data_7TE3 # _entry.id 7TE3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7TE3 pdb_00007te3 10.2210/pdb7te3/pdb WWPDB D_1000262126 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7TE3 _pdbx_database_status.recvd_initial_deposition_date 2022-01-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Geisbrecht, B.V.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-1775-0727 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Immunol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1664-3224 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 887742 _citation.page_last 887742 _citation.title ;gC1qR/C1qBP/HABP-1: Structural Analysis of the Trimeric Core Region, Interactions With a Novel Panel of Monoclonal Antibodies, and Their Influence on Binding to FXII. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fimmu.2022.887742 _citation.pdbx_database_id_PubMed 35865516 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Y.' 1 ? primary 'Vontz, A.J.' 2 ? primary 'Kallenberger, E.M.' 3 ? primary 'Xu, X.' 4 ? primary 'Ploscariu, N.T.' 5 ? primary 'Ramyar, K.X.' 6 ? primary 'Garcia, B.L.' 7 ? primary 'Ghebrehiwet, B.' 8 ? primary 'Geisbrecht, B.V.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7TE3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 80.529 _cell.length_a_esd ? _cell.length_b 80.529 _cell.length_b_esd ? _cell.length_c 114.552 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7TE3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Complement component 1 Q subcomponent-binding protein, mitochondrial' 20030.240 1 ? ? ? ? 2 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;ASF/SF2-associated protein p32,Glycoprotein gC1qBP,C1qBP,Hyaluronan-binding protein 1,Mitochondrial matrix protein p32,gC1q-R protein,p33,SF2AP32 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSTMHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSGGSTPNFVVEVI KNDDGKKALVLDCHYGDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEH QEYITFLEDLKSFVKSQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GSTMHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSGGSTPNFVVEVI KNDDGKKALVLDCHYGDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEH QEYITFLEDLKSFVKSQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 MET n 1 5 HIS n 1 6 THR n 1 7 ASP n 1 8 GLY n 1 9 ASP n 1 10 LYS n 1 11 ALA n 1 12 PHE n 1 13 VAL n 1 14 ASP n 1 15 PHE n 1 16 LEU n 1 17 SER n 1 18 ASP n 1 19 GLU n 1 20 ILE n 1 21 LYS n 1 22 GLU n 1 23 GLU n 1 24 ARG n 1 25 LYS n 1 26 ILE n 1 27 GLN n 1 28 LYS n 1 29 HIS n 1 30 LYS n 1 31 THR n 1 32 LEU n 1 33 PRO n 1 34 LYS n 1 35 MET n 1 36 SER n 1 37 GLY n 1 38 GLY n 1 39 TRP n 1 40 GLU n 1 41 LEU n 1 42 GLU n 1 43 LEU n 1 44 ASN n 1 45 GLY n 1 46 THR n 1 47 GLU n 1 48 ALA n 1 49 LYS n 1 50 LEU n 1 51 VAL n 1 52 ARG n 1 53 LYS n 1 54 VAL n 1 55 ALA n 1 56 GLY n 1 57 GLU n 1 58 LYS n 1 59 ILE n 1 60 THR n 1 61 VAL n 1 62 THR n 1 63 PHE n 1 64 ASN n 1 65 ILE n 1 66 ASN n 1 67 ASN n 1 68 SER n 1 69 GLY n 1 70 GLY n 1 71 SER n 1 72 THR n 1 73 PRO n 1 74 ASN n 1 75 PHE n 1 76 VAL n 1 77 VAL n 1 78 GLU n 1 79 VAL n 1 80 ILE n 1 81 LYS n 1 82 ASN n 1 83 ASP