data_7T8J # _entry.id 7T8J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7T8J pdb_00007t8j 10.2210/pdb7t8j/pdb WWPDB D_1000258772 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7T8J _pdbx_database_status.recvd_initial_deposition_date 2021-12-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Soleimani, S.' 1 0000-0001-8676-8966 'Pedroza Romo, M.J.' 2 0000-0002-7441-3874 'Smith, T.' 3 0000-0001-7960-7320 'Brown, S.' 4 0000-0003-2888-7208 'Doukov, T.' 5 0000-0001-8625-2572 'Moody, J.D.' 6 0000-0003-2266-5348 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 31 _citation.language ? _citation.page_first 1589 _citation.page_last ? _citation.title 'Fusion crystallization reveals the behavior of both the 1TEL crystallization chaperone and the TNK1 UBA domain.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2023.09.001 _citation.pdbx_database_id_PubMed 37776857 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nawarathnage, S.' 1 ? primary 'Tseng, Y.J.' 2 ? primary 'Soleimani, S.' 3 ? primary 'Smith, T.' 4 ? primary 'Pedroza Romo, M.J.' 5 ? primary 'Abiodun, W.O.' 6 ? primary 'Egbert, C.M.' 7 ? primary 'Madhusanka, D.' 8 ? primary 'Bunn, D.' 9 ? primary 'Woods, B.' 10 ? primary 'Tsubaki, E.' 11 ? primary 'Stewart, C.' 12 ? primary 'Brown, S.' 13 ? primary 'Doukov, T.' 14 ? primary 'Andersen, J.L.' 15 ? primary 'Moody, J.D.' 16 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7T8J _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.651 _cell.length_a_esd ? _cell.length_b 68.651 _cell.length_b_esd ? _cell.length_c 56.735 _cell.length_c_esd ? _cell.volume 231566.337 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7T8J _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall 'P 65' _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1' 17919.182 1 2.7.10.2 R80S,V112E,C610A,C644A ? ? 2 non-polymer nat 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ETS translocation variant 6,ETS-related protein Tel1,Tel,CD38 negative kinase 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILGSGG ELQRKIMEVELSVHGVTHQEAQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADAWRILEHYQWDLSAASRYVLARP ; _entity_poly.pdbx_seq_one_letter_code_can ;GSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILGSGG ELQRKIMEVELSVHGVTHQEAQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADAWRILEHYQWDLSAASRYVLARP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ILE n 1 4 ARG n 1 5 LEU n 1 6 PRO n 1 7 ALA n 1 8 HIS n 1 9 LEU n 1 10 ARG n 1 11 LEU n 1 12 GLN n 1 13 PRO n 1 14 ILE n 1 15 TYR n 1 16 TRP n 1 17 SER n 1 18 ARG n 1 19 ASP n 1 20 ASP n 1 21 VAL n 1 22 ALA n 1 23 GLN n 1 24 TRP n 1 25 LEU n 1 26 LYS n 1 27 TRP n 1 28 ALA n 1 29 GLU n 1 30 ASN n 1 31 GLU n 1 32 PHE n 1 33 SER n 1 34 LEU n 1 35 SER n 1 36 PRO n 1 37 ILE n 1 38 ASP n 1 39 SER n 1 40 ASN n 1 41 THR n 1 42 PHE n 1 43 GLU n 1 44 MET n 1 45 ASN n 1 46 GLY n 1 47 LYS n 1 48 ALA n 1 49 LEU n 1 50 LEU n 1 51 LEU n 1 52 LEU n 1 53 THR n 1 54 LYS n 1 55 GLU n 1 56 ASP n 1 57 PHE n 1 58 ARG n 1 59 TYR n 1 60 ARG n 1 61 SER n 1 62 PRO n 1 63 HIS n 1 64 SER n 1 65 GLY n 1 66 ASP n 1 67 GLU n 1 68 LEU n 1 69 TYR n 1 70 GLU n 1 71 LEU n 1 72 