data_7TCZ # _entry.id 7TCZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7TCZ pdb_00007tcz 10.2210/pdb7tcz/pdb WWPDB D_1000262065 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7TCZ _pdbx_database_status.recvd_initial_deposition_date 2021-12-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hulce, K.R.' 1 ? 'Bohn, M.' 2 ? 'Ongpipattanakul, C.' 3 ? 'Jaishankar, P.' 4 ? 'Renslo, A.R.' 5 ? 'Craik, C.S.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Chem Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2451-9456 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 785 _citation.page_last 798.e19 _citation.title 'Inhibiting a dynamic viral protease by targeting a non-catalytic cysteine.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.chembiol.2022.03.007 _citation.pdbx_database_id_PubMed 35364007 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hulce, K.R.' 1 ? primary 'Jaishankar, P.' 2 ? primary 'Lee, G.M.' 3 ? primary 'Bohn, M.F.' 4 ? primary 'Connelly, E.J.' 5 ? primary 'Wucherer, K.' 6 ? primary 'Ongpipattanakul, C.' 7 ? primary 'Volk, R.F.' 8 ? primary 'Chuo, S.W.' 9 ? primary 'Arkin, M.R.' 10 ? primary 'Renslo, A.R.' 11 ? primary 'Craik, C.S.' 12 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7TCZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.673 _cell.length_a_esd ? _cell.length_b 51.673 _cell.length_b_esd ? _cell.length_c 215.726 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7TCZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Assemblin 28961.416 1 3.4.21.97 'C84A, C87A, C138A, C202A' ? ? 2 non-polymer syn '[1-(2-oxopropyl)-4-phenyl-1H-1,2,3-triazol-5-yl]methyl benzylcarbamate' 364.398 1 ? ? ? ? 3 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Protease # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHMTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVA AMQSVRDGLFALGAVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRADDVEVATSLSGSETT PFKHVALCSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRAGSTAVDVSGDPFRSDSYGLLGNSVDALYIRE RLPKLRYDKQLVGVTERESYVKA ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHMTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVA AMQSVRDGLFALGAVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRADDVEVATSLSGSETT PFKHVALCSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRAGSTAVDVSGDPFRSDSYGLLGNSVDALYIRE RLPKLRYDKQLVGVTERESYVKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 THR n 1 10 MET n 1 11 ASP n 1 12 GLU n 1 13 GLN n 1 14 GLN n 1 15 SER n 1 16 GLN n 1 17 ALA n 1 18 VAL n 1 19 ALA n 1 20 PRO n 1 21 VAL n 1 22 TYR n 1 23 VAL n 1 24 GLY n 1 25 GLY n 1 26 PHE n 1 27 LEU n 1 28 ALA n 1 29 ARG n 1 30 TYR n 1 31 ASP n 1 32 GLN n 1 33 SER n 1 34 PRO n 1 35 ASP n 1 36 GLU n 1 37 ALA n 1 38 GLU n 1 39 LEU n 1 40 LEU n 1 41 LEU n 1 42 PRO n 1 43 ARG n 1 44 ASP n 1 45 VAL n 1 46 VAL n 1 47 GLU n 1 48 HIS n 1 49 TRP n 1 50 LEU n 1 51 HIS n 1 52 ALA n 1 53 GLN n 1 54 GLY n 1 55 GLN n 1 56 GLY n 1 57 GLN n 1 58 PRO n 1 59 SER n 1 60 LEU n 1 61 SER n 1 62 VAL n 1 63 ALA n 1 64 LEU n 1 65 PRO n 1 66 LEU n 1 67 ASN n 1 68 ILE n 1 69 ASN n 1 70 HIS n 1 71 ASP n 1 72 ASP n 1 73 THR n 1 74 ALA n 1 75 VAL n 1 76 VAL n 1 77 GLY n 1 78 HIS n 1 79 VAL n 1 80 ALA n 1 81 ALA n 1 82 MET n 1 83 GLN n 1 84 SER n 1 85 VAL n 1 86 ARG n 1 87 ASP n 1 88 GLY n 1 89 LEU n 1 90 PHE n 1 91 ALA n 1 92 LEU n 1 93 GLY n 1 94 ALA n 1 95 VAL n 1 96 THR n 1 97 SER n 1 98 PRO n 1 99 ARG n 1 100 PHE n 1 101 LEU n 1 102 GLU n 1 103 ILE n 1 104 VAL n 1 105 ARG n 1 106 ARG n 1 107 ALA n 1 108 SER n 1 109 GLU n 1 110 LYS n 1 111 SER n 1 112 GLU n 1 113 LEU n 1 114 VAL n 1 115 SER n 1 116 ARG n 1 117 GLY n 1 118 PRO n 1 119 VAL n 1 120 SER n 1 121 PRO n 1 122 LEU n 1 123 GLN n 1 124 PRO n 1 125 ASP n 1 126 LYS n 1 127 VAL n 1 128 VAL n 1 129 GLU n 1 130 PHE n 1 131 LEU n 1 132 SER n 1 133 GLY n 1 134 SER n 1 135 TYR n 1 136 ALA n 1 137 GLY n 1 138 LEU n 1 139 SER n 1 140 LEU n 1 141 SER n 1 142 SER n 1 143 ARG n 1 144 ARG n 1 145 ALA n 1 146 ASP n 1 147 ASP n 1 148 VAL n 1 149 GLU n 1 150 VAL n 1 151 ALA n 1 152 THR n 1 153 SER n 1 154 LEU n 1 155 SER n 1 156 GLY n 1 157 SER n 1 158 GLU n 1 159 THR n 1 160 THR n 1 161 PRO n 1 162 PHE n 1 163 LYS n 1 164 HIS n 1 165 VAL n 1 166 ALA n 1 167 LEU n 1 168 CYS n 1 169 SER n 1 170 VAL n 1 171 GLY n 1 172 ARG n 1 173 ARG n 1 174 ARG n 1 175 GLY n 1 176 THR n 1 177 LEU n 1 178 ALA n 1 179 VAL n 1 180 TYR n 1 181 GLY n 1 182 ARG n 1 183 ASP n 1 184 PRO n 1 185 GLU n 1 186 TRP n 1 187 VAL n 1 188 THR n 1 189 GLN n 1 190 ARG n 1 191 PHE n 1 192 PRO n 1 193 ASP n 1 194 LEU n 1 195 THR n 1 196 ALA n 1 197 ALA n 1 198 ASP n 1 199 ARG n 1 200 ASP