n 1 84 ASP n 1 85 GLY n 1 86 LYS n 1 87 LYS n 1 88 ALA n 1 89 LEU n 1 90 VAL n 1 91 LEU n 1 92 ASP n 1 93 CYS n 1 94 HIS n 1 95 TYR n 1 96 GLY n 1 97 ASP n 1 98 ILE n 1 99 PHE n 1 100 SER n 1 101 ILE n 1 102 ARG n 1 103 GLU n 1 104 VAL n 1 105 SER n 1 106 PHE n 1 107 GLN n 1 108 SER n 1 109 THR n 1 110 GLY n 1 111 GLU n 1 112 SER n 1 113 GLU n 1 114 TRP n 1 115 LYS n 1 116 ASP n 1 117 THR n 1 118 ASN n 1 119 TYR n 1 120 THR n 1 121 LEU n 1 122 ASN n 1 123 THR n 1 124 ASP n 1 125 SER n 1 126 LEU n 1 127 ASP n 1 128 TRP n 1 129 ALA n 1 130 LEU n 1 131 TYR n 1 132 ASP n 1 133 HIS n 1 134 LEU n 1 135 MET n 1 136 ASP n 1 137 PHE n 1 138 LEU n 1 139 ALA n 1 140 ASP n 1 141 ARG n 1 142 GLY n 1 143 VAL n 1 144 ASP n 1 145 ASN n 1 146 THR n 1 147 PHE n 1 148 ALA n 1 149 ASP n 1 150 GLU n 1 151 LEU n 1 152 VAL n 1 153 GLU n 1 154 LEU n 1 155 SER n 1 156 THR n 1 157 ALA n 1 158 LEU n 1 159 GLU n 1 160 HIS n 1 161 GLN n 1 162 GLU n 1 163 TYR n 1 164 ILE n 1 165 THR n 1 166 PHE n 1 167 LEU n 1 168 GLU n 1 169 ASP n 1 170 LEU n 1 171 LYS n 1 172 SER n 1 173 PHE n 1 174 VAL n 1 175 LYS n 1 176 SER n 1 177 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 177 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'C1QBP, GC1QBP, HABP1, SF2P32' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C1QBP_HUMAN _struct_ref.pdbx_db_accession Q07021 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQK VEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWA LYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ ; _struct_ref.pdbx_align_begin 75 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7TE3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q07021 _struct_ref_seq.db_align_beg 75 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 282 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 75 _struct_ref_seq.pdbx_auth_seq_align_end 247 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7TE3 GLY A 1 ? UNP Q07021 ? ? 'expression tag' 71 1 1 7TE3 SER A 2 ? UNP Q07021 ? ? 'expression tag' 72 2 1 7TE3 THR A 3 ? UNP Q07021 ? ? 'expression tag' 73 3 1 7TE3 MET A 4 ? UNP Q07021 ? ? 'expression tag' 74 4 1 7TE3 ? A ? ? UNP Q07021 ILE 139 deletion ? 5 1 7TE3 ? A ? ? UNP Q07021 PRO 140 deletion ? 6 1 7TE3 ? A ? ? UNP Q07021 PRO 141 deletion ? 7 1 7TE3 ? A ? ? UNP Q07021 THR 142 deletion ? 8 1 7TE3 ? A ? ? UNP Q07021 PHE 143 deletion ? 9 1 7TE3 ? A ? ? UNP Q07021 ASP 144 deletion ? 10 1 7TE3 ? A ? ? UNP Q07021 GLY 145 deletion ? 11 1 7TE3 ? A ? ? UNP Q07021 GLU 146 deletion ? 12 1 7TE3 ? A ? ? UNP Q07021 GLU 147 deletion ? 13 1 7TE3 ? A ? ? UNP Q07021 GLU 148 deletion ? 14 1 7TE3 ? A ? ? UNP Q07021 PRO 149 deletion ? 15 1 7TE3 ? A ? ? UNP Q07021 SER 150 deletion ? 16 1 7TE3 ? A ? ? UNP Q07021 GLN 151 deletion ? 17 1 7TE3 ? A ? ? UNP Q07021 GLY 152 deletion ? 18 1 7TE3 ? A ? ? UNP Q07021 GLN 153 deletion ? 19 1 7TE3 ? A ? ? UNP Q07021 LYS 154 deletion ? 20 1 7TE3 ? A ? ? UNP Q07021 VAL 155 deletion ? 21 1 7TE3 ? A ? ? UNP Q07021 GLU 156 deletion ? 22 1 7TE3 ? A ? ? UNP Q07021 GLU 157 deletion ? 23 1 7TE3 ? A ? ? UNP Q07021 GLN 158 deletion ? 24 1 7TE3 ? A ? ? UNP Q07021 GLU 159 deletion ? 