data_7T28 # _entry.id 7T28 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7T28 pdb_00007t28 10.2210/pdb7t28/pdb WWPDB D_1000261539 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-20 2 'Structure model' 1 1 2022-06-01 3 'Structure model' 1 2 2024-02-28 4 'Structure model' 1 3 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7T28 _pdbx_database_status.recvd_initial_deposition_date 2021-12-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email philip.kranzusch@gmail.com _pdbx_contact_author.name_first Philip _pdbx_contact_author.name_last Kranzusch _pdbx_contact_author.name_mi J. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4943-733X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hobbs, S.J.' 1 ? 'Wein, T.' 2 ? 'Lu, A.' 3 ? 'Morehouse, B.R.' 4 ? 'Schnabel, J.' 5 ? 'Sorek, R.' 6 ? 'Kranzusch, P.J.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 605 _citation.language ? _citation.page_first 522 _citation.page_last 526 _citation.title 'Phage anti-CBASS and anti-Pycsar nucleases subvert bacterial immunity.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-022-04716-y _citation.pdbx_database_id_PubMed 35395152 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hobbs, S.J.' 1 ? primary 'Wein, T.' 2 ? primary 'Lu, A.' 3 ? primary 'Morehouse, B.R.' 4 ? primary 'Schnabel, J.' 5 ? primary 'Leavitt, A.' 6 ? primary 'Yirmiya, E.' 7 ? primary 'Sorek, R.' 8 ? primary 'Kranzusch, P.J.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative metal-dependent hydrolase' 29169.730 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 36 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMLHTTQIRMVGTGSAFSKKFYNNSALVTFTNGYNLLIDCGHSVPKGLHDADIPLESIDGILITHTHADHIGGLEEVALY NKFVLGGRKIDLLVPNTLVESLWENSLKGGLRYSDTYDDLSLSDYFTVRSLKTFTSGAARTQLEENIAIKLYPTFHVSHM ASYAVGLEDRGEDKVFYSSDTIFDEYLIDYALTYSWVFHDCQFFTGGVHASLDELLNYIPEEDQDRVFLMHYGDNMEDFF TKTGRMRFALQGRTYIL ; _entity_poly.pdbx_seq_one_letter_code_can ;SMLHTTQIRMVGTGSAFSKKFYNNSALVTFTNGYNLLIDCGHSVPKGLHDADIPLESIDGILITHTHADHIGGLEEVALY NKFVLGGRKIDLLVPNTLVESLWENSLKGGLRYSDTYDDLSLSDYFTVRSLKTFTSGAARTQLEENIAIKLYPTFHVSHM ASYAVGLEDRGEDKVFYSSDTIFDEYLIDYALTYSWVFHDCQFFTGGVHASLDELLNYIPEEDQDRVFLMHYGDNMEDFF TKTGRMRFALQGRTYIL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 LEU n 1 4 HIS n 1 5 THR n 1 6 THR n 1 7 GLN n 1 8 ILE n 1 9 ARG n 1 10 MET n 1 11 VAL n 1 12 GLY n 1 13 THR n 1 14 GLY n 1 15 SER n 1 16 ALA n 1 17 PHE n 1 18 SER n 1 19 LYS n 1 20 LYS n 1 21 PHE n 1 22 TYR n 1 23 ASN n 1 24 ASN n 1 25 SER n 1 26 ALA n 1 27 LEU n 1 28 VAL n 1 29 THR n 1 30 PHE n 1 31 THR n 1 32 ASN n 1 33 GLY n 1 34 TYR n 1 35 ASN n 1 36 LEU n 1 37 LEU n 1 38 ILE n 1 39 ASP n 1 40 CYS n 1 41 GLY n 1 42 HIS n 1 43 SER n 1 44 VAL n 1 45 PRO n 1 46 LYS n 1 47 GLY n 1 48 LEU n 1 49 HIS n 1 50 ASP n 1 51 ALA n 1 52 ASP n 1 53 ILE n 1 54 PRO n 1 55 LEU n 1 56 GLU n 1 57 SER n 1 58 ILE n 1 59 ASP n 1 60 GLY n 1 61 ILE n 1 62 LEU n 1 63 ILE n 1 64 THR n 1 65 HIS n 1 66 THR n 1 67 HIS n 1 68 ALA n 1 69 ASP n 1 70 HIS n 1 71 ILE n 1 72 GLY n 1 73 GLY n 1 74 LEU n 1 75 GLU n 1 76 GLU n 1 77 VAL n 1 78 ALA n 1 79 LEU n 1 80 TYR n 1 81 ASN n 1 82 LYS n 1 83 PHE n 1 84 VAL n 1 85 LEU n 1 86 GLY n 1 87 GLY n 1 88 ARG n 1 89 LYS n 1 90 ILE n 1 91 ASP n 1 92 LEU n 1 93 LEU n 1 94 VAL n 1 95 PRO n 1 96 ASN n 1 97 THR n 1 98 LEU n 1 99 VAL n 1 100 GLU n 1 101 SER n 1 102 LEU n 1 103 TRP n 1 104 GLU n 1 105 ASN n 1 106 SER n 1 107 LEU n 1 108 LYS n 1 109 GLY n 1 110 GLY n 1 111 LEU n 1 112 ARG n 1 113 TYR n 1 114 SER n 1 115 ASP n 1 116 THR n 1 117 TYR n 1 118 ASP n 1 119 ASP