n 1 201 GLY n 1 202 LEU n 1 203 ARG n 1 204 ALA n 1 205 GLN n 1 206 TRP n 1 207 GLN n 1 208 ARG n 1 209 ALA n 1 210 GLY n 1 211 SER n 1 212 THR n 1 213 ALA n 1 214 VAL n 1 215 ASP n 1 216 VAL n 1 217 SER n 1 218 GLY n 1 219 ASP n 1 220 PRO n 1 221 PHE n 1 222 ARG n 1 223 SER n 1 224 ASP n 1 225 SER n 1 226 TYR n 1 227 GLY n 1 228 LEU n 1 229 LEU n 1 230 GLY n 1 231 ASN n 1 232 SER n 1 233 VAL n 1 234 ASP n 1 235 ALA n 1 236 LEU n 1 237 TYR n 1 238 ILE n 1 239 ARG n 1 240 GLU n 1 241 ARG n 1 242 LEU n 1 243 PRO n 1 244 LYS n 1 245 LEU n 1 246 ARG n 1 247 TYR n 1 248 ASP n 1 249 LYS n 1 250 GLN n 1 251 LEU n 1 252 VAL n 1 253 GLY n 1 254 VAL n 1 255 THR n 1 256 GLU n 1 257 ARG n 1 258 GLU n 1 259 SER n 1 260 TYR n 1 261 VAL n 1 262 LYS n 1 263 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene UL80 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human betaherpesvirus 5' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10359 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A126N917_HCMV _struct_ref.pdbx_db_accession A0A126N917 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRD GLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVAL CSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDSYGLLGNSVDALYIRERLPKLRY DKQLVGVTERESYVKA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7TCZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A126N917 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 256 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 256 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7TCZ MET A 1 ? UNP A0A126N917 ? ? 'initiating methionine' -6 1 1 7TCZ HIS A 2 ? UNP A0A126N917 ? ? 'expression tag' -5 2 1 7TCZ HIS A 3 ? UNP A0A126N917 ? ? 'expression tag' -4 3 1 7TCZ HIS A 4 ? UNP A0A126N917 ? ? 'expression tag' -3 4 1 7TCZ HIS A 5 ? UNP A0A126N917 ? ? 'expression tag' -2 5 1 7TCZ HIS A 6 ? UNP A0A126N917 ? ? 'expression tag' -1 6 1 7TCZ HIS A 7 ? UNP A0A126N917 ? ? 'expression tag' 0 7 1 7TCZ ALA A 91 ? UNP A0A126N917 CYS 84 'engineered mutation' 84 8 1 7TCZ ALA A 94 ? UNP A0A126N917 CYS 87 'engineered mutation' 87 9 1 7TCZ ALA A 145 ? UNP A0A126N917 CYS 138 'engineered mutation' 138 10 1 7TCZ VAL A 150 ? UNP A0A126N917 ALA 143 'engineered mutation' 143 11 1 7TCZ ALA A 209 ? UNP A0A126N917 CYS 202 'engineered mutation' 202 12 1 7TCZ VAL A 216 ? UNP A0A126N917 ALA 209 'engineered mutation' 209 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GIT non-polymer . '[1-(2-oxopropyl)-4-phenyl-1H-1,2,3-triazol-5-yl]methyl benzylcarbamate' ? 'C20 H20 N4 O3' 364.398 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7TCZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 297 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '40% v/v PEG 200, 0.1 M MES pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.11583 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.11583 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7TCZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.669 _reflns.d_resolution_low 51.67 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9026 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.35 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.6 _reflns.pdbx_Rmerge_I_obs 0.2958 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.94 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.306 _reflns.pdbx_Rpim_I_all 0.083 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.669 _reflns_shell.d_res_low 2.766 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 871 _reflns_shell.percent_possible_all 98.28 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 3.171 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 24.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.814 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7TCZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.67 _refine.ls_d_res_low 51.67 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8978 _refine.ls_number_reflns_R_free 444 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.37 _refine.ls_percent_reflns_R_free 4.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2507 _refine.ls_R_factor_R_free 0.2884 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2488 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1NJT _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.66 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.39 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1630 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1661 _refine_hist.d_res_high 2.67 _refine_hist.d_res_low 51.67 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1696 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.223 ? 