25 1 7TE3 ? A ? ? UNP Q07021 PRO 160 deletion ? 26 1 7TE3 ? A ? ? UNP Q07021 GLU 161 deletion ? 27 1 7TE3 GLY A 69 ? UNP Q07021 LEU 162 conflict 139 28 1 7TE3 GLY A 70 ? UNP Q07021 THR 163 conflict 140 29 1 7TE3 ? A ? ? UNP Q07021 PRO 189 deletion ? 30 1 7TE3 ? A ? ? UNP Q07021 GLU 190 deletion ? 31 1 7TE3 ? A ? ? UNP Q07021 ASP 191 deletion ? 32 1 7TE3 ? A ? ? UNP Q07021 GLU 192 deletion ? 33 1 7TE3 ? A ? ? UNP Q07021 VAL 193 deletion ? 34 1 7TE3 ? A ? ? UNP Q07021 GLY 194 deletion ? 35 1 7TE3 ? A ? ? UNP Q07021 GLN 195 deletion ? 36 1 7TE3 ? A ? ? UNP Q07021 GLU 196 deletion ? 37 1 7TE3 ? A ? ? UNP Q07021 ASP 197 deletion ? 38 1 7TE3 ? A ? ? UNP Q07021 GLU 198 deletion ? 39 1 7TE3 ? A ? ? UNP Q07021 ALA 199 deletion ? 40 1 7TE3 ? A ? ? UNP Q07021 GLU 200 deletion ? 41 1 7TE3 GLY A 96 ? UNP Q07021 SER 201 conflict 166 42 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7TE3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M BisTris-HCl pH 6.5, 0.1 M sodium chloride, 1.5 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 45.400 _reflns.entry_id 7TE3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11799 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.300 _reflns.pdbx_Rmerge_I_obs 0.143 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.008 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.147 _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 239844 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.200 2.280 ? ? ? ? ? ? 1122 99.600 ? ? ? ? 1.865 ? ? ? ? ? ? ? ? 13.800 ? 1.037 ? ? 1.936 0.499 ? 1 1 0.544 ? ? ? ? ? ? ? ? ? ? 2.280 2.370 ? ? ? ? ? ? 1159 100.000 ? ? ? ? 1.705 ? ? ? ? ? ? ? ? 18.900 ? 1.009 ? ? 1.751 0.396 ? 2 1 0.750 ? ? ? ? ? ? ? ? ? ? 2.370 2.480 ? ? ? ? ? ? 1139 100.000 ? ? ? ? 1.371 ? ? ? ? ? ? ? ? 21.700 ? 1.031 ? ? 1.404 0.297 ? 3 1 0.869 ? ? ? ? ? ? ? ? ? ? 2.480 2.610 ? ? ? ? ? ? 1169 100.000 ? ? ? ? 0.928 ? ? ? ? ? ? ? ? 21.800 ? 1.033 ? ? 0.950 0.201 ? 4 1 0.935 ? ? ? ? ? ? ? ? ? ? 2.610 2.770 ? ? ? ? ? ? 1150 100.000 ? ? ? ? 0.599 ? ? ? ? ? ? ? ? 21.800 ? 1.018 ? ? 0.613 0.129 ? 5 1 0.969 ? ? ? ? ? ? ? ? ? ? 2.770 2.990 ? ? ? ? ? ? 1168 100.000 ? ? ? ? 0.363 ? ? ? ? ? ? ? ? 21.700 ? 0.982 ? ? 0.371 0.079 ? 6 1 0.989 ? ? ? ? ? ? ? ? ? ? 2.990 3.290 ? ? ? ? ? ? 1170 100.000 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? 21.600 ? 0.985 ? ? 0.197 0.042 ? 7 1 0.996 ? ? ? ? ? ? ? ? ? ? 3.290 3.760 ? ? ? ? ? ? 1183 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 21.500 ? 1.019 ? ? 0.120 0.026 ? 8 1 0.998 ? ? ? ? ? ? ? ? ? ? 3.760 4.740 ? ? ? ? ? ? 1215 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 21.100 ? 1.016 ? ? 0.081 0.018 ? 9 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.740 50.000 ? ? ? ? ? ? 1324 99.600 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 19.400 ? 0.963 ? ? 0.041 0.009 ? 