n 1 120 LEU n 1 121 SER n 1 122 LEU n 1 123 SER n 1 124 ASP n 1 125 TYR n 1 126 PHE n 1 127 THR n 1 128 VAL n 1 129 ARG n 1 130 SER n 1 131 LEU n 1 132 LYS n 1 133 THR n 1 134 PHE n 1 135 THR n 1 136 SER n 1 137 GLY n 1 138 ALA n 1 139 ALA n 1 140 ARG n 1 141 THR n 1 142 GLN n 1 143 LEU n 1 144 GLU n 1 145 GLU n 1 146 ASN n 1 147 ILE n 1 148 ALA n 1 149 ILE n 1 150 LYS n 1 151 LEU n 1 152 TYR n 1 153 PRO n 1 154 THR n 1 155 PHE n 1 156 HIS n 1 157 VAL n 1 158 SER n 1 159 HIS n 1 160 MET n 1 161 ALA n 1 162 SER n 1 163 TYR n 1 164 ALA n 1 165 VAL n 1 166 GLY n 1 167 LEU n 1 168 GLU n 1 169 ASP n 1 170 ARG n 1 171 GLY n 1 172 GLU n 1 173 ASP n 1 174 LYS n 1 175 VAL n 1 176 PHE n 1 177 TYR n 1 178 SER n 1 179 SER n 1 180 ASP n 1 181 THR n 1 182 ILE n 1 183 PHE n 1 184 ASP n 1 185 GLU n 1 186 TYR n 1 187 LEU n 1 188 ILE n 1 189 ASP n 1 190 TYR n 1 191 ALA n 1 192 LEU n 1 193 THR n 1 194 TYR n 1 195 SER n 1 196 TRP n 1 197 VAL n 1 198 PHE n 1 199 HIS n 1 200 ASP n 1 201 CYS n 1 202 GLN n 1 203 PHE n 1 204 PHE n 1 205 THR n 1 206 GLY n 1 207 GLY n 1 208 VAL n 1 209 HIS n 1 210 ALA n 1 211 SER n 1 212 LEU n 1 213 ASP n 1 214 GLU n 1 215 LEU n 1 216 LEU n 1 217 ASN n 1 218 TYR n 1 219 ILE n 1 220 PRO n 1 221 GLU n 1 222 GLU n 1 223 ASP n 1 224 GLN n 1 225 ASP n 1 226 ARG n 1 227 VAL n 1 228 PHE n 1 229 LEU n 1 230 MET n 1 231 HIS n 1 232 TYR n 1 233 GLY n 1 234 ASP n 1 235 ASN n 1 236 MET n 1 237 GLU n 1 238 ASP n 1 239 PHE n 1 240 PHE n 1 241 THR n 1 242 LYS n 1 243 THR n 1 244 GLY n 1 245 ARG n 1 246 MET n 1 247 ARG n 1 248 PHE n 1 249 ALA n 1 250 LEU n 1 251 GLN n 1 252 GLY n 1 253 ARG n 1 254 THR n 1 255 TYR n 1 256 ILE n 1 257 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 257 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BSP38_126 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus phage BSP38' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2283013 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 MET 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 TRP 103 103 103 TRP TRP A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 TYR 117 117 ? ? ? A . n A 1 118 ASP 118 118 ? ? ? A . n A 1 119 ASP 119 119 ? ? ? A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ASP 180 180 ? ? ? A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 ASP 184 184 184 ASP ASP A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 TYR 190 190 ? ? ? A . n A 1 191 ALA 191 191 ? ? ? A . n A 1 192 LEU 192 192 ? ? ? A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 TYR 194 194 194 TYR TYR A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 TRP 196 196 196 TRP TRP A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 CYS 201 201 201 CYS CYS A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 HIS 209 209 209 HIS HIS A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 GLN 224 224 224 GLN GLN A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 MET 230 230 230 MET MET A . n A 1 231 HIS 231 231 231 HIS HIS A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 ASN 235 235 235 ASN ASN A . n A 1 236 MET 236 236 236 MET MET A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 PHE 239 239 ? ? ? A . n A 1 240 PHE 240 240 ? ? ? A . n A 1 241 THR 241 241 ? ? ? A . n A 1 242 LYS 242 242 ? ? ? A . n A 1 243 THR 243 243 ? ? ? A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 MET 246 246 246 MET MET A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 PHE 248 248 248 PHE PHE A . n A 1 249 ALA 249 249 249 ALA ALA A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 GLN 251 