2303 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 22.773 ? 605 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 254 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 302 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.67 3.06 . . 140 2758 99.00 . . . 0.4007 . 0.3159 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.06 3.85 . . 158 2758 99.00 . . . 0.3166 . 0.2634 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.85 51.67 . . 146 3018 100.00 . . . 0.2479 . 0.2281 . . . . . . . . . . . # _struct.entry_id 7TCZ _struct.title 'Human cytomegalovirus protease mutant (C84A, C87A, C138A, C202A) in complex with inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7TCZ _struct_keywords.text 'Protease, VIRAL PROTEIN, HYRDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYRDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 36 ? LEU A 40 ? GLU A 29 LEU A 33 5 ? 5 HELX_P HELX_P2 AA2 PRO A 42 ? LEU A 50 ? PRO A 35 LEU A 43 1 ? 9 HELX_P HELX_P3 AA3 SER A 97 ? GLU A 109 ? SER A 90 GLU A 102 1 ? 13 HELX_P HELX_P4 AA4 SER A 111 ? ARG A 116 ? SER A 104 ARG A 109 1 ? 6 HELX_P HELX_P5 AA5 ASP A 125 ? TYR A 135 ? ASP A 118 TYR A 128 1 ? 11 HELX_P HELX_P6 AA6 ASP A 183 ? ARG A 190 ? ASP A 176 ARG A 183 1 ? 8 HELX_P HELX_P7 AA7 THR A 195 ? TRP A 206 ? THR A 188 TRP A 199 1 ? 12 HELX_P HELX_P8 AA8 ASP A 224 ? TYR A 237 ? ASP A 217 TYR A 230 1 ? 14 HELX_P HELX_P9 AA9 GLU A 240 ? GLY A 253 ? GLU A 233 GLY A 246 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 168 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id GIT _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C01 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 161 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GIT _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.609 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 137 ? SER A 141 ? GLY A 130 SER A 134 AA1 2 HIS A 164 ? CYS A 168 ? HIS A 157 CYS A 161 AA1 3 PRO A 65 ? ILE A 68 ? PRO A 58 ILE A 61 AA1 4 ASP A 71 ? SER A 84 ? ASP A 64 SER A 77 AA1 5 GLY A 88 ? VAL A 95 ? GLY A 81 VAL A 88 AA1 6 VAL A 21 ? ARG A 29 ? VAL A 14 ARG A 22 AA1 7 VAL A 179 ? GLY A 181 ? VAL A 172 GLY A 174 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 139 ? N SER A 132 O ALA A 166 ? O ALA A 159 AA1 2 3 O LEU A 167 ? O LEU A 160 N ASN A 67 ? N ASN A 60 AA1 3 4 N LEU A 66 ? N LEU A 59 O VAL A 76 ? O VAL A 69 AA1 4 5 N GLN A 83 ? N GLN A 76 O PHE A 90 ? O PHE A 83 AA1 5 6 O VAL A 95 ? O VAL A 88 N VAL A 21 ? N VAL A 14 AA1 6 7 N TYR A 22 ? N TYR A 15 O GLY A 181 ? O GLY A 174 # _atom_sites.entry_id 7TCZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019353 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019353 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004636 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -6 ? ? ? A . n A 1 2 HIS 2 -5 ? ? ? A . n A 1 3 HIS 3 -4 ? ? ? A . n A 1 4 HIS 4 -3 ? ? ? A . n A 1 5 HIS 5 -2 ? ? ? A . n A 1 6 HIS 6 -1 ? ? ? A . n A 1 7 HIS 7 0 ? ? ? A . n A 1 8 MET 8 1 ? ? ? A . n A 1 9 THR 9 2 ? ? ? A . n A 1 10 MET 10 3 ? ? ? A . n A 1 11 ASP 11 4 ? ? ? A . n A 1 12 GLU 12 5 ? ? ? A . n A 1 13 GLN 13 6 6 GLN GLN A . n A 1 14 GLN 14 7 7 GLN GLN A . n A 1 15 SER 15 8 8 SER SER A . n A 1 16 GLN 16 9 9 GLN GLN A . n A 1 17 ALA 17 10 10 ALA ALA A . n A 1 18 VAL 18 11 11 VAL VAL A . n A 1 19 ALA 19 12 12 ALA ALA A . n A 1 20 PRO 20 13 13 PRO PRO A . n A 1 21 VAL 21 14 14 VAL VAL A . n A 1 22 TYR 22 15 15 TYR TYR A . n A 1 23 VAL 23 16 16 VAL VAL A . n A 1 24 GLY 24 17 17 GLY GLY A . n A 1 25 GLY 25 18 18 GLY GLY A . n A 1 26 PHE 26 19 19 PHE PHE A . n A 1 27 LEU 27 20 20 LEU LEU A . n A 1 28 ALA 28 21 21 ALA ALA A . n A 1 29 ARG 29 22 22 ARG ARG A . n A 1 30 TYR 30 23 23 TYR TYR A . n A 1 31 ASP 31 24 24 ASP ASP A . n A 1 32 GLN 32 25 25 GLN GLN A . n A 1 33 SER 33 26 26 SER SER A . n A 1 34 PRO 34 27 27 PRO PRO A . n A 1 35 ASP 35 28 28 ASP ASP A . n A 1 36 GLU 36 29 29 GLU GLU A . n A 1 37 ALA 37 30 30 ALA ALA A . n A 1 38 GLU 38 31 31 GLU GLU A . n A 1 39 LEU 39 32 32 LEU LEU A . n A 1 40 LEU 40 33 33 LEU LEU A . n A 1 41 LEU 41 34 34 LEU LEU A . n A 1 42 PRO 42 35 35 PRO PRO A . n A 1 43 ARG 43 36 36 ARG ARG A . n A 1 44 ASP 44 37 37 ASP ASP A . n A 1 45 VAL 45 38 38 VAL VAL A . n A 1 46 VAL 46 39 39 VAL VAL A . n A 1 47 GLU 47 40 40 GLU GLU A . n A 1 48 HIS 48 41 41 HIS HIS A . n A 1 49 TRP 49 42 42 TRP TRP A . n A 1 50 LEU 50 43 43 LEU LEU A . n A 1 51 HIS 51 44 44 HIS HIS A . n A 1 52 ALA 52 45 ? ? ? A . n A 1 53 GLN 53 46 ? ? ? A . n A 1 54 GLY 54 47 ? ? ? A . n A 1 55 GLN 55 48 ? ? ? A . n A 1 56 GLY 56 49 ? ? ? A . n A 1 57 GLN 57 50 ? ? ? A . n