LEU n 1 73 GLN n 1 74 HIS n 1 75 ILE n 1 76 LEU n 1 77 GLY n 1 78 SER n 1 79 GLY n 1 80 GLY n 1 81 GLU n 1 82 LEU n 1 83 GLN n 1 84 ARG n 1 85 LYS n 1 86 ILE n 1 87 MET n 1 88 GLU n 1 89 VAL n 1 90 GLU n 1 91 LEU n 1 92 SER n 1 93 VAL n 1 94 HIS n 1 95 GLY n 1 96 VAL n 1 97 THR n 1 98 HIS n 1 99 GLN n 1 100 GLU n 1 101 ALA n 1 102 GLN n 1 103 THR n 1 104 ALA n 1 105 LEU n 1 106 GLY n 1 107 ALA n 1 108 THR n 1 109 GLY n 1 110 GLY n 1 111 ASP n 1 112 VAL n 1 113 VAL n 1 114 SER n 1 115 ALA n 1 116 ILE n 1 117 ARG n 1 118 ASN n 1 119 LEU n 1 120 LYS n 1 121 VAL n 1 122 ASP n 1 123 GLN n 1 124 LEU n 1 125 PHE n 1 126 HIS n 1 127 LEU n 1 128 SER n 1 129 SER n 1 130 ARG n 1 131 SER n 1 132 ARG n 1 133 ALA n 1 134 ASP n 1 135 ALA n 1 136 TRP n 1 137 ARG n 1 138 ILE n 1 139 LEU n 1 140 GLU n 1 141 HIS n 1 142 TYR n 1 143 GLN n 1 144 TRP n 1 145 ASP n 1 146 LEU n 1 147 SER n 1 148 ALA n 1 149 ALA n 1 150 SER n 1 151 ARG n 1 152 TYR n 1 153 VAL n 1 154 LEU n 1 155 ALA n 1 156 ARG n 1 157 PRO n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 76 human ? 'ETV6, TEL, TEL1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? B ? ? ? ? ? ? ? ? ? 'N-term cleavable 10xHis-SUMO tag' ? pET42_SUMO ? ? 1 2 sample 'Biological sequence' 77 157 human ? TNK1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? B ? ? ? ? ? ? ? ? ? 'N-term cleavable 10xHis-SUMO tag' ? pET42_SUMO ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ETV6_HUMAN P41212 ? 1 SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHIL 47 2 UNP TNK1_HUMAN Q13470 ? 1 ELQRKIMEVELSVHGVTHQECQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADCWRILEHYQWDLSAASRYVLARP 590 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7T8J A 2 ? 76 ? P41212 47 ? 121 ? 2 76 2 2 7T8J A 81 ? 157 ? Q13470 590 ? 666 ? 81 157 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7T8J GLY A 1 ? UNP P41212 ? ? 'expression tag' 1 1 1 7T8J SER A 35 ? UNP P41212 ARG 80 'engineered mutation' 35 2 1 7T8J GLU A 67 ? UNP P41212 VAL 112 'engineered mutation' 67 3 1 7T8J GLY A 77 ? UNP P41212 ? ? linker 77 4 1 7T8J SER A 78 ? UNP P41212 ? ? linker 78 5 1 7T8J GLY A 79 ? UNP P41212 ? ? linker 79 6 1 7T8J GLY A 80 ? UNP P41212 ? ? linker 80 7 2 7T8J ALA A 101 ? UNP Q13470 CYS 610 'engineered mutation' 101 8 2 7T8J ALA A 135 ? UNP Q13470 CYS 644 'engineered mutation' 135 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7T8J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.06 _exptl_crystal.description 'Teardrop with hexagonal cross-section' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.2 uL of 1 mg/mL protein in 50 mM Tris pH 8.8, 200 mM KCl combined with 1.2 uL of 100 mM Bis-tris-propane, 2.5 M Ammonium Nitrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Mirror: Rh coated flat bent M0, toroidal focusing post-monochromator M1' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111) and Si(220) double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 39.92 _reflns.entry_id 7T8J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.89 _reflns.d_resolution_low 34.33 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12236 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.92 