251 251 GLN GLN A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 ARG 253 253 253 ARG ARG A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 TYR 255 255 255 TYR TYR A . n A 1 256 ILE 256 256 ? ? ? A . n A 1 257 LEU 257 257 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 5 ZN ZN A . C 2 ZN 1 302 6 ZN ZN A . D 3 HOH 1 401 36 HOH HOH A . D 3 HOH 2 402 16 HOH HOH A . D 3 HOH 3 403 25 HOH HOH A . D 3 HOH 4 404 18 HOH HOH A . D 3 HOH 5 405 30 HOH HOH A . D 3 HOH 6 406 3 HOH HOH A . D 3 HOH 7 407 19 HOH HOH A . D 3 HOH 8 408 13 HOH HOH A . D 3 HOH 9 409 6 HOH HOH A . D 3 HOH 10 410 12 HOH HOH A . D 3 HOH 11 411 20 HOH HOH A . D 3 HOH 12 412 32 HOH HOH A . D 3 HOH 13 413 14 HOH HOH A . D 3 HOH 14 414 35 HOH HOH A . D 3 HOH 15 415 34 HOH HOH A . D 3 HOH 16 416 10 HOH HOH A . D 3 HOH 17 417 7 HOH HOH A . D 3 HOH 18 418 11 HOH HOH A . D 3 HOH 19 419 17 HOH HOH A . D 3 HOH 20 420 4 HOH HOH A . D 3 HOH 21 421 22 HOH HOH A . D 3 HOH 22 422 15 HOH HOH A . D 3 HOH 23 423 2 HOH HOH A . D 3 HOH 24 424 33 HOH HOH A . D 3 HOH 25 425 21 HOH HOH A . D 3 HOH 26 426 5 HOH HOH A . D 3 HOH 27 427 8 HOH HOH A . D 3 HOH 28 428 29 HOH HOH A . D 3 HOH 29 429 26 HOH HOH A . D 3 HOH 30 430 27 HOH HOH A . D 3 HOH 31 431 9 HOH HOH A . D 3 HOH 32 432 23 HOH HOH A . D 3 HOH 33 433 24 HOH HOH A . D 3 HOH 34 434 28 HOH HOH A . D 3 HOH 35 435 1 HOH HOH A . D 3 HOH 36 436 31 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7T28 _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.485 _cell.length_a_esd ? _cell.length_b 82.485 _cell.length_b_esd ? _cell.length_c 76.098 _cell.length_c_esd ? _cell.volume 448387.846 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7T28 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7T28 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.56 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.99 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M lithium sulfate, 0.1 M Tris-HCl pH 7.5, 30% PEG-4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-10-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 76.17 _reflns.entry_id 7T28 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.68 _reflns.d_resolution_low 38.42 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8581 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.071 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1129 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.732 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.883 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 107.29 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7T28 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.68 _refine.ls_d_res_low 36.26 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8581 _refine.ls_number_reflns_R_free 850 _refine.ls_number_reflns_R_work 7731 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.18 _refine.ls_percent_reflns_R_free 9.91 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3021 _refine.ls_R_factor_R_free 0.3197 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3001 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model Alphafold2 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 44.5205 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5493 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.68 _refine_hist.d_res_low 36.26 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 1934 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1896 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0017 ? 1937 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4838 ? 