A 1 58 PRO 58 51 ? ? ? A . n A 1 59 SER 59 52 ? ? ? A . n A 1 60 LEU 60 53 ? ? ? A . n A 1 61 SER 61 54 ? ? ? A . n A 1 62 VAL 62 55 55 VAL VAL A . n A 1 63 ALA 63 56 56 ALA ALA A . n A 1 64 LEU 64 57 57 LEU LEU A . n A 1 65 PRO 65 58 58 PRO PRO A . n A 1 66 LEU 66 59 59 LEU LEU A . n A 1 67 ASN 67 60 60 ASN ASN A . n A 1 68 ILE 68 61 61 ILE ILE A . n A 1 69 ASN 69 62 62 ASN ASN A . n A 1 70 HIS 70 63 63 HIS HIS A . n A 1 71 ASP 71 64 64 ASP ASP A . n A 1 72 ASP 72 65 65 ASP ASP A . n A 1 73 THR 73 66 66 THR THR A . n A 1 74 ALA 74 67 67 ALA ALA A . n A 1 75 VAL 75 68 68 VAL VAL A . n A 1 76 VAL 76 69 69 VAL VAL A . n A 1 77 GLY 77 70 70 GLY GLY A . n A 1 78 HIS 78 71 71 HIS HIS A . n A 1 79 VAL 79 72 72 VAL VAL A . n A 1 80 ALA 80 73 73 ALA ALA A . n A 1 81 ALA 81 74 74 ALA ALA A . n A 1 82 MET 82 75 75 MET MET A . n A 1 83 GLN 83 76 76 GLN GLN A . n A 1 84 SER 84 77 77 SER SER A . n A 1 85 VAL 85 78 78 VAL VAL A . n A 1 86 ARG 86 79 79 ARG ARG A . n A 1 87 ASP 87 80 80 ASP ASP A . n A 1 88 GLY 88 81 81 GLY GLY A . n A 1 89 LEU 89 82 82 LEU LEU A . n A 1 90 PHE 90 83 83 PHE PHE A . n A 1 91 ALA 91 84 84 ALA ALA A . n A 1 92 LEU 92 85 85 LEU LEU A . n A 1 93 GLY 93 86 86 GLY GLY A . n A 1 94 ALA 94 87 87 ALA ALA A . n A 1 95 VAL 95 88 88 VAL VAL A . n A 1 96 THR 96 89 89 THR THR A . n A 1 97 SER 97 90 90 SER SER A . n A 1 98 PRO 98 91 91 PRO PRO A . n A 1 99 ARG 99 92 92 ARG ARG A . n A 1 100 PHE 100 93 93 PHE PHE A . n A 1 101 LEU 101 94 94 LEU LEU A . n A 1 102 GLU 102 95 95 GLU GLU A . n A 1 103 ILE 103 96 96 ILE ILE A . n A 1 104 VAL 104 97 97 VAL VAL A . n A 1 105 ARG 105 98 98 ARG ARG A . n A 1 106 ARG 106 99 99 ARG ARG A . n A 1 107 ALA 107 100 100 ALA ALA A . n A 1 108 SER 108 101 101 SER SER A . n A 1 109 GLU 109 102 102 GLU GLU A . n A 1 110 LYS 110 103 103 LYS LYS A . n A 1 111 SER 111 104 104 SER SER A . n A 1 112 GLU 112 105 105 GLU GLU A . n A 1 113 LEU 113 106 106 LEU LEU A . n A 1 114 VAL 114 107 107 VAL VAL A . n A 1 115 SER 115 108 108 SER SER A . n A 1 116 ARG 116 109 109 ARG ARG A . n A 1 117 GLY 117 110 110 GLY GLY A . n A 1 118 PRO 118 111 111 PRO PRO A . n A 1 119 VAL 119 112 112 VAL VAL A . n A 1 120 SER 120 113 113 SER SER A . n A 1 121 PRO 121 114 114 PRO PRO A . n A 1 122 LEU 122 115 115 LEU LEU A . n A 1 123 GLN 123 116 116 GLN GLN A . n A 1 124 PRO 124 117 117 PRO PRO A . n A 1 125 ASP 125 118 118 ASP ASP A . n A 1 126 LYS 126 119 119 LYS LYS A . n A 1 127 VAL 127 120 120 VAL VAL A . n A 1 128 VAL 128 121 121 VAL VAL A . n A 1 129 GLU 129 122 122 GLU GLU A . n A 1 130 PHE 130 123 123 PHE PHE A . n A 1 131 LEU 131 124 124 LEU LEU A . n A 1 132 SER 132 125 125 SER SER A . n A 1 133 GLY 133 126 126 GLY GLY A . n A 1 134 SER 134 127 127 SER SER A . n A 1 135 TYR 135 128 128 TYR TYR A . n A 1 136 ALA 136 129 129 ALA ALA A . n A 1 137 GLY 137 130 130 GLY GLY A . n A 1 138 LEU 138 131 131 LEU LEU A . n A 1 139 SER 139 132 132 SER SER A . n A 1 140 LEU 140 133 133 LEU LEU A . n A 1 141 SER 141 134 134 SER SER A . n A 1 142 SER 142 135 ? ? ? A . n A 1 143 ARG 143 136 ? ? ? A . n A 1 144 ARG 144 137 ? ? ? A . n A 1 145 ALA 145 138 ? ? ? A . n A 1 146 ASP 146 139 ? ? ? A . n A 1 147 ASP 147 140 ? ? ? A . n A 1 148 VAL 148 141 ? ? ? A . n A 1 149 GLU 149 142 ? ? ? A . n A 1 150 VAL 150 143 ? ? ? A . n A 1 151 ALA 151 144 ? ? ? A . n A 1 152 THR 152 145 ? ? ? A . n A 1 153 SER 153 146 ? ? ? A . n A 1 154 LEU 154 147 ? ? ? A . n A 1 155 SER 155 148 ? ? ? A . n A 1 156 GLY 156 149 ? ? ? A . n A 1 157 SER 157 150 ? ? ? A . n A 1 158 GLU 158 151 ? ? ? A . n A 1 159 THR 159 152 ? ? ? A . n A 1 160 THR 160 153 ? ? ? A . n A 1 161 PRO 161 154 ? ? ? A . n A 1 162 PHE 162 155 155 PHE PHE A . n A 1 163 LYS 163 156 156 LYS LYS A . n A 1 164 HIS 164 157 157 HIS HIS A . n A 1 165 VAL 165 158 158 VAL VAL A . n A 1 166 ALA 166 159 159 ALA ALA A . n A 1 167 LEU 167 160 160 LEU LEU A . n A 1 168 CYS 168 161 161 CYS CYS A . n A 1 169 SER 169 162 162 SER SER A . n A 1 170 VAL 170 163 163 VAL VAL A . n A 1 171 GLY 171 164 164 GLY GLY A . n A 1 172 ARG 172 165 165 ARG ARG A . n A 1 173 ARG 173 166 166 ARG ARG A . n A 1 174 ARG 174 167 167 ARG ARG A . n A 1 175 GLY 175 168 168 GLY GLY A . n A 1 176 THR 176 169 169 THR THR A . n A 1 177 LEU 177 170 170 LEU LEU A . n A 1 178 ALA 178 171 171 ALA ALA A . n A 1 179 VAL 179 172 172 VAL VAL A . n A 1 180 TYR 180 173 173 TYR TYR A . n A 1 181 GLY 181 174 174 GLY GLY A . n A 1 182 ARG 182 175 175 ARG ARG A . n A 1 183 ASP 183 176 176 ASP ASP A . n A 1 184 PRO 184 177 177 PRO PRO A . n A 1 185 GLU 185 178 178 GLU GLU A . n A 1 186 TRP 186 179 179 TRP TRP A . n A 1 187 VAL 187 180 180 VAL VAL A . n A 1 188 THR 188 181 181 