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14 _reflns.pdbx_Rmerge_I_obs 0.06456 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 20.93 _reflns.pdbx_netI_over_sigmaI 20.93 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06703 _reflns.pdbx_Rpim_I_all 0.0179 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.89 _reflns_shell.d_res_low 1.959 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.59 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1208 _reflns_shell.percent_possible_all 100.00 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.631 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 14.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.99 _reflns_shell.pdbx_Rpim_I_all 0.4415 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.903 _reflns_shell.pdbx_CC_star 0.974 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.32 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7T8J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.89 _refine.ls_d_res_low 34.33 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12228 _refine.ls_number_reflns_R_free 595 _refine.ls_number_reflns_R_work 11633 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 4.87 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2243 _refine.ls_R_factor_R_free 0.2347 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2238 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7TCY _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.0752 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1493 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.89 _refine_hist.d_res_low 34.33 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1115 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1095 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0033 ? 1121 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5444 ? 1524 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0365 ? 173 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0036 ? 191 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.8708 ? 375 ? f_dihedral_angle_d ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.89 _refine_ls_shell.d_res_low 2.08 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 147 _refine_ls_shell.number_reflns_R_work 2887 _refine_ls_shell.percent_reflns_obs 99.93 _refine_ls_shell.percent_reflns_R_free 4.05 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3643 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3068 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7T8J _struct.title ;The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1TEL crystallization chaperone via a GSGG linker ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7T8J _struct_keywords.text 'Protein polymer, Ubiquitin-associated domain, Helix bundle, Chimera, ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 12 ? TRP A 16 ? GLN A 12 TRP A 16 5 ? 5 HELX_P HELX_P2 AA2 SER A 17 ? PHE A 32 ? SER A 17 PHE A 32 1 ? 16 HELX_P HELX_P3 AA3 ASP A 38 ? PHE A 42 ? ASP A 38 PHE A 42 5 ? 5 HELX_P HELX_P4 AA4 ASN A 45 ? LEU A 52 ? ASN A 45 LEU A 52 1 ? 8 HELX_P HELX_P5 AA5 THR A 53 ? SER A 61 ? THR A 53 SER A 61 1 ? 