10 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 108.120 _refine.B_iso_mean 55.1115 _refine.B_iso_min 29.860 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7TE3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 37.9900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11768 _refine.ls_number_reflns_R_free 1177 _refine.ls_number_reflns_R_work 10591 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8300 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2384 _refine.ls_R_factor_R_free 0.2878 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2329 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1P32 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.3600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 37.9900 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 1367 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 165 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 52.57 _refine_hist.pdbx_number_atoms_protein 1327 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1349 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.882 ? 1822 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.997 ? 489 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 206 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 235 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2000 2.3000 1413 . 141 1272 99.0000 . . . 0.3434 0.0000 0.3131 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.3000 2.4200 1422 . 141 1281 100.0000 . . . 0.3267 0.0000 0.2862 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.4200 2.5700 1439 . 145 1294 100.0000 . . . 0.3099 0.0000 0.2737 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.5700 2.7700 1449 . 145 1304 100.0000 . . . 0.3678 0.0000 0.2660 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.7700 3.0400 1457 . 145 1312 100.0000 . . . 0.3592 0.0000 0.2580 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 3.0400 3.4800 1470 . 147 1323 100.0000 . . . 0.2685 0.0000 0.2367 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 3.4800 4.3900 1502 . 150 1352 100.0000 . . . 0.2823 0.0000 0.2121 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 4.3900 37.9900 1616 . 163 1453 100.0000 . . . 0.2492 0.0000 0.2095 . . . . . . . 8 . . . # _struct.entry_id 7TE3 _struct.title 'Crystal Structure of a Double Loop Deletion Mutant in gC1qR/C1qBP/HABP-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7TE3 _struct_keywords.text 'complement, C1q-binding protein, coagulation, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? ILE A 26 ? THR A 76 ILE A 96 1 ? 21 HELX_P HELX_P2 AA2 ASP A 127 ? ARG A 141 ? ASP A 197 ARG A 211 1 ? 15 HELX_P HELX_P3 AA3 ASP A 144 ? SER A 176 ? ASP A 214 SER A 246 1 ? 33 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 40 ? ASN A 44 ? GLU A 110 ASN A 114 AA1 2 GLU A 47 ? LYS A 53 ? GLU A 117 LYS A 123 AA1 3 GLU A 57 ? ASN A 64 ? GLU A 127 ASN A 134 AA1 4 ASN A 74 ? LYS A 81 ? ASN A 144 LYS A 151 AA1 5 LYS A 87 ? HIS A 94 ? LYS A 157 HIS A 164 AA1 6 ILE A 101 ? SER A 108 ? ILE A 171 SER A 178 AA1 7 THR A 120 ? ASN A 122 ? THR A 190 ASN A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 44 ? N ASN A 114 O GLU A 47 ? O GLU A 117 AA1 2 3 N ARG A 52 ? N ARG A 122 O ILE A 59 ? O ILE A 129 AA1 3 4 N THR A 62 ? N THR A 132 O VAL A 76 ? O VAL A 146 AA1 4 5 N PHE A 75 ? N PHE A 145 O CYS A 93 ? O CYS A 163 AA1 5 6 N VAL A 90 ? N VAL A 160 O SER A 105 ? O SER A 175 AA1 6 7 N VAL A 