THR THR A . n A 1 189 GLN 189 182 182 GLN GLN A . n A 1 190 ARG 190 183 183 ARG ARG A . n A 1 191 PHE 191 184 184 PHE PHE A . n A 1 192 PRO 192 185 185 PRO PRO A . n A 1 193 ASP 193 186 186 ASP ASP A . n A 1 194 LEU 194 187 187 LEU LEU A . n A 1 195 THR 195 188 188 THR THR A . n A 1 196 ALA 196 189 189 ALA ALA A . n A 1 197 ALA 197 190 190 ALA ALA A . n A 1 198 ASP 198 191 191 ASP ASP A . n A 1 199 ARG 199 192 192 ARG ARG A . n A 1 200 ASP 200 193 193 ASP ASP A . n A 1 201 GLY 201 194 194 GLY GLY A . n A 1 202 LEU 202 195 195 LEU LEU A . n A 1 203 ARG 203 196 196 ARG ARG A . n A 1 204 ALA 204 197 197 ALA ALA A . n A 1 205 GLN 205 198 198 GLN GLN A . n A 1 206 TRP 206 199 199 TRP TRP A . n A 1 207 GLN 207 200 200 GLN GLN A . n A 1 208 ARG 208 201 201 ARG ARG A . n A 1 209 ALA 209 202 ? ? ? A . n A 1 210 GLY 210 203 ? ? ? A . n A 1 211 SER 211 204 ? ? ? A . n A 1 212 THR 212 205 ? ? ? A . n A 1 213 ALA 213 206 ? ? ? A . n A 1 214 VAL 214 207 ? ? ? A . n A 1 215 ASP 215 208 ? ? ? A . n A 1 216 VAL 216 209 ? ? ? A . n A 1 217 SER 217 210 210 SER SER A . n A 1 218 GLY 218 211 211 GLY GLY A . n A 1 219 ASP 219 212 212 ASP ASP A . n A 1 220 PRO 220 213 213 PRO PRO A . n A 1 221 PHE 221 214 214 PHE PHE A . n A 1 222 ARG 222 215 215 ARG ARG A . n A 1 223 SER 223 216 216 SER SER A . n A 1 224 ASP 224 217 217 ASP ASP A . n A 1 225 SER 225 218 218 SER SER A . n A 1 226 TYR 226 219 219 TYR TYR A . n A 1 227 GLY 227 220 220 GLY GLY A . n A 1 228 LEU 228 221 221 LEU LEU A . n A 1 229 LEU 229 222 222 LEU LEU A . n A 1 230 GLY 230 223 223 GLY GLY A . n A 1 231 ASN 231 224 224 ASN ASN A . n A 1 232 SER 232 225 225 SER SER A . n A 1 233 VAL 233 226 226 VAL VAL A . n A 1 234 ASP 234 227 227 ASP ASP A . n A 1 235 ALA 235 228 228 ALA ALA A . n A 1 236 LEU 236 229 229 LEU LEU A . n A 1 237 TYR 237 230 230 TYR TYR A . n A 1 238 ILE 238 231 231 ILE ILE A . n A 1 239 ARG 239 232 232 ARG ARG A . n A 1 240 GLU 240 233 233 GLU GLU A . n A 1 241 ARG 241 234 234 ARG ARG A . n A 1 242 LEU 242 235 235 LEU LEU A . n A 1 243 PRO 243 236 236 PRO PRO A . n A 1 244 LYS 244 237 237 LYS LYS A . n A 1 245 LEU 245 238 238 LEU LEU A . n A 1 246 ARG 246 239 239 ARG ARG A . n A 1 247 TYR 247 240 240 TYR TYR A . n A 1 248 ASP 248 241 241 ASP ASP A . n A 1 249 LYS 249 242 242 LYS LYS A . n A 1 250 GLN 250 243 243 GLN GLN A . n A 1 251 LEU 251 244 244 LEU LEU A . n A 1 252 VAL 252 245 245 VAL VAL A . n A 1 253 GLY 253 246 246 GLY GLY A . n A 1 254 VAL 254 247 247 VAL VAL A . n A 1 255 THR 255 248 248 THR THR A . n A 1 256 GLU 256 249 249 GLU GLU A . n A 1 257 ARG 257 250 250 ARG ARG A . n A 1 258 GLU 258 251 251 GLU GLU A . n A 1 259 SER 259 252 252 SER SER A . n A 1 260 TYR 260 253 253 TYR TYR A . n A 1 261 VAL 261 254 254 VAL VAL A . n A 1 262 LYS 262 255 255 LYS LYS A . n A 1 263 ALA 263 256 256 ALA ALA A . n # _pdbx_contact_author.id 5 _pdbx_contact_author.email charles.craik@ucsf.edu _pdbx_contact_author.name_first Charles _pdbx_contact_author.name_last Craik _pdbx_contact_author.name_mi S. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7704-9185 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GIT 1 301 301 GIT 362 A . C 3 HOH 1 401 2 HOH HOH A . C 3 HOH 2 402 1 HOH HOH A . C 3 HOH 3 403 6 HOH HOH A . C 3 HOH 4 404 5 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C 2 1 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3120 ? 1 MORE -18 ? 1 'SSA (A^2)' 18620 ? 2 'ABSA (A^2)' 0 ? 2 MORE 0 ? 2 'SSA (A^2)' 10870 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_644 y+1,x-1,-z-1/4 0.0000000000 1.0000000000 0.0000000000 51.6730000000 1.0000000000 0.0000000000 0.0000000000 -51.6730000000 0.0000000000 0.0000000000 -1.0000000000 -53.9315000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-12 2 'Structure model' 1 1 2022-04-13 3 'Structure model' 1 2 2022-06-01 4 'Structure model' 1 3 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.17.1_3660: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7TCZ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 SG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 161 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H012 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GIT _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.29 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NH2 A ARG 183 ? ? 1_555 OE1 A GLU 251 ? ? 5_655 1.32 2 1 O A SER 113 ? ? 1_555 OE1 A GLN 116 ? ? 5_655 2.13 3 1 N A LEU 106 ? ? 1_555 OD1 A ASP 227 ? ? 