9 HELX_P HELX_P6 AA6 SER A 64 ? GLY A 77 ? SER A 64 GLY A 77 1 ? 14 HELX_P HELX_P7 AA7 LEU A 82 ? LEU A 91 ? LEU A 82 LEU A 91 1 ? 10 HELX_P HELX_P8 AA8 THR A 97 ? THR A 108 ? THR A 97 THR A 108 1 ? 12 HELX_P HELX_P9 AA9 ASP A 111 ? HIS A 126 ? ASP A 111 HIS A 126 1 ? 16 HELX_P HELX_P10 AB1 SER A 131 ? TYR A 142 ? SER A 131 TYR A 142 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7T8J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014566 _atom_sites.fract_transf_matrix[1][2] 0.008410 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016820 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017626 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? ? ? ? ? ? ? ? ? ? ? ? H ? ? ? ? ? ? ? ? ? ? ? ? ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 SER 78 78 78 SER GLY A . n A 1 79 GLY 79 79 ? ? ? A . n A 1 80 GLY 80 80 ? ? ? A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 TRP 136 136 136 TRP TRP A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 TRP 144 144 144 TRP TRP A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 TYR 152 152 ? ? ? A . n A 1 153 VAL 153 153 ? ? ? A . n A 1 154 LEU 154 154 ? ? ? A . n A 1 155 ALA 155 155 ? ? ? A . n A 1 156 ARG 156 156 ? ? ? A . n A 1 157 PRO 157 157 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email jdmoody@chem.byu.edu _pdbx_contact_author.name_first James _pdbx_contact_author.name_last Moody _pdbx_contact_author.name_mi D _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2266-5348 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 201 1 CL CL A . C 3 HOH 1 301 20 HOH HOH A . C 3 HOH 2 302 26 HOH HOH A . C 3 HOH 3 303 4 HOH HOH A . C 3 HOH 4 304 23 HOH HOH A . C 3 HOH 5 305 29 HOH HOH A . C 3 HOH 6 306 34 HOH HOH A . C 3 HOH 7 307 5 HOH HOH A . C 3 HOH 8 308 15 HOH HOH A . C 3 HOH 9 309 22 HOH HOH A . C 3 HOH 10 310 12 HOH HOH A . C 3 HOH 11 311 6 HOH HOH A . C 3 HOH 12 312 35 HOH HOH A . C 3 HOH 13 313 32 HOH HOH A . C 3 HOH 14 314 31 HOH HOH A . C 3 HOH 15 315 10 HOH HOH A . C 3 HOH 16 316 33 HOH HOH A . C 3 HOH 17 317 21 HOH HOH A . C 3 HOH 18 318 27 HOH HOH A . C 3 HOH 19 319 28 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-12-21 2 'Structure model' 1 1 2023-01-11 3 'Structure model' 2 0 2023-03-22 4 'Structure model' 2 1 2023-10-25 5 'Structure model' 2 2 2023-11-15 6 'Structure model' 2 3 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Polymer sequence' 6 3 'Structure model' 'Structure summary' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Refinement description' 9 5 'Structure model' 'Database references' 10 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' refine 2 2 'Structure model' software 3 3 'Structure model' atom_site 4 3 'Structure model' atom_site_anisotrop 5 3 'Structure model' citation 6 3 'Structure model' entity 7 3 'Structure model' entity_poly 8 3 'Structure model' entity_poly_seq 9 3 'Structure model' pdbx_poly_seq_scheme 10 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 11 3 'Structure model' struct 12 3 'Structure model' struct_ref_seq_dif 13 4 'Structure model' chem_comp_atom 14 4 'Structure model' chem_comp_bond 15 4 'Structure model' pdbx_initial_refinement_model 