRO H H N N 318 PRO HA H N N 319 PRO HB2 H N N 320 PRO HB3 H N N 321 PRO HG2 H N N 322 PRO HG3 H N N 323 PRO HD2 H N N 324 PRO HD3 H N N 325 PRO HXT H N N 326 SER N N N N 327 SER CA C N S 328 SER C C N N 329 SER O O N N 330 SER CB C N N 331 SER OG O N N 332 SER OXT O N N 333 SER H H N N 334 SER H2 H N N 335 SER HA H N N 336 SER HB2 H N N 337 SER HB3 H N N 338 SER HG H N N 339 SER HXT H N N 340 SO4 S S N N 341 SO4 O1 O N N 342 SO4 O2 O N N 343 SO4 O3 O N N 344 SO4 O4 O N N 345 THR N N N N 346 THR CA C N S 347 THR C C N N 348 THR O O N N 349 THR CB C N R 350 THR OG1 O N N 351 THR CG2 C N N 352 THR OXT O N N 353 THR H H N N 354 THR H2 H N N 355 THR HA H N N 356 THR HB H N N 357 THR HG1 H N N 358 THR HG21 H N N 359 THR HG22 H N N 360 THR HG23 H N N 361 THR HXT H N N 362 TRP N N N N 363 TRP CA C N S 364 TRP C C N N 365 TRP O O N N 366 TRP CB C N N 367 TRP CG C Y N 368 TRP CD1 C Y N 369 TRP CD2 C Y N 370 TRP NE1 N Y N 371 TRP CE2 C Y N 372 TRP CE3 C Y N 373 TRP CZ2 C Y N 374 TRP CZ3 C Y N 375 TRP CH2 C Y N 376 TRP OXT O N N 377 TRP H H N N 378 TRP H2 H N N 379 TRP HA H N N 380 TRP HB2 H N N 381 TRP HB3 H N N 382 TRP HD1 H N N 383 TRP HE1 H N N 384 TRP HE3 H N N 385 TRP HZ2 H N N 386 TRP HZ3 H N N 387 TRP HH2 H N N 388 TRP HXT H N N 389 TYR N N N N 390 TYR CA C N S 391 TYR C C N N 392 TYR O O N N 393 TYR CB C N N 394 TYR CG C Y N 395 TYR CD1 C Y N 396 TYR CD2 C Y N 397 TYR CE1 C Y N 398 TYR CE2 C Y N 399 TYR CZ C Y N 400 TYR OH O N N 401 TYR OXT O N N 402 TYR H H N N 403 TYR H2 H N N 404 TYR HA H N N 405 TYR HB2 H N N 406 TYR HB3 H N N 407 TYR HD1 H N N 408 TYR HD2 H N N 409 TYR HE1 H N N 410 TYR HE2 H N N 411 TYR HH H N N 412 TYR HXT H N N 413 VAL N N N N 414 VAL CA C N S 415 VAL C C N N 416 VAL O O N N 417 VAL CB C N N 418 VAL CG1 C N N 419 VAL CG2 C N N 420 VAL OXT O N N 421 VAL H H N N 422 VAL H2 H N N 423 VAL HA H N N 424 VAL HB H N N 425 VAL HG11 H N N 426 VAL HG12 H N N 427 VAL HG13 H N N 428 VAL HG21 H N N 429 VAL HG22 H N N 430 VAL HG23 H N N 431 VAL HXT H N N 432 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 GLN N CA sing N N 109 GLN N H sing N N 110 GLN N H2 sing N N 111 GLN CA C sing N N 112 GLN CA CB sing N N 113 GLN CA HA sing N N 114 GLN C O doub N N 115 GLN C OXT sing N N 116 GLN CB CG sing N N 117 GLN CB HB2 sing N N 118 GLN CB HB3 sing N N 119 GLN CG CD sing N N 120 GLN CG HG2 sing N N 121 GLN CG HG3 sing N N 122 GLN CD OE1 doub N N 123 GLN CD NE2 sing N N 124 GLN NE2 HE21 sing N N 125 GLN NE2 HE22 sing N N 126 GLN OXT HXT sing N N 127 GLU N CA sing N N 128 GLU N H sing N N 129 GLU N H2 sing N N 130 GLU CA C sing N N 131 GLU CA CB sing N N 132 GLU CA HA sing N N 133 GLU C O doub N N 134 GLU C OXT sing N N 135 GLU CB CG sing N N 136 GLU CB HB2 sing N N 137 GLU CB HB3 sing N N 138 GLU CG CD sing N N 139 GLU CG HG2 sing N N 140 GLU CG HG3 sing N N 141 GLU CD OE1 doub N N 142 GLU CD OE2 sing N N 143 GLU OE2 HE2 sing N N 144 GLU OXT HXT sing N N 145 GLY N CA sing N N 146 GLY N H sing N N 147 GLY N H2 sing N N 148 GLY CA C sing N N 149 GLY CA HA2 sing N N 150 GLY CA HA3 sing N N 151 GLY C O doub N N 152 GLY C OXT sing N N 153 GLY OXT HXT sing N N 154 GOL C1 O1 sing N N 155 GOL C1 C2 sing N N 156 GOL