2618 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0393 ? 289 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0029 ? 334 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.5717 ? 684 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.68 2.84 . . 129 1167 90.88 . . . 0.4095 . 0.3959 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.85 3.06 . . 140 1279 99.02 . . . 0.4625 . 0.3904 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.07 3.37 . . 141 1293 99.51 . . . 0.4153 . 0.3715 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.37 3.86 . . 148 1299 99.86 . . . 0.3235 . 0.3276 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.86 4.86 . . 142 1307 99.66 . . . 0.2496 . 0.2717 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.86 36.26 . . 150 1386 99.93 . . . 0.3108 . 0.2685 . . . . . . . . . . . # _struct.entry_id 7T28 _struct.title 'Structure of phage Bsp38 anti-Pycsar nuclease Apyc1 in apo state' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7T28 _struct_keywords.text 'Anti-Pycsar, Nuclease, Immune evasion, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A345MJY6_9CAUD _struct_ref.pdbx_db_accession A0A345MJY6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLHTTQIRMVGTGSAFSKKFYNNSALVTFTNGYNLLIDCGHSVPKGLHDADIPLESIDGILITHTHADHIGGLEEVALYN KFVLGGRKIDLLVPNTLVESLWENSLKGGLRYSDTYDDLSLSDYFTVRSLKTFTSGAARTQLEENIAIKLYPTFHVSHMA SYAVGLEDRGEDKVFYSSDTIFDEYLIDYALTYSWVFHDCQFFTGGVHASLDELLNYIPEEDQDRVFLMHYGDNMEDFFT KTGRMRFALQGRTYIL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7T28 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 257 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A345MJY6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 256 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 257 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7T28 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A345MJY6 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2470 ? 1 MORE -170 ? 1 'SSA (A^2)' 22040 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_554 x-y,-y,-z-2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -50.7320000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 43 ? ALA A 51 ? SER A 43 ALA A 51 1 ? 9 HELX_P HELX_P2 AA2 PRO A 54 ? ILE A 58 ? PRO A 54 ILE A 58 5 ? 5 HELX_P HELX_P3 AA3 HIS A 67 ? GLY A 72 ? HIS A 67 GLY A 72 1 ? 6 HELX_P HELX_P4 AA4 GLY A 73 ? VAL A 84 ? GLY A 73 VAL A 84 1 ? 12 HELX_P HELX_P5 AA5 VAL A 99 ? GLU A 104 ? VAL A 99 GLU A 104 1 ? 6 HELX_P HELX_P6 AA6 SER A 121 ? TYR A 125 ? SER A 121 TYR A 125 5 ? 5 HELX_P HELX_P7 AA7 SER A 211 ? ASN A 217 ? SER A 211 ASN A 217 1 ? 7 HELX_P HELX_P8 AA8 GLU A 222 ? ASP A 225 ? GLU A 222 ASP A 225 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 65 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 65 A ZN 301 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc2 metalc ? ? A HIS 70 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 70 A ZN 302 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc3 metalc ? ? A HIS 156 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 156 A ZN 301 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc4 metalc ? ? A HIS 231 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 231 A ZN 302 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 301 A HOH 431 1_555 ? ? ? ? ? ? ? 2.394 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 156 ? A HIS 156 ? 1_555 92.2 ? 2 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 431 ? 1_555 109.4 ? 