16 5 'Structure model' citation 17 5 'Structure model' citation_author 18 6 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_refine.pdbx_starting_model' 2 2 'Structure model' '_software.version' 3 3 'Structure model' '_atom_site.auth_comp_id' 4 3 'Structure model' '_atom_site.label_comp_id' 5 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 6 3 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 7 3 'Structure model' '_citation.title' 8 3 'Structure model' '_entity.formula_weight' 9 3 'Structure model' '_entity.pdbx_mutation' 10 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 11 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 12 3 'Structure model' '_entity_poly_seq.mon_id' 13 3 'Structure model' '_pdbx_poly_seq_scheme.mon_id' 14 3 'Structure model' '_pdbx_poly_seq_scheme.pdb_mon_id' 15 3 'Structure model' '_struct.title' 16 3 'Structure model' '_struct_ref_seq_dif.mon_id' 17 5 'Structure model' '_citation.country' 18 5 'Structure model' '_citation.journal_abbrev' 19 5 'Structure model' '_citation.journal_id_ASTM' 20 5 'Structure model' '_citation.journal_id_CSD' 21 5 'Structure model' '_citation.journal_id_ISSN' 22 5 'Structure model' '_citation.pdbx_database_id_DOI' 23 5 'Structure model' '_citation.pdbx_database_id_PubMed' 24 5 'Structure model' '_citation.title' 25 5 'Structure model' '_citation.year' 26 6 'Structure model' '_citation.journal_volume' 27 6 'Structure model' '_citation.page_first' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 -x,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -5.52131048994 -50.9549081973 -10.8141706267 0.372920581126 ? -0.097613519313 ? -0.0566254723348 ? 0.537218445929 ? 0.0140458893686 ? 0.802522122931 ? 5.56996578189 ? -5.31347570768 ? 5.90957219897 ? 5.57048345483 ? -4.57779112523 ? 9.79252934514 ? -0.0345017857171 ? -0.389328493874 ? 0.998954899106 ? 0.225550151621 ? -0.499237988088 ? -2.41834936344 ? -0.13924163503 ? 0.970781052459 ? 0.456838984355 ? 2 'X-RAY DIFFRACTION' ? refined -8.01376255748 -57.505158005 -16.6002786412 0.350070754171 ? -0.0104188071856 ? 0.0651143663959 ? 0.372563995903 ? 0.00525866513545 ? 0.401064020172 ? 9.75377167467 ? -1.24089632198 ? -1.26502205185 ? 2.67192510661 ? -5.99960966833 ? 9.22093187505 ? 0.101822237877 ? 0.444606192269 ? 0.454974740955 ? -0.567166083771 ? -0.417093942691 ? -1.0595855199 ? -0.0211155537444 ? 0.639290663187 ? 0.330043200436 ? 3 'X-RAY DIFFRACTION' ? refined -13.1022030244 -65.0660920482 -17.8714063499 0.36464075573 ? -0.0616569891658 ? 0.0111323857454 ? 0.422893833972 ? 0.0249059350913 ? 0.370143417226 ? 9.41081716529 ? -3.36681855328 ? 0.168747373337 ? 6.33523021047 ? -2.12829089838 ? 7.79212738257 ? -0.198545649108 ? 1.16469290822 ? -0.158120004742 ? -0.658630688837 ? -0.229708645072 ? -0.547541594211 ? -0.333346315639 ? -0.0110117938376 ? 0.472371564764 ? 4 'X-RAY DIFFRACTION' ? refined -17.3897942706 -50.0301622264 -18.2272620229 0.331197305647 ? 0.00541394362111 ? -0.0564079276071 ? 0.330427577562 ? 0.02352181932 ? 0.329432304126 ? 4.8541902653 ? 0.974731795866 ? -0.833426869326 ? 8.98878294891 ? -3.13201936777 ? 2.98448145519 ? 0.243304646367 ? 0.276930304617 ? -0.105986520106 ? 