7_644 2.17 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 183 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 183 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 183 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 115.77 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -4.53 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 10 ? ? -137.46 -35.98 2 1 VAL A 11 ? ? -87.10 34.15 3 1 ALA A 21 ? ? -173.07 136.30 4 1 ALA A 67 ? ? -110.63 54.20 5 1 ALA A 74 ? ? -174.30 134.21 6 1 VAL A 78 ? ? -127.37 -167.31 7 1 SER A 113 ? ? -25.91 -64.03 8 1 TYR A 128 ? ? -113.39 58.91 9 1 ARG A 165 ? ? 77.14 -52.00 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 6 ? CG ? A GLN 13 CG 2 1 Y 1 A GLN 6 ? CD ? A GLN 13 CD 3 1 Y 1 A GLN 6 ? OE1 ? A GLN 13 OE1 4 1 Y 1 A GLN 6 ? NE2 ? A GLN 13 NE2 5 1 Y 1 A GLN 7 ? CG ? A GLN 14 CG 6 1 Y 1 A GLN 7 ? CD ? A GLN 14 CD 7 1 Y 1 A GLN 7 ? OE1 ? A GLN 14 OE1 8 1 Y 1 A GLN 7 ? NE2 ? A GLN 14 NE2 9 1 Y 1 A ASP 28 ? CG ? A ASP 35 CG 10 1 Y 1 A ASP 28 ? OD1 ? A ASP 35 OD1 11 1 Y 1 A ASP 28 ? OD2 ? A ASP 35 OD2 12 1 Y 1 A VAL 55 ? CG1 ? A VAL 62 CG1 13 1 Y 1 A VAL 55 ? CG2 ? A VAL 62 CG2 14 1 Y 1 A LYS 156 ? CG ? A LYS 163 CG 15 1 Y 1 A LYS 156 ? CD ? A LYS 163 CD 16 1 Y 1 A LYS 156 ? CE ? A LYS 163 CE 17 1 Y 1 A LYS 156 ? NZ ? A LYS 163 NZ 18 1 Y 1 A ARG 165 ? CG ? A ARG 172 CG 19 1 Y 1 A ARG 165 ? CD ? A ARG 172 CD 20 1 Y 1 A ARG 165 ? NE ? A ARG 172 NE 21 1 Y 1 A ARG 165 ? CZ ? A ARG 172 CZ 22 1 Y 1 A ARG 165 ? NH1 ? A ARG 172 NH1 23 1 Y 1 A ARG 165 ? NH2 ? A ARG 172 NH2 24 1 Y 1 A ARG 201 ? CG ? A ARG 208 CG 25 1 Y 1 A ARG 201 ? CD ? A ARG 208 CD 26 1 Y 1 A ARG 201 ? NE ? A ARG 208 NE 27 1 Y 1 A ARG 201 ? CZ ? A ARG 208 CZ 28 1 Y 1 A ARG 201 ? NH1 ? A ARG 208 NH1 29 1 Y 1 A ARG 201 ? NH2 ? A ARG 208 NH2 30 1 Y 1 A SER 210 ? OG ? A SER 217 OG 31 1 Y 1 A ARG 232 ? CG ? A ARG 239 CG 32 1 Y 1 A ARG 232 ? CD ? A ARG 239 CD 33 1 Y 1 A ARG 232 ? NE ? A ARG 239 NE 34 1 Y 1 A ARG 232 ? CZ ? A ARG 239 CZ 35 1 Y 1 A ARG 232 ? NH1 ? A ARG 239 NH1 36 1 Y 1 A ARG 232 ? NH2 ? A ARG 239 NH2 37 1 Y 1 A ARG 250 ? CG ? A ARG 257 CG 38 1 Y 1 A ARG 250 ? CD ? A ARG 257 CD 39 1 Y 1 A ARG 250 ? NE ? A ARG 257 NE 40 1 Y 1 A ARG 250 ? CZ ? A ARG 257 CZ 41 1 Y 1 A ARG 250 ? NH1 ? A ARG 257 NH1 42 1 Y 1 A ARG 250 ? NH2 ? A ARG 257 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -6 ? A MET 1 2 1 Y 1 A HIS -5 ? A HIS 2 3 1 Y 1 A HIS -4 ? A HIS 3 4 1 Y 1 A HIS -3 ? A HIS 4 5 1 Y 1 A HIS -2 ? A HIS 5 6 1 Y 1 A HIS -1 ? A HIS 6 7 1 Y 1 A HIS 0 ? A HIS 7 8 1 Y 1 A MET 1 ? A MET 8 9 1 Y 1 A THR 2 ? A THR 9 10 1 Y 1 A MET 3 ? A MET 10 11 1 Y 1 A ASP 4 ? A ASP 11 12 1 Y 1 A GLU 5 ? A GLU 12 13 1 Y 1 A ALA 45 ? A ALA 52 14 1 Y 1 A GLN 46 ? A GLN 53 15 1 Y 1 A GLY 47 ? A GLY 54 16 1 Y 1 A GLN 48 ? A GLN 55 17 1 Y 1 A GLY 49 ? A GLY 56 18 1 Y 1 A GLN 50 ? A GLN 57 19 1 Y 1 A PRO 51 ? A PRO 58 20 1 Y 1 A SER 52 ? A SER 59 21 1 Y 1 A LEU 53 ? A LEU 60 22 1 Y 1 A SER 54 ? A SER 61 23 1 Y 1 A SER 135 ? A SER 142 24 1 Y 1 A ARG 136 ? A ARG 143 25 1 Y 1 A ARG 137 ? A ARG 144 26 1 Y 1 A ALA 138 ? A ALA 145 27 1 Y 1 A ASP 139 ? A ASP 146 28 1 Y 1 A ASP 140 ? A ASP 147 29 1 Y 1 A VAL 141 ? A VAL 148 30 1 Y 1 A GLU 142 ? A GLU 149 31 1 Y 1 A VAL 143 ? A VAL 150 32 1 Y 1 A ALA 144 ? A ALA 151 33 1 Y 1 A THR 145 ? A THR 152 34 1 Y 1 A SER 146 ? A SER 153 35 1 Y 1 A LEU 147 ? A LEU 154 36 1 Y 1 A SER 148 ? A SER 155 37 1 Y 1 A GLY 149 ? A GLY 156 38 1 Y 1 A SER 150 ? A SER 157 39 1 Y 1 A GLU 151 ? A GLU 158 40 1 Y 1 A THR 152 ? A THR 159 41 1 Y 1 A THR 153 ? A THR 160 42 1 Y 1 A PRO 154 ? A PRO 161 43 1 Y 1 A ALA 202 ? A ALA 209 44 1 Y 1 A GLY 203 ? A GLY 210 45 1 Y 1 A SER 204 ? A SER 211 46 1 Y 1 A THR 205 ? A THR 212 47 1 Y 1 A ALA 206 ? A ALA 213 48 1 Y 1 A VAL 207 ? A VAL 214 49 1 Y 1 A ASP 208 ? A ASP 215 50 1 Y 1 A VAL 209 ? A VAL 216 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GIT C15 C N N 88 GIT C17 C Y N 89 GIT C22 C Y N 90 GIT C12 C N N 91 GIT C18 C Y N 92 GIT C01 C N N 93 GIT C02 C N N 94 GIT C04 C N N 95 GIT C08 C Y N 96 GIT C09 C Y N 97 GIT C10 C N N 98 GIT C16 C Y N 99 GIT C19 C Y N 100 GIT C20 C Y N 101 GIT C21 C Y N 102 GIT C23 C Y N 103 GIT C24 C Y N 104 GIT C25 C Y N 105 GIT C26 C Y N 106 GIT C27 C Y N 107 GIT N05 N Y N 108 GIT N06 N Y N 109 GIT N07 N Y N 110 GIT N14 N N N 111 GIT O03 O N N 112 GIT O11 O N N 113 GIT O13 O N N 114 GIT H151 H N N 115 GIT H152 H N N 116 GIT H171 H N N 117 GIT H181 H N N 118 GIT H012 H N N 119 GIT H1 H N N 120 GIT H011 H N N 121 GIT H041 H N N 122 GIT H042 H N N 123 GIT H102 H N N 124 GIT H101 H N N 125 GIT H191 H N N 126 GIT H201 H N N 127 GIT H211 H N N 128 GIT H231 H N N 129 GIT H241 H N N 130 GIT H251 H N N 131 GIT H261 H N N 132 GIT H271 H N N 133 GIT H141 H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 PHE N N N N 297 PHE CA C N S 298 PHE C C N N 299 PHE O O N N 300 PHE CB C N