C1 H11 sing N N 157 GOL C1 H12 sing N N 158 GOL O1 HO1 sing N N 159 GOL C2 O2 sing N N 160 GOL C2 C3 sing N N 161 GOL C2 H2 sing N N 162 GOL O2 HO2 sing N N 163 GOL C3 O3 sing N N 164 GOL C3 H31 sing N N 165 GOL C3 H32 sing N N 166 GOL O3 HO3 sing N N 167 HIS N CA sing N N 168 HIS N H sing N N 169 HIS N H2 sing N N 170 HIS CA C sing N N 171 HIS CA CB sing N N 172 HIS CA HA sing N N 173 HIS C O doub N N 174 HIS C OXT sing N N 175 HIS CB CG sing N N 176 HIS CB HB2 sing N N 177 HIS CB HB3 sing N N 178 HIS CG ND1 sing Y N 179 HIS CG CD2 doub Y N 180 HIS ND1 CE1 doub Y N 181 HIS ND1 HD1 sing N N 182 HIS CD2 NE2 sing Y N 183 HIS CD2 HD2 sing N N 184 HIS CE1 NE2 sing Y N 185 HIS CE1 HE1 sing N N 186 HIS NE2 HE2 sing N N 187 HIS OXT HXT sing N N 188 HOH O H1 sing N N 189 HOH O H2 sing N N 190 ILE N CA sing N N 191 ILE N H sing N N 192 ILE N H2 sing N N 193 ILE CA C sing N N 194 ILE CA CB sing N N 195 ILE CA HA sing N N 196 ILE C O doub N N 197 ILE C OXT sing N N 198 ILE CB CG1 sing N N 199 ILE CB CG2 sing N N 200 ILE CB HB sing N N 201 ILE CG1 CD1 sing N N 202 ILE CG1 HG12 sing N N 203 ILE CG1 HG13 sing N N 204 ILE CG2 HG21 sing N N 205 ILE CG2 HG22 sing N N 206 ILE CG2 HG23 sing N N 207 ILE CD1 HD11 sing N N 208 ILE CD1 HD12 sing N N 209 ILE CD1 HD13 sing N N 210 ILE OXT HXT sing N N 211 LEU N CA sing N N 212 LEU N H sing N N 213 LEU N H2 sing N N 214 LEU CA C sing N N 215 LEU CA CB sing N N 216 LEU CA HA sing N N 217 LEU C O doub N N 218 LEU C OXT sing N N 219 LEU CB CG sing N N 220 LEU CB HB2 sing N N 221 LEU CB HB3 sing N N 222 LEU CG CD1 sing N N 223 LEU CG CD2 sing N N 224 LEU CG HG sing N N 225 LEU CD1 HD11 sing N N 226 LEU CD1 HD12 sing N N 227 LEU CD1 HD13 sing N N 228 LEU CD2 HD21 sing N N 229 LEU CD2 HD22 sing N N 230 LEU CD2 HD23 sing N N 231 LEU OXT HXT sing N N 232 LYS N CA sing N N 233 LYS N H sing N N 234 LYS N H2 sing N N 235 LYS CA C sing N N 236 LYS CA CB sing N N 237 LYS CA HA sing N N 238 LYS C O doub N N 239 LYS C OXT sing N N 240 LYS CB CG sing N N 241 LYS CB HB2 sing N N 242 LYS CB HB3 sing N N 243 LYS CG CD sing N N 244 LYS CG HG2 sing N N 245 LYS CG HG3 sing N N 246 LYS CD CE sing N N 247 LYS CD HD2 sing N N 248 LYS CD HD3 sing N N 249 LYS CE NZ sing N N 250 LYS CE HE2 sing N N 251 LYS CE HE3 sing N N 252 LYS NZ HZ1 sing N N 253 LYS NZ HZ2 sing N N 254 LYS NZ HZ3 sing N N 255 LYS OXT HXT sing N N 256 MET N CA sing N N 257 MET N H sing N N 258 MET N H2 sing N N 259 MET CA C sing N N 260 MET CA CB sing N N 261 MET CA HA sing N N 262 MET C O doub N N 263 MET C OXT sing N N 264 MET CB CG sing N N 265 MET CB HB2 sing N N 266 MET CB HB3 sing N N 267 MET CG SD sing N N 268 MET CG HG2 sing N N 269 MET CG HG3 sing N N 270 MET SD CE sing N N 271 MET CE HE1 sing N N 272 MET CE HE2 sing N N 273 MET CE HE3 sing N N 274 MET OXT HXT sing N N 275 PHE N CA sing N N 276 PHE N H sing N N 277 PHE N H2 sing N N 278 PHE CA C sing N N 279 PHE CA CB sing N N 280 PHE CA HA sing N N 281 PHE C O doub N N 282 PHE C OXT sing N N 283 PHE CB CG sing N N 284 PHE CB HB2 sing N N 285 PHE CB HB3 sing N N 286 PHE CG CD1 doub Y N 287 PHE CG CD2 sing Y N 288 PHE CD1 CE1 sing Y N 289 PHE CD1 HD1 sing N N 290 PHE CD2 CE2 doub Y N 291 