104 ? N VAL A 174 O LEU A 121 ? O LEU A 191 # _atom_sites.entry_id 7TE3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012418 _atom_sites.fract_transf_matrix[1][2] 0.007169 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014339 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008730 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 71 ? ? ? A . n A 1 2 SER 2 72 ? ? ? A . n A 1 3 THR 3 73 ? ? ? A . n A 1 4 MET 4 74 ? ? ? A . n A 1 5 HIS 5 75 ? ? ? A . n A 1 6 THR 6 76 76 THR THR A . n A 1 7 ASP 7 77 77 ASP ASP A . n A 1 8 GLY 8 78 78 GLY GLY A . n A 1 9 ASP 9 79 79 ASP ASP A . n A 1 10 LYS 10 80 80 LYS LYS A . n A 1 11 ALA 11 81 81 ALA ALA A . n A 1 12 PHE 12 82 82 PHE PHE A . n A 1 13 VAL 13 83 83 VAL VAL A . n A 1 14 ASP 14 84 84 ASP ASP A . n A 1 15 PHE 15 85 85 PHE PHE A . n A 1 16 LEU 16 86 86 LEU LEU A . n A 1 17 SER 17 87 87 SER SER A . n A 1 18 ASP 18 88 88 ASP ASP A . n A 1 19 GLU 19 89 89 GLU GLU A . n A 1 20 ILE 20 90 90 ILE ILE A . n A 1 21 LYS 21 91 91 LYS LYS A . n A 1 22 GLU 22 92 92 GLU GLU A . n A 1 23 GLU 23 93 93 GLU GLU A . n A 1 24 ARG 24 94 94 ARG ARG A . n A 1 25 LYS 25 95 95 LYS LYS A . n A 1 26 ILE 26 96 96 ILE ILE A . n A 1 27 GLN 27 97 97 GLN GLN A . n A 1 28 LYS 28 98 ? ? ? A . n A 1 29 HIS 29 99 ? ? ? A . n A 1 30 LYS 30 100 ? ? ? A . n A 1 31 THR 31 101 101 THR THR A . n A 1 32 LEU 32 102 102 LEU LEU A . n A 1 33 PRO 33 103 103 PRO PRO A . n A 1 34 LYS 34 104 104 LYS LYS A . n A 1 35 MET 35 105 105 MET MET A . n A 1 36 SER 36 106 106 SER SER A . n A 1 37 GLY 37 107 107 GLY GLY A . n A 1 38 GLY 38 108 108 GLY GLY A . n A 1 39 TRP 39 109 109 TRP TRP A . n A 1 40 GLU 40 110 110 GLU GLU A . n A 1 41 LEU 41 111 111 LEU LEU A . n A 1 42 GLU 42 112 112 GLU GLU A . n A 1 43 LEU 43 113 113 LEU LEU A . n A 1 44 ASN 44 114 114 ASN ASN A . n A 1 45 GLY 45 115 115 GLY GLY A . n A 1 46 THR 46 116 116 THR THR A . n A 1 47 GLU 47 117 117 GLU GLU A . n A 1 48 ALA 48 118 118 ALA ALA A . n A 1 49 LYS 49 119 119 LYS LYS A . n A 1 50 LEU 50 120 120 LEU LEU A . n A 1 51 VAL 51 121 121 VAL VAL A . n A 1 52 ARG 52 122 122 ARG ARG A . n A 1 53 LYS 53 123 123 LYS LYS A . n A 1 54 VAL 54 124 124 VAL VAL A . n A 1 55 ALA 55 125 125 ALA ALA A . n A 1 56 GLY 56 126 126 GLY GLY A . n A 1 57 GLU 57 127 127 GLU GLU A . n A 1 58 LYS 58 128 128 LYS LYS A . n A 1 59 ILE 59 129 129 ILE ILE A . n A 1 60 THR 60 130 130 THR THR A . n A 1 61 VAL 61 131 131 VAL VAL A . n A 1 62 THR 62 132 132 THR THR A . n A 1 63 PHE 63 133 133 PHE PHE A . n A 1 64 ASN 64 134 134 ASN ASN A . n A 1 65 ILE 65 135 135 ILE ILE A . n A 1 66 ASN 66 136 136 ASN ASN A . n A 1 67 ASN 67 137 137 ASN ASN A . n A 1 68 SER 68 138 ? ? ? A . n A 1 69 GLY 69 139 ? ? ? A . n A 1 70 GLY 70 140 ? ? ? A . n A 1 71 SER 71 141 ? ? ? A . n A 1 72 THR 72 142 142 THR THR A . n A 1 73 PRO 73 143 143 PRO PRO A . n A 1 74 ASN 74 144 144 ASN ASN A . n A 1 75 PHE 75 145 145 PHE PHE A . n A 1 76 VAL 76 146 146 VAL VAL A . n A 1 77 VAL 77 147 147 VAL VAL A . n A 1 78 GLU 78 148 148 GLU GLU A . n A 1 79 VAL 79 149 149 VAL VAL A . n A 1 80 ILE 80 150 150 ILE ILE A . n A 1 81 LYS 81 151 151 LYS LYS A . n A 1 82 ASN 82 152 