0.0170542269938 ? -0.193252667118 ? -0.851878828028 ? 0.25025130232 ? -0.0132453026606 ? 0.0852069631094 ? 5 'X-RAY DIFFRACTION' ? refined -23.309978702 -59.2857891739 -17.5857134552 0.353389618432 ? -0.00880127056373 ? -0.0841500046902 ? 0.301329578386 ? 0.0211118533063 ? 0.275941005673 ? 5.93660312537 ? -0.143999195304 ? -1.54752723952 ? 2.24433131079 ? -2.08594213875 ? 5.87922653216 ? 0.00929394972786 ? 0.330430599401 ? -0.0144406678997 ? -0.659448483825 ? -0.0444219289072 ? 0.609669326387 ? 0.517121630191 ? -0.255165172757 ? 0.00373447772148 ? 6 'X-RAY DIFFRACTION' ? refined -17.1069354022 -57.0746244933 -8.17378835719 0.336127112891 ? 0.0329386380606 ? 0.0176551476451 ? 0.35382268962 ? 0.0272519984713 ? 0.370293438509 ? 2.33701678433 ? 5.6160142354 ? 7.53656208812 ? 2.31474913217 ? 7.42685918924 ? 2.609156257 ? -0.186834704518 ? -0.44539545251 ? 0.476243421726 ? 0.438613157807 ? -0.265689708643 ? 0.53083366273 ? 0.32527019703 ? -0.0222991040752 ? 0.536583882305 ? 7 'X-RAY DIFFRACTION' ? refined -19.7571434714 -41.8583173639 -6.07183002759 0.443976294585 ? 0.0300047428019 ? -0.110965203254 ? 0.36922309956 ? -0.106543659121 ? 0.613168543822 ? 8.45350252471 ? -5.49767986266 ? 3.64732191694 ? 6.68899680815 ? -5.95430103806 ? 8.23088990743 ? 0.414416449176 ? 0.395539306354 ? -1.15967185987 ? -0.0646079520884 ? -0.593132050727 ? 0.345954338905 ? 0.555653471647 ? 0.622224755209 ? -0.137512420328 ? 8 'X-RAY DIFFRACTION' ? refined -19.282163664 -33.5415277231 -3.70379567869 0.593624925476 ? -0.0479587940156 ? -0.155158600626 ? 0.521420128283 ? -0.0961061105274 ? 0.648780927357 ? 9.47931080178 ? -0.487914033422 ? 5.69000516749 ? 10.0045935588 ? 3.24228946953 ? 8.38859069093 ? -0.486760286775 ? -0.296353383905 ? 0.746128557808 ? 1.27579147256 ? -0.189443116655 ? -0.599566697328 ? -0.317117461731 ? 0.478264803818 ? 0.936066849482 ? 9 'X-RAY DIFFRACTION' ? refined -24.8238576446 -25.1998835148 -3.55028715378 0.399804303111 ? 0.0220855919794 ? -0.0850205223105 ? 0.532806182895 ? -0.241373973207 ? 0.749515291395 ? 8.23196023783 ? 4.07116985753 ? 1.80978069941 ? 9.22379820116 ? -1.59456866725 ? 8.20277122389 ? 0.191642636836 ? 0.0917211921225 ? 0.677211949975 ? 0.614317607776 ? -0.699164783299 ? 1.34880122596 ? -0.472892109144 ? -0.171077266319 ? 0.479061363347 ? 10 'X-RAY DIFFRACTION' ? refined -31.7064121802 -18.7985112771 -1.3120831383 0.957768655745 ? 0.347686991271 ? 0.169720876091 ? 0.83881737826 ? -0.0983409185584 ? 1.60846028846 ? 0.157752215913 ? -0.241120456916 ? -0.162311492961 ? 4.47084478135 ? -5.52762143735 ? 8.09240528106 ? 0.404794181692 ? -0.461967438132 ? -0.0121584228591 ? 1.81579408236 ? 0.808978498845 ? 1.81612348111 ? -1.62310877161 ? -1.58812866945 ? -1.10644231806 ? 11 'X-RAY DIFFRACTION' ? refined -31.7562113626 -22.1815320417 -9.65544010701 0.867546132588 ? 0.164895356282 ? -0.424150541063 ? 0.964890234009 ? -0.0392980350733 ? 1.09105541269 ? 2.10879462651 ? -2.76035407447 ? -1.24307534142 ? 3.15854336134 ? -2.23779102379 ? 5.80835753946 ? 0.603488885956 ? -0.119734588234 ? 0.404996022278 ? -1.3883796193 ? 0.236329906868 ? 2.07951312181 ? 