PHE CD2 HD2 sing N N 292 PHE CE1 CZ doub Y N 293 PHE CE1 HE1 sing N N 294 PHE CE2 CZ sing Y N 295 PHE CE2 HE2 sing N N 296 PHE CZ HZ sing N N 297 PHE OXT HXT sing N N 298 PRO N CA sing N N 299 PRO N CD sing N N 300 PRO N H sing N N 301 PRO CA C sing N N 302 PRO CA CB sing N N 303 PRO CA HA sing N N 304 PRO C O doub N N 305 PRO C OXT sing N N 306 PRO CB CG sing N N 307 PRO CB HB2 sing N N 308 PRO CB HB3 sing N N 309 PRO CG CD sing N N 310 PRO CG HG2 sing N N 311 PRO CG HG3 sing N N 312 PRO CD HD2 sing N N 313 PRO CD HD3 sing N N 314 PRO OXT HXT sing N N 315 SER N CA sing N N 316 SER N H sing N N 317 SER N H2 sing N N 318 SER CA C sing N N 319 SER CA CB sing N N 320 SER CA HA sing N N 321 SER C O doub N N 322 SER C OXT sing N N 323 SER CB OG sing N N 324 SER CB HB2 sing N N 325 SER CB HB3 sing N N 326 SER OG HG sing N N 327 SER OXT HXT sing N N 328 SO4 S O1 doub N N 329 SO4 S O2 doub N N 330 SO4 S O3 sing N N 331 SO4 S O4 sing N N 332 THR N CA sing N N 333 THR N H sing N N 334 THR N H2 sing N N 335 THR CA C sing N N 336 THR CA CB sing N N 337 THR CA HA sing N N 338 THR C O doub N N 339 THR C OXT sing N N 340 THR CB OG1 sing N N 341 THR CB CG2 sing N N 342 THR CB HB sing N N 343 THR OG1 HG1 sing N N 344 THR CG2 HG21 sing N N 345 THR CG2 HG22 sing N N 346 THR CG2 HG23 sing N N 347 THR OXT HXT sing N N 348 TRP N CA sing N N 349 TRP N H sing N N 350 TRP N H2 sing N N 351 TRP CA C sing N N 352 TRP CA CB sing N N 353 TRP CA HA sing N N 354 TRP C O doub N N 355 TRP C OXT sing N N 356 TRP CB CG sing N N 357 TRP CB HB2 sing N N 358 TRP CB HB3 sing N N 359 TRP CG CD1 doub Y N 360 TRP CG CD2 sing Y N 361 TRP CD1 NE1 sing Y N 362 TRP CD1 HD1 sing N N 363 TRP CD2 CE2 doub Y N 364 TRP CD2 CE3 sing Y N 365 TRP NE1 CE2 sing Y N 366 TRP NE1 HE1 sing N N 367 TRP CE2 CZ2 sing Y N 368 TRP CE3 CZ3 doub Y N 369 TRP CE3 HE3 sing N N 370 TRP CZ2 CH2 doub Y N 371 TRP CZ2 HZ2 sing N N 372 TRP CZ3 CH2 sing Y N 373 TRP CZ3 HZ3 sing N N 374 TRP CH2 HH2 sing N N 375 TRP OXT HXT sing N N 376 TYR N CA sing N N 377 TYR N H sing N N 378 TYR N H2 sing N N 379 TYR CA C sing N N 380 TYR CA CB sing N N 381 TYR CA HA sing N N 382 TYR C O doub N N 383 TYR C OXT sing N N 384 TYR CB CG sing N N 385 TYR CB HB2 sing N N 386 TYR CB HB3 sing N N 387 TYR CG CD1 doub Y N 388 TYR CG CD2 sing Y N 389 TYR CD1 CE1 sing Y N 390 TYR CD1 HD1 sing N N 391 TYR CD2 CE2 doub Y N 392 TYR CD2 HD2 sing N N 393 TYR CE1 CZ doub Y N 394 TYR CE1 HE1 sing N N 395 TYR CE2 CZ sing Y N 396 TYR CE2 HE2 sing N N 397 TYR CZ OH sing N N 398 TYR OH HH sing N N 399 TYR OXT HXT sing N N 400 VAL N CA sing N N 401 VAL N H sing N N 402 VAL N H2 sing N N 403 VAL CA C sing N N 404 VAL CA CB sing N N 405 VAL CA HA sing N N 406 VAL C O doub N N 407 VAL C OXT sing N N 408 VAL CB CG1 sing N N 409 VAL CB CG2 sing N N 410 VAL CB HB sing N N 411 VAL CG1 HG11 sing N N 412 VAL CG1 HG12 sing N N 413 VAL CG1 HG13 sing N N 414 VAL CG2 HG21 sing N N 415 VAL CG2 HG22 sing N N 416 VAL CG2 HG23 sing N N 417 VAL OXT HXT sing N N 418 # _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 GLYCEROL GOL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7SOO _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 #