N 301 PHE CG C Y N 302 PHE CD1 C Y N 303 PHE CD2 C Y N 304 PHE CE1 C Y N 305 PHE CE2 C Y N 306 PHE CZ C Y N 307 PHE OXT O N N 308 PHE H H N N 309 PHE H2 H N N 310 PHE HA H N N 311 PHE HB2 H N N 312 PHE HB3 H N N 313 PHE HD1 H N N 314 PHE HD2 H N N 315 PHE HE1 H N N 316 PHE HE2 H N N 317 PHE HZ H N N 318 PHE HXT H N N 319 PRO N N N N 320 PRO CA C N S 321 PRO C C N N 322 PRO O O N N 323 PRO CB C N N 324 PRO CG C N N 325 PRO CD C N N 326 PRO OXT O N N 327 PRO H H N N 328 PRO HA H N N 329 PRO HB2 H N N 330 PRO HB3 H N N 331 PRO HG2 H N N 332 PRO HG3 H N N 333 PRO HD2 H N N 334 PRO HD3 H N N 335 PRO HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 THR N N N N 351 THR CA C N S 352 THR C C N N 353 THR O O N N 354 THR CB C N R 355 THR OG1 O N N 356 THR CG2 C N N 357 THR OXT O N N 358 THR H H N N 359 THR H2 H N N 360 THR HA H N N 361 THR HB H N N 362 THR HG1 H N N 363 THR HG21 H N N 364 THR HG22 H N N 365 THR HG23 H N N 366 THR HXT H N N 367 TRP N N N N 368 TRP CA C N S 369 TRP C C N N 370 TRP O O N N 371 TRP CB C N N 372 TRP CG C Y N 373 TRP CD1 C Y N 374 TRP CD2 C Y N 375 TRP NE1 N Y N 376 TRP CE2 C Y N 377 TRP CE3 C Y N 378 TRP CZ2 C Y N 379 TRP CZ3 C Y N 380 TRP CH2 C Y N 381 TRP OXT O N N 382 TRP H H N N 383 TRP H2 H N N 384 TRP HA H N N 385 TRP HB2 H N N 386 TRP HB3 H N N 387 TRP HD1 H N N 388 TRP HE1 H N N 389 TRP HE3 H N N 390 TRP HZ2 H N N 391 TRP HZ3 H N N 392 TRP HH2 H N N 393 TRP HXT H N N 394 TYR N N N N 395 TYR CA C N S 396 TYR C C N N 397 TYR O O N N 398 TYR CB C N N 399 TYR CG C Y N 400 TYR CD1 C Y N 401 TYR CD2 C Y N 402 TYR CE1 C Y N 403 TYR CE2 C Y N 404 TYR CZ C Y N 405 TYR OH O N N 406 TYR OXT O N N 407 TYR H H N N 408 TYR H2 H N N 409 TYR HA H N N 410 TYR HB2 H N N 411 TYR HB3 H N N 412 TYR HD1 H N N 413 TYR HD2 H N N 414 TYR HE1 H N N 415 TYR HE2 H N N 416 TYR HH H N N 417 TYR HXT H N N 418 VAL N N N N 419 VAL CA C N S 420 VAL C C N N 421 VAL O O N N 422 VAL CB C N N 423 VAL CG1 C N N 424 VAL CG2 C N N 425 VAL OXT O N N 426 VAL H H N N 427 VAL H2 H N N 428 VAL HA H N N 429 VAL HB H N N 430 VAL HG11 H N N 431 VAL HG12 H N N 432 VAL HG13 H N N 433 VAL HG21 H N N 434 VAL HG22 H N N 435 VAL HG23 H N N 436 VAL HXT H N N 437 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GIT C17 C18 doub Y N 83 GIT C17 C16 sing Y N 84 GIT C18 C19 sing Y N 85 GIT C15 C16 sing N N 86 GIT C15 N14 sing N N 87 GIT C16 C21 doub Y N 88 GIT N14 C12 sing N N 89 GIT C19 C20 doub Y N 90 GIT O13 C12 doub N N 91 GIT C12 O11 sing N N 92 GIT C21 C20 sing Y N 93 GIT C26 C25 doub Y N 94 GIT C26 C27 sing Y N 95 GIT C25 C24 sing Y N 96 GIT C27 C22 doub Y N 97 GIT O11 C10 sing N N 98 GIT C10 C09 sing N N 99 GIT C24 C23 doub Y N 100 GIT C22 C23 sing Y N 101 GIT C22 C08 sing N N 102 GIT C09 C08 doub Y N 103 GIT C09 N05 sing Y N 104 GIT C08 N07 sing Y N 105 GIT N05 C04 sing N N 106 GIT N05 N06 sing Y N 107 GIT C04 C02 sing N N 108 GIT N07 N06 doub Y N 109 GIT O03 C02 doub N N 110 GIT C02 C01 sing N N 111 GIT C15 H151 sing N N 112 GIT C15 H152 sing N N 113 GIT C17 H171 sing N N 114 GIT C18 H181 sing N N 115 GIT C01 H012 sing N N 116 GIT C01 H1 sing N N 117 GIT C01 H011 sing N N 118 GIT C04 H041 sing N N 119 GIT C04 H042 sing N N 120 GIT C10 H102 sing N N 121 GIT C10 H101 sing N N 122 GIT C19 H191 sing N N 123 GIT C20 H201 sing N N 124 GIT C21 H211 sing N N 125 GIT C23 H231 sing N N 126 GIT C24 H241 sing N N 127 GIT C25 H251 sing N N 128 GIT C26 H261 sing N N 129 GIT C27 H271 sing N N 130 GIT N14 H141 sing N N 131 GLN N CA sing N N 132 GLN N H sing N N 133 GLN N H2 sing N N 134 GLN CA C sing N N 135 GLN CA CB sing N N 136 GLN CA HA sing N N 137 GLN C O doub N N 138 GLN C OXT sing N N 139 GLN CB CG sing N N 140 GLN CB HB2 sing N N 141 GLN CB HB3 sing N N 142 GLN CG CD sing N N 143 GLN CG HG2 sing N N 144 GLN CG HG3 sing N N 145 GLN CD OE1 doub N N 146 GLN CD NE2 sing N N 147 GLN NE2 HE21 sing N N 148 GLN NE2 HE22 sing N N 149 GLN OXT HXT sing N N 150 GLU N CA sing N N 151 GLU N H sing N N 152 GLU N H2 sing N N 153 GLU CA C sing N N 154 GLU CA CB sing N N 155 GLU CA HA sing N N 156 GLU C O doub N N 157 GLU C OXT sing N N 158 GLU CB CG sing N N 159 GLU CB HB2 sing N N 160 GLU CB HB3 sing N N 161 GLU CG CD sing N N 162 GLU CG HG2 sing N N 163 GLU CG HG3 sing N N 164 GLU CD OE1 doub N N 165 GLU CD OE2 sing N N 166 GLU OE2 HE2 sing N N 167 GLU OXT HXT sing N N 168 GLY N CA sing N N 169 GLY N H sing N N 170 GLY N H2 sing N N 171 GLY CA C sing N N 172 GLY CA HA2 sing N N 173 GLY CA HA3 sing N N 174 GLY C O doub N N 175 GLY C OXT sing N N 176 GLY OXT HXT sing N N 177 HIS N CA sing N N 178 HIS N H sing N N 179 HIS N H2 sing N N 180 HIS CA C sing N N 181 HIS CA CB sing N N 182 HIS CA HA sing N N 183 HIS C O doub N N 184 HIS C OXT sing N N 185 HIS CB CG sing N N 186 HIS CB HB2 sing N N 187 HIS CB HB3 sing N N 188 HIS CG ND1 sing Y N 189 HIS CG CD2 doub Y N 190 HIS ND1 CE1 doub Y N 191 HIS ND1 HD1 sing N N 192 HIS CD2 NE2 sing Y N 193 HIS CD2 HD2 sing N N 194 HIS CE1 NE2 sing Y N 195 HIS CE1 HE1 sing N N 196 HIS NE2 HE2 sing N N 197 HIS OXT HXT sing N N 198 HOH O H1 sing N N 199 HOH O H2 sing N N 200 ILE N CA sing N N 201 ILE N H sing N N 202 ILE N H2 sing N N 203 ILE CA C sing N N 204 ILE CA CB sing N N 205 ILE CA HA sing N N 206 ILE C O doub N N 207 ILE C OXT sing N N 208 ILE CB CG1 sing N N 209 ILE CB CG2 sing N N 210 ILE CB HB sing N N 211 ILE CG1 CD1 sing N N 212 ILE CG1 HG12 sing N N 213 ILE CG1 HG13 sing N N 214 ILE CG2 HG21 sing N N 215 ILE CG2 HG22 sing N N 216 ILE CG2 HG23 sing N N 217 ILE CD1 HD11 sing N N 218 ILE CD1 HD12 sing N N 219 ILE CD1 HD13 sing N N 220 ILE OXT HXT sing N N 221 LEU N CA sing N N 222 LEU N H sing N N 223 LEU N H2 sing N N 224 LEU CA C sing N N 225 LEU CA CB sing N N 226 LEU CA HA sing N N 227 LEU C O doub N N 228 LEU C OXT sing N N 229 LEU CB CG sing N N 230 LEU CB HB2 sing N N 231 LEU CB HB3 sing N N 232 LEU CG CD1 sing N N 233 LEU CG CD2 sing N N 234 LEU CG HG sing N N 235 LEU CD1 HD11 sing N N 236 LEU CD1 HD12 sing N N 237 LEU CD1 HD13 sing N N 238 LEU CD2 HD21 sing N N 239 LEU CD2 HD22 sing N N 240 LEU CD2 HD23 sing N N 241 LEU OXT HXT sing N N 242 LYS N CA sing N N 243 LYS N H sing N N 244 LYS N H2 sing N N 245 LYS CA C sing N N 246 LYS CA CB sing N N 247 LYS CA HA sing N N 248 LYS C O doub N N 249 LYS C OXT sing N N 250 LYS CB CG sing N N 251 LYS CB HB2 sing N N 252 LYS CB HB3 sing N N 253 LYS CG CD sing N N 254 LYS CG HG2 sing N N 255 LYS CG HG3 sing N N 256 LYS CD CE sing N N 257 LYS CD HD2 sing N N 258 LYS CD HD3 sing N N 259 LYS CE NZ sing N N 260 LYS CE HE2 sing N N 261 LYS CE HE3 sing N N 262 LYS NZ HZ1 sing N N 263 LYS NZ HZ2 sing N N 264 LYS NZ HZ3 sing N N 265 LYS OXT HXT sing N N 266 MET N CA sing N N 267 MET N H sing N N 268 MET N H2 sing N N 269 MET CA C sing N N 270 MET CA CB sing N N 271 MET CA HA sing N N 272 MET C O doub N N 273 MET C OXT sing N N 274 MET CB CG sing N N 275 MET CB HB2 sing N N 276 MET CB HB3 sing N N 277 MET CG SD sing N N 278 MET CG HG2 sing N N 279 MET CG HG3 sing N N 280 MET SD CE sing N N 281 MET CE HE1 sing N N 282 MET CE HE2 sing N N 283 MET CE HE3 sing N N 284 MET OXT HXT sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TRP N CA sing N N 355 TRP N H sing N N 356 TRP N H2 sing N N 357 TRP CA C sing N N 358 TRP CA CB sing N N 359 TRP CA HA sing N N 360 TRP C O doub N N 361 TRP C OXT sing N N 362 TRP CB CG sing N N 363 TRP CB HB2 sing N N 364 TRP CB HB3 sing N N 365 TRP CG CD1 doub Y N 366 TRP CG CD2 sing Y N 367 TRP CD1 NE1 sing Y N 368 TRP CD1 HD1 sing N N 369 TRP CD2 CE2 doub Y N 370 TRP CD2 CE3 sing Y N 371 TRP NE1 CE2 sing Y N 372 TRP NE1 HE1 sing N N 373 TRP CE2 CZ2 sing Y N 374 TRP CE3 CZ3 doub Y N 375 TRP CE3 HE3 sing N N 376 TRP CZ2 CH2 doub Y N 377 TRP CZ2 HZ2 sing N N 378 TRP CZ3 CH2 sing Y N 379 TRP CZ3 HZ3 sing N N 380 TRP CH2 HH2 sing N N 381 TRP OXT HXT sing N N 382 TYR N CA sing N N 383 TYR N H sing N N 384 TYR N H2 sing N N 385 TYR CA C sing N N 386 TYR CA CB sing N N 387 TYR CA HA sing N N 388 TYR C O doub N N 389 TYR C OXT sing N N 390 TYR CB CG sing N N 391 TYR CB HB2 sing N N 392 TYR CB HB3 sing N N 393 TYR CG CD1 doub Y N 394 TYR CG CD2 sing Y N 395 TYR CD1 CE1 sing Y N 396 TYR CD1 HD1 sing N N 397 TYR CD2 CE2 doub Y N 398 TYR CD2 HD2 sing N N 399 TYR CE1 CZ doub Y N 400 TYR CE1 HE1 sing N N 401 TYR CE2 CZ sing Y N 402 TYR CE2 HE2 sing N N 403 TYR CZ OH sing N N 404 TYR OH HH sing N N 405 TYR OXT HXT sing N N 406 VAL N CA sing N N 407 VAL N H sing N N 408 VAL N H2 sing N N 409 VAL CA C sing N N 410 VAL CA CB sing N N 411 VAL CA HA sing N N 412 VAL C O doub N N 413 VAL C OXT sing N N 414 VAL CB CG1 sing N N 415 VAL CB CG2 sing N N 416 VAL CB HB sing N N 417 VAL CG1 HG11 sing N N 418 VAL CG1 HG12 sing N N 419 VAL CG1 HG13 sing N N 420 VAL CG2 HG21 sing N N 421 VAL CG2 HG22 sing N N 422 VAL CG2 HG23 sing N N 423 VAL OXT HXT sing N N 424 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'P50 GM082250' 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM104659' 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GIT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GIT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[1-(2-oxopropyl)-4-phenyl-1H-1,2,3-triazol-5-yl]methyl benzylcarbamate' GIT 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1NJT _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Has the potential to dimerize.' #