3 NE2 ? A HIS 156 ? A HIS 156 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 431 ? 1_555 133.6 ? 4 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 231 ? A HIS 231 ? 1_555 125.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA2 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 7 ? GLY A 12 ? GLN A 7 GLY A 12 AA1 2 SER A 25 ? THR A 29 ? SER A 25 THR A 29 AA1 3 ASN A 35 ? ILE A 38 ? ASN A 35 ILE A 38 AA1 4 GLY A 60 ? LEU A 62 ? GLY A 60 LEU A 62 AA1 5 ASP A 91 ? PRO A 95 ? ASP A 91 PRO A 95 AA1 6 THR A 127 ? LEU A 131 ? THR A 127 LEU A 131 AA2 1 ALA A 139 ? GLN A 142 ? ALA A 139 GLN A 142 AA2 2 ILE A 147 ? THR A 154 ? ILE A 147 THR A 154 AA2 3 SER A 162 ? ASP A 169 ? SER A 162 ASP A 169 AA2 4 GLU A 172 ? TYR A 177 ? GLU A 172 TYR A 177 AA2 5 TRP A 196 ? ASP A 200 ? TRP A 196 ASP A 200 AA2 6 VAL A 227 ? MET A 230 ? VAL A 227 MET A 230 AA2 7 ARG A 247 ? PHE A 248 ? ARG A 247 PHE A 248 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 9 ? N ARG A 9 O LEU A 27 ? O LEU A 27 AA1 2 3 N VAL A 28 ? N VAL A 28 O LEU A 36 ? O LEU A 36 AA1 3 4 N LEU A 37 ? N LEU A 37 O LEU A 62 ? O LEU A 62 AA1 4 5 N ILE A 61 ? N ILE A 61 O LEU A 93 ? O LEU A 93 AA1 5 6 N VAL A 94 ? N VAL A 94 O LEU A 131 ? O LEU A 131 AA2 1 2 N ALA A 139 ? N ALA A 139 O LEU A 151 ? O LEU A 151 AA2 2 3 N TYR A 152 ? N TYR A 152 O ALA A 164 ? O ALA A 164 AA2 3 4 N VAL A 165 ? N VAL A 165 O TYR A 177 ? O TYR A 177 AA2 4 5 N PHE A 176 ? N PHE A 176 O PHE A 198 ? O PHE A 198 AA2 5 6 N HIS A 199 ? N HIS A 199 O PHE A 228 ? O PHE A 228 AA2 6 7 N VAL A 227 ? N VAL A 227 O ARG A 247 ? O ARG A 247 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 58 ? ? O A HOH 401 ? ? 2.07 2 1 NH1 A ARG 88 ? ? O A HOH 401 ? ? 2.11 3 1 O A SER 130 ? ? O A HOH 402 ? ? 2.13 4 1 O A ILE 90 ? ? O A HOH 403 ? ? 2.14 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 405 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 429 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 1.94 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 39 ? ? 68.46 139.23 2 1 ASN A 105 ? ? -104.64 -65.21 3 1 SER A 114 ? ? -118.01 68.70 4 1 SER A 121 ? ? -125.09 -166.87 5 1 GLU A 144 ? ? -116.03 -141.51 6 1 HIS A 156 ? ? -113.88 -80.38 7 1 ARG A 170 ? ? 38.08 41.76 8 1 ILE A 219 ? ? -142.07 -29.66 9 1 PRO A 220 ? ? -68.71 84.06 10 1 GLU A 221 ? ? -163.92 -0.97 11 1 GLU A 237 ? ? -47.98 81.89 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 434 ? D HOH . 2 1 A HOH 435 ? D HOH . 3 1 A HOH 436 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # _pdbx_entry_details.entry_id 7T28 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A MET 2 ? A MET 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A TYR 117 ? A TYR 117 7 1 Y 1 A ASP 118 ? A ASP 118 8 1 Y 1 A ASP 119 ? A ASP 119 9 1 Y 1 A ASP 180 ? A ASP 180 10 1 Y 1 A TYR 190 ? A TYR 190 11 1 Y 1 A ALA 191 ? A ALA 191 12 1 Y 1 A LEU 192 ? A LEU 192 13 1 Y 1 A PHE 239 ? A PHE 239 14 1 Y 1 A PHE 240 ? A PHE 240 15 1 Y 1 A THR 241 ? A THR 241 16 1 Y 1 A LYS 242 ? A LYS 242 17 1 Y 1 A THR 243 ? A THR 243 18 1 Y 1 A ILE 256 ? A ILE 256 19 1 Y 1 A LEU 257 ? A LEU 257 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1DP2GM146250-01 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.details Alphafold2 # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 7T28 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012123 _atom_sites.fract_transf_matrix[1][2] 0.006999 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013999 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013141 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_