0.0685974284629 ? -2.08836347389 ? -0.950847424125 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 3 ? A 15 A 17 ? ? ;chain 'A' and (resid 3 through 17 ) ; 2 'X-RAY DIFFRACTION' 2 A 16 A 18 ? A 29 A 31 ? ? ;chain 'A' and (resid 18 through 31 ) ; 3 'X-RAY DIFFRACTION' 3 A 30 A 32 ? A 36 A 38 ? ? ;chain 'A' and (resid 32 through 38 ) ; 4 'X-RAY DIFFRACTION' 4 A 37 A 39 ? A 51 A 53 ? ? ;chain 'A' and (resid 39 through 53 ) ; 5 'X-RAY DIFFRACTION' 5 A 52 A 54 ? A 62 A 64 ? ? ;chain 'A' and (resid 54 through 64 ) ; 6 'X-RAY DIFFRACTION' 6 A 63 A 65 ? A 74 A 76 ? ? ;chain 'A' and (resid 65 through 76 ) ; 7 'X-RAY DIFFRACTION' 7 A 75 A 77 ? A 86 A 90 ? ? ;chain 'A' and (resid 77 through 90 ) ; 8 'X-RAY DIFFRACTION' 8 A 87 A 91 ? A 107 A 111 ? ? ;chain 'A' and (resid 91 through 111 ) ; 9 'X-RAY DIFFRACTION' 9 A 108 A 112 ? A 123 A 127 ? ? ;chain 'A' and (resid 112 through 127 ) ; 10 'X-RAY DIFFRACTION' 10 A 124 A 128 ? A 137 A 141 ? ? ;chain 'A' and (resid 128 through 141 ) ; 11 'X-RAY DIFFRACTION' 11 A 138 A 142 ? A 147 A 151 ? ? ;chain 'A' and (resid 142 through 151 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 1.19.2_4158 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 20210420 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 1.19.2-4158-000 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? '0.9.6 EL' 5 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 20210420 6 # _pdbx_entry_details.entry_id 7T8J _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 11 ? ? -88.10 31.86 2 1 ALA A 148 ? ? -79.03 47.08 3 1 ALA A 149 ? ? -87.27 35.19 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 3 ? CD1 ? A ILE 3 CD1 2 1 Y 1 A ARG 4 ? CG ? A ARG 4 CG 3 1 Y 1 A ARG 4 ? CD ? A ARG 4 CD 4 1 Y 1 A ARG 4 ? NE ? A ARG 4 NE 5 1 Y 1 A ARG 4 ? CZ ? A ARG 4 CZ 6 1 Y 1 A ARG 4 ? NH1 ? A ARG 4 NH1 7 1 Y 1 A ARG 4 ? NH2 ? A ARG 4 NH2 8 1 Y 1 A ARG 10 ? CG ? A ARG 10 CG 9 1 Y 1 A ARG 10 ? CD ? A ARG 10 CD 10 1 Y 1 A ARG 10 ? NE ? A ARG 10 NE 11 1 Y 1 A ARG 10 ? CZ ? A ARG 10 CZ 12 1 Y 1 A ARG 10 ? NH1 ? A ARG 10 NH1 13 1 Y 1 A ARG 10 ? NH2 ? A ARG 10 NH2 14 1 Y 1 A LEU 11 ? CB ? A LEU 11 CB 15 1 Y 1 A LEU 11 ? CG ? A LEU 11 CG 16 1 Y 1 A LEU 11 ? CD1 ? A LEU 11 CD1 17 1 Y 1 A LEU 11 ? CD2 ? A LEU 11 CD2 18 1 Y 1 A GLN 12 ? CG ? A GLN 12 CG 19 1 Y 1 A GLN 12 ? CD ? A GLN 12 CD 20 1 Y 1 A GLN 12 ? OE1 ? A GLN 12 OE1 21 1 Y 1 A GLN 12 ? NE2 ? A GLN 12 NE2 22 1 Y 1 A ILE 14 ? CD1 ? A ILE 14 CD1 23 1 Y 1 A ARG 18 ? CZ ? A ARG 18 CZ 24 1 Y 1 A ARG 18 ? NH1 ? A ARG 18 NH1 25 1 Y 1 A ARG 18 ? NH2 ? A ARG 18 NH2 26 1 Y 1 A ASP 19 ? OD2 ? A ASP 19 OD2 27 1 Y 1 A SER 35 ? OG ? A SER 35 OG 28 1 Y 1 A SER 39 ? OG ? A SER 39 OG 29 1 Y 1 A ASN 40 ? CG ? A ASN 40 CG 30 1 Y 1 A ASN 40 ? OD1 ? A ASN 40 OD1 31 1 Y 1 A ASN 40 ? ND2 ? A ASN 40 ND2 32 1 Y 1 A GLU 43 ? OE1 ? A GLU 43 OE1 33 1 Y 1 A GLU 43 ? OE2 ? A GLU 43 OE2 34 1 Y 1 A LYS 47 ? NZ ? A LYS 47 NZ 35 1 Y 1 A GLU 55 ? CD ? A GLU 55 CD 36 1 Y 1 A GLU 55 ? OE1 ? A GLU 55 OE1 37 1 Y 1 A GLU 55 ? OE2 ? A GLU 55 OE2 38 1 Y 1 A SER 78 ? CB ? A SER 78 CB 39 1 Y 1 A SER 78 ? OG ? A SER 78 OG 40 1 Y 1 A GLU 81 ? CG ? A GLU 81 CG 41 1 Y 1 A GLU 81 ? CD ? A GLU 81 CD 42 1 Y 1 A GLU 81 ? OE1 ? A GLU 81 OE1 43 1 Y 1 A GLU 81 ? OE2 ? A GLU 81 OE2 44 1 Y 1 A LEU 82 ? CG ? A LEU 82 CG 45 1 Y 1 A LEU 82 ? CD1 ? A LEU 82 CD1 46 1 Y 1 A LEU 82 ? CD2 ? A LEU 82 CD2 47 1 Y 1 A GLN 83 ? OE1 ? A GLN 83 OE1 48 1 Y 1 A GLN 83 ? NE2 ? A GLN 83 NE2 49 1 Y 1 A LYS 85 ? CE ? A LYS 85 CE 50 1 Y 1 A LYS 85 ? NZ ? A LYS 85 NZ 51 1 Y 1 A GLU 88 ? OE1 ? A GLU 88 OE1 52 1 Y 1 A GLU 88 ? OE2 ? A GLU 88 OE2 53 1 Y 1 A GLU 90 ? OE1 ? A GLU 90 OE1 54 1 Y 1 A GLU 90 ? OE2 ? A GLU 90 OE2 55 1 Y 1 A VAL 93 ? CG1 ? A VAL 93 CG1 56 1 Y 1 A GLU 100 ? OE1 ? A GLU 100 OE1 57 1 Y 1 A GLU 100 ? OE2 ? A GLU 100 OE2 58 1 Y 1 A VAL 113 ? CG1 ? A VAL 113 CG1 59 1 Y 1 A VAL 113 ? CG2 ? A VAL 113 CG2 60 1 Y 1 A SER 114 ? OG ? A SER 114 OG 61 1 Y 1 A ASN 118 ? OD1 ? A ASN 118 OD1 62 1 Y 1 A ASN 118 ? ND2 ? A ASN 118 ND2 63 1 Y 1 A GLN 123 ? CD ? A GLN 123 CD 64 1 Y 1 A GLN 123 ? OE1 ? A GLN 123 OE1 65 1 Y 1 A GLN 123 ? NE2 ? A GLN 123 NE2 66 1 Y 1 A SER 128 ? OG ? A SER 128 OG 67 1 Y 1 A SER 129 ? OG ? A SER 129 OG 68 1 Y 1 A ARG 130 ? CG ? A ARG 130 CG 69 1 Y 1 A ARG 130 ? CD ? A ARG 130 CD 70 1 Y 1 A ARG 130 ? NE ? A ARG 130 NE 71 1 Y 1 A ARG 130 ? CZ ? A ARG 130 CZ 72 1 Y 1 A ARG 130 ? NH1 ? A ARG 130 NH1 73 1 Y 1 A ARG 130 ? NH2 ? A ARG 130 NH2 74 1 Y 1 A ARG 132 ? CG ? A ARG 132 CG 75 1 Y 1 A ARG 132 ? CD ? A ARG 132 CD 76 1 Y 1 A ARG 132 ? NE ? A ARG 132 NE 77 1 Y 1 A ARG 132 ? CZ ? A ARG 132 CZ 78 1 Y 1 A ARG 132 ? NH1 ? A ARG 132 NH1 79 1 Y 1 A ARG 132 ? NH2 ? A ARG 132 NH2 80 1 Y 1 A ALA 133 ? CB ? A ALA 133 CB 81 1 Y 1 A ASP 134 ? CG ? A ASP 134 CG 82 1 Y 1 A ASP 134 ? OD1 ? A ASP 134 OD1 83 1 Y 1 A ASP 134 ? OD2 ? A ASP 134 OD2 84 1 Y 1 A ILE 138 ? CD1 ? A ILE 138 CD1 85 1 Y 1 A TYR 142 ? CD1 ? A TYR 142 CD1 86 1 Y 1 A TYR 142 ? CD2 ? A TYR 142 CD2 87 1 Y 1 A TYR 142 ? CE1 ? A TYR 142 CE1 88 1 Y 1 A TYR 142 ? CE2 ? A TYR 142 CE2 89 1 Y 1 A TYR 142 ? CZ ? A TYR 142 CZ 90 1 Y 1 A TYR 142 ? OH ? A TYR 142 OH 91 1 Y 1 A GLN 143 ? CG ? A GLN 143 CG 92 1 Y 1 A GLN 143 ? CD ? A GLN 143 CD 93 1 Y 1 A GLN 143 ? OE1 ? A GLN 143 OE1 94 1 Y 1 A GLN 143 ? NE2 ? A GLN 143 NE2 95 1 Y 1 A SER 147 ? OG ? A SER 147 OG 96 1 Y 1 A SER 150 ? OG ? A SER 150 OG 97 1 Y 1 A ARG 151 ? CG ? A ARG 151 CG 98 1 Y 1 A ARG 151 ? CD ? A ARG 151 CD 99 1 Y 1 A ARG 151 ? NE ? A ARG 151 NE 100 1 Y 1 A ARG 151 ? CZ ? A ARG 151 CZ 101 1 Y 1 A ARG 151 ? NH1 ? A ARG 151 NH1 102 1 Y 1 A ARG 151 ? NH2 ? A ARG 151 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLY 79 ? A GLY 79 4 1 Y 1 A GLY 80 ? A GLY 80 5 1 Y 1 A TYR 152 ? A TYR 152 6 1 Y 1 A VAL 153 ? A VAL 153 7 1 Y 1 A LEU 154 ? A LEU 154 8 1 Y 1 A ALA 155 ? A ALA 155 9 1 Y 1 A ARG 156 ? A ARG 156 10 1 Y 1 A PRO 157 ? A PRO 157 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7TCY _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ;This assembly is observed in all crystal structures of the 1TEL domain and was previously confirmed by electron microscopy (Kim et al. EMBO J. 2001 Aug 1;20(15):4173-82). The assembly can be generated by generating the crystallographic symmetry mates. ; # _space_group.name_H-M_alt 'P 65' _space_group.name_Hall 'P 65' _space_group.IT_number 170 _space_group.crystal_system hexagonal _space_group.id 1 #