152 ASN ASN A . n A 1 83 ASP 83 153 153 ASP ASP A . n A 1 84 ASP 84 154 154 ASP ASP A . n A 1 85 GLY 85 155 155 GLY GLY A . n A 1 86 LYS 86 156 156 LYS LYS A . n A 1 87 LYS 87 157 157 LYS LYS A . n A 1 88 ALA 88 158 158 ALA ALA A . n A 1 89 LEU 89 159 159 LEU LEU A . n A 1 90 VAL 90 160 160 VAL VAL A . n A 1 91 LEU 91 161 161 LEU LEU A . n A 1 92 ASP 92 162 162 ASP ASP A . n A 1 93 CYS 93 163 163 CYS CYS A . n A 1 94 HIS 94 164 164 HIS HIS A . n A 1 95 TYR 95 165 165 TYR TYR A . n A 1 96 GLY 96 166 166 GLY GLY A . n A 1 97 ASP 97 167 167 ASP ASP A . n A 1 98 ILE 98 168 168 ILE ILE A . n A 1 99 PHE 99 169 169 PHE PHE A . n A 1 100 SER 100 170 170 SER SER A . n A 1 101 ILE 101 171 171 ILE ILE A . n A 1 102 ARG 102 172 172 ARG ARG A . n A 1 103 GLU 103 173 173 GLU GLU A . n A 1 104 VAL 104 174 174 VAL VAL A . n A 1 105 SER 105 175 175 SER SER A . n A 1 106 PHE 106 176 176 PHE PHE A . n A 1 107 GLN 107 177 177 GLN GLN A . n A 1 108 SER 108 178 178 SER SER A . n A 1 109 THR 109 179 179 THR THR A . n A 1 110 GLY 110 180 180 GLY GLY A . n A 1 111 GLU 111 181 181 GLU GLU A . n A 1 112 SER 112 182 182 SER SER A . n A 1 113 GLU 113 183 183 GLU GLU A . n A 1 114 TRP 114 184 184 TRP TRP A . n A 1 115 LYS 115 185 185 LYS LYS A . n A 1 116 ASP 116 186 186 ASP ASP A . n A 1 117 THR 117 187 187 THR THR A . n A 1 118 ASN 118 188 188 ASN ASN A . n A 1 119 TYR 119 189 189 TYR TYR A . n A 1 120 THR 120 190 190 THR THR A . n A 1 121 LEU 121 191 191 LEU LEU A . n A 1 122 ASN 122 192 192 ASN ASN A . n A 1 123 THR 123 193 193 THR THR A . n A 1 124 ASP 124 194 194 ASP ASP A . n A 1 125 SER 125 195 195 SER SER A . n A 1 126 LEU 126 196 196 LEU LEU A . n A 1 127 ASP 127 197 197 ASP ASP A . n A 1 128 TRP 128 198 198 TRP TRP A . n A 1 129 ALA 129 199 199 ALA ALA A . n A 1 130 LEU 130 200 200 LEU LEU A . n A 1 131 TYR 131 201 201 TYR TYR A . n A 1 132 ASP 132 202 202 ASP ASP A . n A 1 133 HIS 133 203 203 HIS HIS A . n A 1 134 LEU 134 204 204 LEU LEU A . n A 1 135 MET 135 205 205 MET MET A . n A 1 136 ASP 136 206 206 ASP ASP A . n A 1 137 PHE 137 207 207 PHE PHE A . n A 1 138 LEU 138 208 208 LEU LEU A . n A 1 139 ALA 139 209 209 ALA ALA A . n A 1 140 ASP 140 210 210 ASP ASP A . n A 1 141 ARG 141 211 211 ARG ARG A . n A 1 142 GLY 142 212 212 GLY GLY A . n A 1 143 VAL 143 213 213 VAL VAL A . n A 1 144 ASP 144 214 214 ASP ASP A . n A 1 145 ASN 145 215 215 ASN ASN A . n A 1 146 THR 146 216 216 THR THR A . n A 1 147 PHE 147 217 217 PHE PHE A . n A 1 148 ALA 148 218 218 ALA ALA A . n A 1 149 ASP 149 219 219 ASP ASP A . n A 1 150 GLU 150 220 220 GLU GLU A . n A 1 151 LEU 151 221 221 LEU LEU A . n A 1 152 VAL 152 222 222 VAL VAL A . n A 1 153 GLU 153 223 223 GLU GLU A . n A 1 154 LEU 154 224 224 LEU LEU A . n A 1 155 SER 155 225 225 SER SER A . n A 1 156 THR 156 226 226 THR THR A . n A 1 157 ALA 157 227 227 ALA ALA A . n A 1 158 LEU 158 228 228 LEU LEU A . n A 1 159 GLU 159 229 229 GLU GLU A . n A 1 160 HIS 160 230 230 HIS HIS A . n A 1 161 GLN 161 231 231 GLN GLN A . n A 1 162 GLU 162 232 232 GLU GLU A . n A 1 163 TYR 163 233 233 TYR TYR A . n A 1 164 ILE 164 234 234 ILE ILE A . n A 1 165 THR 165 235 235 THR THR A . n A 1 166 PHE 166 236 236 PHE PHE A . n A 1 167 LEU 167 237 237 LEU LEU A . n A 1 168 GLU 168 238 238 GLU GLU A . n A 1 169 ASP 169 239 239 ASP ASP A . n A 1 170 LEU 170 240 240 LEU LEU A . n A 1 171 LYS 171 241 241 LYS LYS A . n A 1 172 SER 172 242 242 SER SER A . n A 1 173 PHE 173 243 243 PHE PHE A . n A 1 174 VAL 174 244 244 VAL VAL A . n A 1 175 LYS 175 245 245 LYS LYS A . n A 1 176 SER 176 246 246 SER SER A . n A 1 177 GLN 177 247 247 GLN GLN A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email bvglab@ksu.edu _pdbx_contact_author.name_first Brian _pdbx_contact_author.name_last Geisbrecht _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1775-0727 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 1 HOH HOH A . B 2 HOH 2 302 11 HOH HOH A . B 2 HOH 3 303 26 HOH HOH A . B 2 HOH 4 304 16 HOH HOH A . B 2 HOH 5 305 17 HOH HOH A . B 2 HOH 6 306 36 HOH HOH A . B 2 HOH 7 307 42 HOH HOH A . B 2 HOH 8 308 9 HOH HOH A . B 2 HOH 9 309 18 HOH HOH A . B 2 HOH 10 310 2 HOH HOH A . B 2 HOH 11 311 35 HOH HOH A . B 2 HOH 12 312 6 HOH HOH A . B 2 HOH 13 313 25 HOH HOH A . B 2 HOH 14 314 4 HOH HOH A . B 2 HOH 15 315 12 HOH HOH A . B 2 HOH 16 316 45 HOH HOH A . B 2 HOH 17 317 33 HOH HOH A . B 2 HOH 18 318 27 HOH HOH A . B 2 HOH 19 319 14 HOH HOH A . B 2 HOH 20 320 28 HOH HOH A . B 2 HOH 21 321 13 HOH HOH A . B 2 HOH 22 322 7 HOH HOH A . B 2 HOH 23 323 31 HOH HOH A . B 2 HOH 24 324 22 HOH HOH A . B 2 HOH 25 325 3 HOH HOH A . B 2 HOH 26 326 41 HOH HOH A . B 2 HOH 27 327 39 HOH HOH A . B 2 HOH 28 328 38 HOH HOH A . B 2 HOH 29 329 21 HOH HOH A . B 2 HOH 30 330 5 HOH HOH A . B 2 HOH 31 331 10 HOH HOH A . B 2 HOH 32 332 24 HOH HOH A . B 2 HOH 33 333 20 HOH HOH A . B 2 HOH 34 334 32 HOH HOH A . B 2 HOH 35 335 37 HOH HOH A . B 2 HOH 36 336 29 HOH HOH A . B 2 HOH 37 337 15 HOH HOH A . B 2 HOH 38 338 19 HOH HOH A . B 2 HOH 39 339 40 HOH HOH A . B 2 HOH 40 340 8 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6060 ? 1 MORE -37 ? 1 'SSA (A^2)' 25250 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 40.2645000000 0.8660254038 -0.5000000000 0.0000000000 69.7401597414 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -40.2645000000 -0.8660254038 -0.5000000000 0.0000000000 69.7401597414 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-01 2 'Structure model' 1 1 2022-12-14 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? v1.19.2 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 124 ? ? -117.39 -85.80 2 1 ASP A 167 ? ? -54.23 -79.50 3 1 PHE A 169 ? ? -69.09 -101.99 4 1 SER A 170 ? ? 69.87 142.24 5 1 ASP A 197 ? ? -28.12 122.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 71 ? A GLY 1 2 1 Y 1 A SER 72 ? A SER 2 3 1 Y 1 A THR 73 ? A THR 3 4 1 Y 1 A MET 74 ? A MET 4 5 1 Y 1 A HIS 75 ? A HIS 5 6 1 Y 1 A LYS 98 ? A LYS 28 7 1 Y 1 A HIS 99 ? A HIS 29 8 1 Y 1 A LYS 100 ? A LYS 30 9 1 Y 1 A SER 138 ? A SER 68 10 1 Y 1 A GLY 139 ? A GLY 69 11 1 Y 1 A GLY 140 ? A GLY 70 12 1 Y 1 A SER 141 ? A SER 71 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R35GM140852 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1P32 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #