data_7U5V # _entry.id 7U5V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.390 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7U5V pdb_00007u5v 10.2210/pdb7u5v/pdb WWPDB D_1000263460 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-09-27 2 'Structure model' 1 1 2024-04-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7U5V _pdbx_database_status.recvd_initial_deposition_date 2022-03-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email yalidou@usc.edu _pdbx_contact_author.name_first Yali _pdbx_contact_author.name_last Dou _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4040-1429 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'An, S.' 1 0000-0001-7678-2684 'Cho, U.S.' 2 0000-0002-6992-2455 'Oh, H.' 3 0000-0002-9116-0223 'Sha, L.' 4 0000-0003-0748-9630 'Xu, J.' 5 0000-0001-9845-3304 'Kim, S.' 6 0000-0001-5873-6430 'Yang, W.' 7 0000-0002-6108-7301 'An, W.' 8 0000-0001-8756-595X 'Dou, Y.' 9 0000-0002-4040-1429 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat.Cell Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1465-7392 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 25 _citation.language ? _citation.page_first 1637 _citation.page_last 1649 _citation.title 'Non-canonical MLL1 activity regulates centromeric phase separation and genome stability.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41556-023-01270-1 _citation.pdbx_database_id_PubMed 37945831 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sha, L.' 1 0000-0003-0748-9630 primary 'Yang, Z.' 2 0009-0003-9161-6299 primary 'An, S.' 3 ? primary 'Yang, W.' 4 ? primary 'Kim, S.' 5 0000-0001-5873-6430 primary 'Oh, H.' 6 ? primary 'Xu, J.' 7 ? primary 'Yin, J.' 8 ? primary 'Wang, H.' 9 0000-0003-4144-9122 primary 'Lenz, H.J.' 10 0000-0003-2178-9568 primary 'An, W.' 11 0000-0001-8756-595X primary 'Cho, U.S.' 12 0000-0002-6992-2455 primary 'Dou, Y.' 13 0000-0002-4040-1429 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone-lysine N-methyltransferase 2A' 18002.770 1 ? ? 'SET Domain' ? 2 polymer syn Borealin 1090.343 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE 384.411 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;Lysine N-methyltransferase 2A,ALL-1,CXXC-type zinc finger protein 7,Myeloid/lymphoid or mixed-lineage leukemia,Myeloid/lymphoid or mixed-lineage leukemia protein 1,Trithorax-like protein,Zinc finger protein HRX ; 2 'Cell division cycle-associated protein 8,Dasra-B,hDasra-B,Pluripotent embryonic stem cell-related gene 3 protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SMDLPMPMRFRALAAASAAAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDS EVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYAFPIEDASNKLPCNCGAKKCRKFLN ; ;SMDLPMPMRFRALAAASAAAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDS EVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYAFPIEDASNKLPCNCGAKKCRKFLN ; A ? 2 'polypeptide(L)' no yes 'LQTARV(MLZ)RC' LQTARVKRC C ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 S-ADENOSYL-L-HOMOCYSTEINE SAH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ASP n 1 4 LEU n 1 5 PRO n 1 6 MET n 1 7 PRO n 1 8 MET n 1 9 ARG n 1 10 PHE n 1 11 ARG n 1 12 ALA n 1 13 LEU n 1 14 ALA n 1 15 ALA n 1 16 ALA n 1 17 SER n 1 18 ALA n 1 19 ALA n 1 20 ALA n 1 21 VAL n 1 22 GLY n 1 23 VAL n 1 24 TYR n 1 25 ARG n 1 26 SER n 1 27 PRO n 1 28 ILE n 1 29 HIS n 1 30 GLY n 1 31 ARG n 1 32 GLY n 1 33 LEU n 1 34 PHE n 1 35 CYS n 1 36 LYS n 1 37 ARG n 1 38 ASN n 1 39 ILE n 1 40 ASP n 1 41 ALA n 1 42 GLY n 1 43 GLU n 1 44 MET n 1 45 VAL n 1 46 ILE n 1 47 GLU n 1 48 TYR n 1 49 ALA n 1 50 GLY n 1 51 ASN n 1 52 VAL n 1 53 ILE n 1 54 ARG n 1 55 SER n 1 56 ILE n 1 57 GLN n 1 58 THR n 1 59 ASP n 1 60 LYS n 1 61 ARG n 1 62 GLU n 1 63 LYS n 1 64 TYR n 1 65 TYR n 1 66 ASP n 1 67 SER n 1 68 LYS n 1 69 GLY n 1 70 ILE n 1 71 GLY n 1 72 CYS n 1 73 TYR n 1 74 MET n 1 75 PHE n 1 76 ARG n 1 77 ILE n 1 78 ASP n 1 79 ASP n 1 80 SER n 1 81 GLU n 1 82 VAL n 1 83 VAL n 1 84 ASP n 1 85 ALA n 1 86 THR n 1 87 MET n 1 88 HIS n 1 89 GLY n 1 90 ASN n 1 91 ALA n 1 92 ALA n 1 93 ARG n 1 94 PHE n 1 95 ILE n 1 96 ASN n 1 97 HIS n 1 98 SER n 1 99 CYS n 1 100 GLU n 1 101 PRO n 1 102 ASN n 1 103 CYS n 1 104 TYR n 1 105 SER n 1 106 ARG n 1 107 VAL n 1 108 ILE n 1 109 ASN n 1 110 ILE n 1 111 ASP n 1 112 GLY n 1 113 GLN n 1 114 LYS n 1 115 HIS n 1 116 ILE n 1 117 VAL n 1 118 ILE n 1 119 PHE n 1 120 ALA n 1 121 MET n 1 122 ARG n 1 123 LYS n 1 124 ILE n 1 125 TYR n 1 126 ARG n 1 127 GLY n 1 128 GLU n 1 129 GLU n 1 130 LEU n 1 131 THR n 1 132 TYR n 1 133 ASP n 1 134 TYR n 1 135 ALA n 1 136 PHE n 1 137 PRO n 1 138 ILE n 1 139 GLU n 1 140 ASP n 1 141 ALA n 1 142 SER n 1 143 ASN n 1 144 LYS n 1 145 LEU n 1 146 PRO n 1 147 CYS n 1 148 ASN n 1 149 CYS n 1 150 GLY n 1 151 ALA n 1 152 LYS n 1 153 LYS n 1 154 CYS n 1 155 ARG n 1 156 LYS n 1 157 PHE n 1 158 LEU n 1 159 ASN n 2 1 LEU n 2 2 GLN n 2 3 THR n 2 4 ALA n 2 5 ARG n 2 6 VAL n 2 7 MLZ n 2 8 ARG n 2 9 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 159 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KMT2A, ALL1, CXXC7, HRX, HTRX, MLL, MLL1, TRX1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 9 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLZ 'L-peptide linking' n N-METHYL-LYSINE ? 'C7 H16 N2 O2' 160.214 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 3811 ? ? ? A . n A 1 2 MET 2 3812 ? ? ? A . n A 1 3 ASP 3 3813 ? ? ? A . n A 1 4 LEU 4 3814 ? ? ? A . n A 1 5 PRO 5 3815 ? ? ? A . n A 1 6 MET 6 3816 ? ? ? A . n A 1 7 PRO 7 3817 ? ? ? A . n A 1 8 MET 8 3818 ? ? ? A . n A 1 9 ARG 9 3819 ? ? ? A . n A 1 10 PHE 10 3820 ? ? ? A . n A 1 11 ARG 11 3821 ? ? ? A . n A 1 12 ALA 12 3822 3822 ALA ALA A . n A 1 13 LEU 13 3823 3823 LEU LEU A . n A 1 14 ALA 14 3824 3824 ALA ALA A . n A 1 15 ALA 15 3825 3825 ALA ALA A . n A 1 16 ALA 16 3826 3826 ALA ALA A . n A 1 17 SER 17 3827 3827 SER SER A . n A 1 18 ALA 18 3828 3828 ALA ALA A . n A 1 19 ALA 19 3829 3829 ALA ALA A . n A 1 20 ALA 20 3830 3830 ALA ALA A . n A 1 21 VAL 21 3831 3831 VAL VAL A . n A 1 22 GLY 22 3832 3832 GLY GLY A . n A 1 23 VAL 23 3833 3833 VAL VAL A . n A 1 24 TYR 24 3834 3834 TYR TYR A . n A 1 25 ARG 25 3835 3835 ARG ARG A . n A 1 26 SER 26 3836 3836 SER SER A . n A 1 27 PRO 27 3837 3837 PRO PRO A . n A 1 28 ILE 28 3838 3838 ILE ILE A . n A 1 29 HIS 29 3839 3839 HIS HIS A . n A 1 30 GLY 30 3840 3840 GLY GLY A . n A 1 31 ARG 31 3841 3841 ARG ARG A . n A 1 32 GLY 32 3842 3842 GLY GLY A . n A 1 33 LEU 33 3843 3843 LEU LEU A . n A 1 34 PHE 34 3844 3844 PHE PHE A . n A 1 35 CYS 35 3845 3845 CYS CYS A . n A 1 36 LYS 36 3846 3846 LYS LYS A . n A 1 37 ARG 37 3847 3847 ARG ARG A . n A 1 38 ASN 38 3848 3848 ASN ASN A . n A 1 39 ILE 39 3849 3849 ILE ILE A . n A 1 40 ASP 40 3850 3850 ASP ASP A . n A 1 41 ALA 41 3851 3851 ALA ALA A . n A 1 42 GLY 42 3852 3852 GLY GLY A . n A 1 43 GLU 43 3853 3853 GLU GLU A . n A 1 44 MET 44 3854 3854 MET MET A . n A 1 45 VAL 45 3855 3855 VAL VAL A . n A 1 46 ILE 46 3856 3856 ILE ILE A . n A 1 47 GLU 47 3857 3857 GLU GLU A . n A 1 48 TYR 48 3858 3858 TYR TYR A . n A 1 49 ALA 49 3859 3859 ALA ALA A . n A 1 50 GLY 50 3860 3860 GLY GLY A . n A 1 51 ASN 51 3861 3861 ASN ASN A . n A 1 52 VAL 52 3862 3862 VAL VAL A . n A 1 53 ILE 53 3863 3863 ILE ILE A . n A 1 54 ARG 54 3864 3864 ARG ARG A . n A 1 55 SER 55 3865 3865 SER SER A . n A 1 56 ILE 56 3866 3866 ILE ILE A . n A 1 57 GLN 57 3867 3867 GLN GLN A . n A 1 58 THR 58 3868 3868 THR THR A . n A 1 59 ASP 59 3869 3869 ASP ASP A . n A 1 60 LYS 60 3870 3870 LYS LYS A . n A 1 61 ARG 61 3871 3871 ARG ARG A . n A 1 62 GLU 62 3872 3872 GLU GLU A . n A 1 63 LYS 63 3873 3873 LYS LYS A . n A 1 64 TYR 64 3874 3874 TYR TYR A . n A 1 65 TYR 65 3875 3875 TYR TYR A . n A 1 66 ASP 66 3876 3876 ASP ASP A . n A 1 67 SER 67 3877 3877 SER SER A . n A 1 68 LYS 68 3878 3878 LYS LYS A . n A 1 69 GLY 69 3879 3879 GLY GLY A . n A 1 70 ILE 70 3880 3880 ILE ILE A . n A 1 71 GLY 71 3881 3881 GLY GLY A . n A 1 72 CYS 72 3882 3882 CYS CYS A . n A 1 73 TYR 73 3883 3883 TYR TYR A . n A 1 74 MET 74 3884 3884 MET MET A . n A 1 75 PHE 75 3885 3885 PHE PHE A . n A 1 76 ARG 76 3886 3886 ARG ARG A . n A 1 77 ILE 77 3887 3887 ILE ILE A . n A 1 78 ASP 78 3888 3888 ASP ASP A . n A 1 79 ASP 79 3889 3889 ASP ASP A . n A 1 80 SER 80 3890 3890 SER SER A . n A 1 81 GLU 81 3891 3891 GLU GLU A . n A 1 82 VAL 82 3892 3892 VAL VAL A . n A 1 83 VAL 83 3893 3893 VAL VAL A . n A 1 84 ASP 84 3894 3894 ASP ASP A . n A 1 85 ALA 85 3895 3895 ALA ALA A . n A 1 86 THR 86 3896 3896 THR THR A . n A 1 87 MET 87 3897 3897 MET MET A . n A 1 88 HIS 88 3898 3898 HIS HIS A . n A 1 89 GLY 89 3899 3899 GLY GLY A . n A 1 90 ASN 90 3900 3900 ASN ASN A . n A 1 91 ALA 91 3901 3901 ALA ALA A . n A 1 92 ALA 92 3902 3902 ALA ALA A . n A 1 93 ARG 93 3903 3903 ARG ARG A . n A 1 94 PHE 94 3904 3904 PHE PHE A . n A 1 95 ILE 95 3905 3905 ILE ILE A . n A 1 96 ASN 96 3906 3906 ASN ASN A . n A 1 97 HIS 97 3907 3907 HIS HIS A . n A 1 98 SER 98 3908 3908 SER SER A . n A 1 99 CYS 99 3909 3909 CYS CYS A . n A 1 100 GLU 100 3910 3910 GLU GLU A . n A 1 101 PRO 101 3911 3911 PRO PRO A . n A 1 102 ASN 102 3912 3912 ASN ASN A . n A 1 103 CYS 103 3913 3913 CYS CYS A . n A 1 104 TYR 104 3914 3914 TYR TYR A . n A 1 105 SER 105 3915 3915 SER SER A . n A 1 106 ARG 106 3916 3916 ARG ARG A . n A 1 107 VAL 107 3917 3917 VAL VAL A . n A 1 108 ILE 108 3918 3918 ILE ILE A . n A 1 109 ASN 109 3919 3919 ASN ASN A . n A 1 110 ILE 110 3920 3920 ILE ILE A . n A 1 111 ASP 111 3921 3921 ASP ASP A . n A 1 112 GLY 112 3922 3922 GLY GLY A . n A 1 113 GLN 113 3923 3923 GLN GLN A . n A 1 114 LYS 114 3924 3924 LYS LYS A . n A 1 115 HIS 115 3925 3925 HIS HIS A . n A 1 116 ILE 116 3926 3926 ILE ILE A . n A 1 117 VAL 117 3927 3927 VAL VAL A . n A 1 118 ILE 118 3928 3928 ILE ILE A . n A 1 119 PHE 119 3929 3929 PHE PHE A . n A 1 120 ALA 120 3930 3930 ALA ALA A . n A 1 121 MET 121 3931 3931 MET MET A . n A 1 122 ARG 122 3932 3932 ARG ARG A . n A 1 123 LYS 123 3933 3933 LYS LYS A . n A 1 124 ILE 124 3934 3934 ILE ILE A . n A 1 125 TYR 125 3935 3935 TYR TYR A . n A 1 126 ARG 126 3936 3936 ARG ARG A . n A 1 127 GLY 127 3937 3937 GLY GLY A . n A 1 128 GLU 128 3938 3938 GLU GLU A . n A 1 129 GLU 129 3939 3939 GLU GLU A . n A 1 130 LEU 130 3940 3940 LEU LEU A . n A 1 131 THR 131 3941 3941 THR THR A . n A 1 132 TYR 132 3942 3942 TYR TYR A . n A 1 133 ASP 133 3943 3943 ASP ASP A . n A 1 134 TYR 134 3944 3944 TYR TYR A . n A 1 135 ALA 135 3945 3945 ALA ALA A . n A 1 136 PHE 136 3946 ? ? ? A . n A 1 137 PRO 137 3947 ? ? ? A . n A 1 138 ILE 138 3948 ? ? ? A . n A 1 139 GLU 139 3949 ? ? ? A . n A 1 140 ASP 140 3950 ? ? ? A . n A 1 141 ALA 141 3951 ? ? ? A . n A 1 142 SER 142 3952 ? ? ? A . n A 1 143 ASN 143 3953 ? ? ? A . n A 1 144 LYS 144 3954 ? ? ? A . n A 1 145 LEU 145 3955 ? ? ? A . n A 1 146 PRO 146 3956 ? ? ? A . n A 1 147 CYS 147 3957 ? ? ? A . n A 1 148 ASN 148 3958 ? ? ? A . n A 1 149 CYS 149 3959 ? ? ? A . n A 1 150 GLY 150 3960 ? ? ? A . n A 1 151 ALA 151 3961 ? ? ? A . n A 1 152 LYS 152 3962 ? ? ? A . n A 1 153 LYS 153 3963 ? ? ? A . n A 1 154 CYS 154 3964 ? ? ? A . n A 1 155 ARG 155 3965 ? ? ? A . n A 1 156 LYS 156 3966 ? ? ? A . n A 1 157 PHE 157 3967 ? ? ? A . n A 1 158 LEU 158 3968 ? ? ? A . n A 1 159 ASN 159 3969 ? ? ? A . n B 2 1 LEU 1 3951 ? ? ? C . n B 2 2 GLN 2 3952 ? ? ? C . n B 2 3 THR 3 3953 ? ? ? C . n B 2 4 ALA 4 3954 ? ? ? C . n B 2 5 ARG 5 3955 ? ? ? C . n B 2 6 VAL 6 3956 3956 VAL VAL C . n B 2 7 MLZ 7 3957 3957 MLZ MLZ C . n B 2 8 ARG 8 3958 3958 ARG ARG C . n B 2 9 CYS 9 3959 3959 CYS CYS C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 4001 4001 ZN ZN A . D 4 SAH 1 4002 4003 SAH SAH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 3889 ? CG ? A ASP 79 CG 2 1 Y 1 A ASP 3889 ? OD1 ? A ASP 79 OD1 3 1 Y 1 A ASP 3889 ? OD2 ? A ASP 79 OD2 4 1 Y 1 A GLU 3910 ? CG ? A GLU 100 CG 5 1 Y 1 A GLU 3910 ? CD ? A GLU 100 CD 6 1 Y 1 A GLU 3910 ? OE1 ? A GLU 100 OE1 7 1 Y 1 A GLU 3910 ? OE2 ? A GLU 100 OE2 8 1 Y 1 A ASP 3921 ? CG ? A ASP 111 CG 9 1 Y 1 A ASP 3921 ? OD1 ? A ASP 111 OD1 10 1 Y 1 A ASP 3921 ? OD2 ? A ASP 111 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20_4459 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7U5V _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.480 _cell.length_a_esd ? _cell.length_b 54.480 _cell.length_b_esd ? _cell.length_c 105.630 _cell.length_c_esd ? _cell.volume 271513.926 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7U5V _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7U5V _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '60% Tacsimate pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 105 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-02-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.12705 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.12705 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 61.92 _reflns.entry_id 7U5V _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.59 _reflns.d_resolution_low 47.18 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5905 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.96 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_Rmerge_I_obs 0.103 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.046 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.114 _reflns.pdbx_Rpim_I_all 0.046 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.59 _reflns_shell.d_res_low 2.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 236 _reflns_shell.percent_possible_all 79.46 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.169 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.789 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.789 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.302 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 60.91 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7U5V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.59 _refine.ls_d_res_low 43.08 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5878 _refine.ls_number_reflns_R_free 297 _refine.ls_number_reflns_R_work 5581 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.53 _refine.ls_percent_reflns_R_free 5.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.3036 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2477 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.6144 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1688 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.59 _refine_hist.d_res_low 43.08 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1027 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1000 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0095 ? 1045 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1497 ? 1405 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0641 ? 151 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0119 ? 178 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.8860 ? 164 ? f_dihedral_angle_d ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.59 _refine_ls_shell.d_res_low 2.68 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 139 _refine_ls_shell.number_reflns_R_work 453 _refine_ls_shell.percent_reflns_obs 83 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4790 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.4439 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7U5V _struct.title ;Crystal structure of the Mixed Lineage Leukaemia (MLL1) SET Domain with the cofactor product S-Adenosylhomocysteine and Borealin peptide ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7U5V _struct_keywords.text 'MLL1-SET, Borealin, Histone methyltransferase, Non-histone substrate, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KMT2A_HUMAN Q03164 ? 1 ;SMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDS EVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN ; 3811 2 UNP BOREA_HUMAN Q53HL2 ? 2 LQTARVKRC 137 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7U5V A 1 ? 159 ? Q03164 3811 ? 3969 ? 3811 3969 2 2 7U5V C 1 ? 9 ? Q53HL2 137 ? 145 ? 3951 3959 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7U5V ALA A 12 ? UNP Q03164 HIS 3822 conflict 3822 1 1 7U5V ALA A 14 ? UNP Q03164 LYS 3824 conflict 3824 2 1 7U5V ALA A 15 ? UNP Q03164 LYS 3825 conflict 3825 3 1 7U5V ALA A 16 ? UNP Q03164 THR 3826 conflict 3826 4 1 7U5V ALA A 18 ? UNP Q03164 LYS 3828 conflict 3828 5 1 7U5V ALA A 19 ? UNP Q03164 GLU 3829 conflict 3829 6 1 7U5V ALA A 135 ? UNP Q03164 LYS 3945 conflict 3945 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1030 ? 1 MORE -28 ? 1 'SSA (A^2)' 7170 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 13 ? ALA A 20 ? LEU A 3823 ALA A 3830 1 ? 8 HELX_P HELX_P2 AA2 GLN A 57 ? LYS A 68 ? GLN A 3867 LYS A 3878 1 ? 12 HELX_P HELX_P3 AA3 ASN A 90 ? ILE A 95 ? ASN A 3900 ILE A 3905 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B VAL 6 C ? ? ? 1_555 B MLZ 7 N ? ? C VAL 3956 C MLZ 3957 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale2 covale both ? B MLZ 7 C ? ? ? 1_555 B ARG 8 N ? ? C MLZ 3957 C ARG 3958 1_555 ? ? ? ? ? ? ? 1.339 ? ? metalc1 metalc ? ? A CYS 99 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 3909 A ZN 4001 1_555 ? ? ? ? ? ? ? 2.341 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 21 ? ARG A 25 ? VAL A 3831 ARG A 3835 AA1 2 ARG A 31 ? CYS A 35 ? ARG A 3841 CYS A 3845 AA1 3 GLU A 129 ? TYR A 132 ? GLU A 3939 TYR A 3942 AA1 4 ASN A 96 ? HIS A 97 ? ASN A 3906 HIS A 3907 AA2 1 MET A 44 ? GLU A 47 ? MET A 3854 GLU A 3857 AA2 2 GLN A 113 ? ALA A 120 ? GLN A 3923 ALA A 3930 AA2 3 CYS A 103 ? ILE A 110 ? CYS A 3913 ILE A 3920 AA3 1 ASN A 51 ? ARG A 54 ? ASN A 3861 ARG A 3864 AA3 2 GLU A 81 ? ASP A 84 ? GLU A 3891 ASP A 3894 AA3 3 MET A 74 ? ARG A 76 ? MET A 3884 ARG A 3886 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 22 ? N GLY A 3832 O PHE A 34 ? O PHE A 3844 AA1 2 3 N LEU A 33 ? N LEU A 3843 O LEU A 130 ? O LEU A 3940 AA1 3 4 O TYR A 132 ? O TYR A 3942 N ASN A 96 ? N ASN A 3906 AA2 1 2 N ILE A 46 ? N ILE A 3856 O ILE A 118 ? O ILE A 3928 AA2 2 3 O HIS A 115 ? O HIS A 3925 N ILE A 108 ? N ILE A 3918 AA3 1 2 N ASN A 51 ? N ASN A 3861 O ASP A 84 ? O ASP A 3894 AA3 2 3 O VAL A 83 ? O VAL A 3893 N PHE A 75 ? N PHE A 3885 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 3888 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NZ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 3933 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_565 _pdbx_validate_symm_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3888 ? ? -161.87 -161.21 2 1 SER A 3890 ? ? -149.85 -9.82 3 1 ASP A 3921 ? ? 57.00 17.11 4 1 ARG A 3936 ? ? -28.41 123.26 5 1 ARG C 3958 ? ? 77.02 49.10 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id MLZ _pdbx_struct_mod_residue.label_seq_id 7 _pdbx_struct_mod_residue.auth_asym_id C _pdbx_struct_mod_residue.auth_comp_id MLZ _pdbx_struct_mod_residue.auth_seq_id 3957 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -24.6494372563 _pdbx_refine_tls.origin_y 20.1590568478 _pdbx_refine_tls.origin_z 7.21096046363 _pdbx_refine_tls.T[1][1] 0.300492514873 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0371559909795 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.00626106392673 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.414145635488 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.063026123167 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.39416146211 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 7.72542453931 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.509607534901 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 2.72878907191 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.85137810996 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.89118991675 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 4.88224288024 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.35207304696 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.81243000695 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.585836959307 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0554541856097 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.192340079679 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.000773090479248 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.327925537825 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.440329030408 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.153653528524 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 3822 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id D _pdbx_refine_tls_group.end_label_seq_id 4 _pdbx_refine_tls_group.end_auth_asym_id C _pdbx_refine_tls_group.end_auth_seq_id 3959 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # _pdbx_entry_details.entry_id 7U5V _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 3811 ? A SER 1 2 1 Y 1 A MET 3812 ? A MET 2 3 1 Y 1 A ASP 3813 ? A ASP 3 4 1 Y 1 A LEU 3814 ? A LEU 4 5 1 Y 1 A PRO 3815 ? A PRO 5 6 1 Y 1 A MET 3816 ? A MET 6 7 1 Y 1 A PRO 3817 ? A PRO 7 8 1 Y 1 A MET 3818 ? A MET 8 9 1 Y 1 A ARG 3819 ? A ARG 9 10 1 Y 1 A PHE 3820 ? A PHE 10 11 1 Y 1 A ARG 3821 ? A ARG 11 12 1 Y 1 A PHE 3946 ? A PHE 136 13 1 Y 1 A PRO 3947 ? A PRO 137 14 1 Y 1 A ILE 3948 ? A ILE 138 15 1 Y 1 A GLU 3949 ? A GLU 139 16 1 Y 1 A ASP 3950 ? A ASP 140 17 1 Y 1 A ALA 3951 ? A ALA 141 18 1 Y 1 A SER 3952 ? A SER 142 19 1 Y 1 A ASN 3953 ? A ASN 143 20 1 Y 1 A LYS 3954 ? A LYS 144 21 1 Y 1 A LEU 3955 ? A LEU 145 22 1 Y 1 A PRO 3956 ? A PRO 146 23 1 Y 1 A CYS 3957 ? A CYS 147 24 1 Y 1 A ASN 3958 ? A ASN 148 25 1 Y 1 A CYS 3959 ? A CYS 149 26 1 Y 1 A GLY 3960 ? A GLY 150 27 1 Y 1 A ALA 3961 ? A ALA 151 28 1 Y 1 A LYS 3962 ? A LYS 152 29 1 Y 1 A LYS 3963 ? A LYS 153 30 1 Y 1 A CYS 3964 ? A CYS 154 31 1 Y 1 A ARG 3965 ? A ARG 155 32 1 Y 1 A LYS 3966 ? A LYS 156 33 1 Y 1 A PHE 3967 ? A PHE 157 34 1 Y 1 A LEU 3968 ? A LEU 158 35 1 Y 1 A ASN 3969 ? A ASN 159 36 1 Y 1 C LEU 3951 ? B LEU 1 37 1 Y 1 C GLN 3952 ? B GLN 2 38 1 Y 1 C THR 3953 ? B THR 3 39 1 Y 1 C ALA 3954 ? B ALA 4 40 1 Y 1 C ARG 3955 ? B ARG 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MLZ N N N N 247 MLZ CA C N S 248 MLZ CB C N N 249 MLZ CG C N N 250 MLZ CD C N N 251 MLZ CE C N N 252 MLZ NZ N N N 253 MLZ CM C N N 254 MLZ C C N N 255 MLZ O O N N 256 MLZ OXT O N N 257 MLZ H H N N 258 MLZ H2 H N N 259 MLZ HA H N N 260 MLZ HB2 H N N 261 MLZ HB3 H N N 262 MLZ HG2 H N N 263 MLZ HG3 H N N 264 MLZ HD2 H N N 265 MLZ HD3 H N N 266 MLZ HE2 H N N 267 MLZ HE3 H N N 268 MLZ HZ H N N 269 MLZ HCM1 H N N 270 MLZ HCM2 H N N 271 MLZ HCM3 H N N 272 MLZ HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SAH N N N N 314 SAH CA C N S 315 SAH CB C N N 316 SAH CG C N N 317 SAH SD S N N 318 SAH C C N N 319 SAH O O N N 320 SAH OXT O N N 321 SAH "C5'" C N N 322 SAH "C4'" C N S 323 SAH "O4'" O N N 324 SAH "C3'" C N S 325 SAH "O3'" O N N 326 SAH "C2'" C N R 327 SAH "O2'" O N N 328 SAH "C1'" C N R 329 SAH N9 N Y N 330 SAH C8 C Y N 331 SAH N7 N Y N 332 SAH C5 C Y N 333 SAH C6 C Y N 334 SAH N6 N N N 335 SAH N1 N Y N 336 SAH C2 C Y N 337 SAH N3 N Y N 338 SAH C4 C Y N 339 SAH HN1 H N N 340 SAH HN2 H N N 341 SAH HA H N N 342 SAH HB1 H N N 343 SAH HB2 H N N 344 SAH HG1 H N N 345 SAH HG2 H N N 346 SAH HXT H N N 347 SAH "H5'1" H N N 348 SAH "H5'2" H N N 349 SAH "H4'" H N N 350 SAH "H3'" H N N 351 SAH "HO3'" H N N 352 SAH "H2'" H N N 353 SAH "HO2'" H N N 354 SAH "H1'" H N N 355 SAH H8 H N N 356 SAH HN61 H N N 357 SAH HN62 H N N 358 SAH H2 H N N 359 SER N N N N 360 SER CA C N S 361 SER C C N N 362 SER O O N N 363 SER CB C N N 364 SER OG O N N 365 SER OXT O N N 366 SER H H N N 367 SER H2 H N N 368 SER HA H N N 369 SER HB2 H N N 370 SER HB3 H N N 371 SER HG H N N 372 SER HXT H N N 373 THR N N N N 374 THR CA C N S 375 THR C C N N 376 THR O O N N 377 THR CB C N R 378 THR OG1 O N N 379 THR CG2 C N N 380 THR OXT O N N 381 THR H H N N 382 THR H2 H N N 383 THR HA H N N 384 THR HB H N N 385 THR HG1 H N N 386 THR HG21 H N N 387 THR HG22 H N N 388 THR HG23 H N N 389 THR HXT H N N 390 TYR N N N N 391 TYR CA C N S 392 TYR C C N N 393 TYR O O N N 394 TYR CB C N N 395 TYR CG C Y N 396 TYR CD1 C Y N 397 TYR CD2 C Y N 398 TYR CE1 C Y N 399 TYR CE2 C Y N 400 TYR CZ C Y N 401 TYR OH O N N 402 TYR OXT O N N 403 TYR H H N N 404 TYR H2 H N N 405 TYR HA H N N 406 TYR HB2 H N N 407 TYR HB3 H N N 408 TYR HD1 H N N 409 TYR HD2 H N N 410 TYR HE1 H N N 411 TYR HE2 H N N 412 TYR HH H N N 413 TYR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 ZN ZN ZN N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 MLZ N CA sing N N 235 MLZ N H sing N N 236 MLZ N H2 sing N N 237 MLZ CA CB sing N N 238 MLZ CA C sing N N 239 MLZ CA HA sing N N 240 MLZ CB CG sing N N 241 MLZ CB HB2 sing N N 242 MLZ CB HB3 sing N N 243 MLZ CG CD sing N N 244 MLZ CG HG2 sing N N 245 MLZ CG HG3 sing N N 246 MLZ CD CE sing N N 247 MLZ CD HD2 sing N N 248 MLZ CD HD3 sing N N 249 MLZ CE NZ sing N N 250 MLZ CE HE2 sing N N 251 MLZ CE HE3 sing N N 252 MLZ NZ CM sing N N 253 MLZ NZ HZ sing N N 254 MLZ CM HCM1 sing N N 255 MLZ CM HCM2 sing N N 256 MLZ CM HCM3 sing N N 257 MLZ C O doub N N 258 MLZ C OXT sing N N 259 MLZ OXT HXT sing N N 260 PHE N CA sing N N 261 PHE N H sing N N 262 PHE N H2 sing N N 263 PHE CA C sing N N 264 PHE CA CB sing N N 265 PHE CA HA sing N N 266 PHE C O doub N N 267 PHE C OXT sing N N 268 PHE CB CG sing N N 269 PHE CB HB2 sing N N 270 PHE CB HB3 sing N N 271 PHE CG CD1 doub Y N 272 PHE CG CD2 sing Y N 273 PHE CD1 CE1 sing Y N 274 PHE CD1 HD1 sing N N 275 PHE CD2 CE2 doub Y N 276 PHE CD2 HD2 sing N N 277 PHE CE1 CZ doub Y N 278 PHE CE1 HE1 sing N N 279 PHE CE2 CZ sing Y N 280 PHE CE2 HE2 sing N N 281 PHE CZ HZ sing N N 282 PHE OXT HXT sing N N 283 PRO N CA sing N N 284 PRO N CD sing N N 285 PRO N H sing N N 286 PRO CA C sing N N 287 PRO CA CB sing N N 288 PRO CA HA sing N N 289 PRO C O doub N N 290 PRO C OXT sing N N 291 PRO CB CG sing N N 292 PRO CB HB2 sing N N 293 PRO CB HB3 sing N N 294 PRO CG CD sing N N 295 PRO CG HG2 sing N N 296 PRO CG HG3 sing N N 297 PRO CD HD2 sing N N 298 PRO CD HD3 sing N N 299 PRO OXT HXT sing N N 300 SAH N CA sing N N 301 SAH N HN1 sing N N 302 SAH N HN2 sing N N 303 SAH CA CB sing N N 304 SAH CA C sing N N 305 SAH CA HA sing N N 306 SAH CB CG sing N N 307 SAH CB HB1 sing N N 308 SAH CB HB2 sing N N 309 SAH CG SD sing N N 310 SAH CG HG1 sing N N 311 SAH CG HG2 sing N N 312 SAH SD "C5'" sing N N 313 SAH C O doub N N 314 SAH C OXT sing N N 315 SAH OXT HXT sing N N 316 SAH "C5'" "C4'" sing N N 317 SAH "C5'" "H5'1" sing N N 318 SAH "C5'" "H5'2" sing N N 319 SAH "C4'" "O4'" sing N N 320 SAH "C4'" "C3'" sing N N 321 SAH "C4'" "H4'" sing N N 322 SAH "O4'" "C1'" sing N N 323 SAH "C3'" "O3'" sing N N 324 SAH "C3'" "C2'" sing N N 325 SAH "C3'" "H3'" sing N N 326 SAH "O3'" "HO3'" sing N N 327 SAH "C2'" "O2'" sing N N 328 SAH "C2'" "C1'" sing N N 329 SAH "C2'" "H2'" sing N N 330 SAH "O2'" "HO2'" sing N N 331 SAH "C1'" N9 sing N N 332 SAH "C1'" "H1'" sing N N 333 SAH N9 C8 sing Y N 334 SAH N9 C4 sing Y N 335 SAH C8 N7 doub Y N 336 SAH C8 H8 sing N N 337 SAH N7 C5 sing Y N 338 SAH C5 C6 sing Y N 339 SAH C5 C4 doub Y N 340 SAH C6 N6 sing N N 341 SAH C6 N1 doub Y N 342 SAH N6 HN61 sing N N 343 SAH N6 HN62 sing N N 344 SAH N1 C2 sing Y N 345 SAH C2 N3 doub Y N 346 SAH C2 H2 sing N N 347 SAH N3 C4 sing Y N 348 SER N CA sing N N 349 SER N H sing N N 350 SER N H2 sing N N 351 SER CA C sing N N 352 SER CA CB sing N N 353 SER CA HA sing N N 354 SER C O doub N N 355 SER C OXT sing N N 356 SER CB OG sing N N 357 SER CB HB2 sing N N 358 SER CB HB3 sing N N 359 SER OG HG sing N N 360 SER OXT HXT sing N N 361 THR N CA sing N N 362 THR N H sing N N 363 THR N H2 sing N N 364 THR CA C sing N N 365 THR CA CB sing N N 366 THR CA HA sing N N 367 THR C O doub N N 368 THR C OXT sing N N 369 THR CB OG1 sing N N 370 THR CB CG2 sing N N 371 THR CB HB sing N N 372 THR OG1 HG1 sing N N 373 THR CG2 HG21 sing N N 374 THR CG2 HG22 sing N N 375 THR CG2 HG23 sing N N 376 THR OXT HXT sing N N 377 TYR N CA sing N N 378 TYR N H sing N N 379 TYR N H2 sing N N 380 TYR CA C sing N N 381 TYR CA CB sing N N 382 TYR CA HA sing N N 383 TYR C O doub N N 384 TYR C OXT sing N N 385 TYR CB CG sing N N 386 TYR CB HB2 sing N N 387 TYR CB HB3 sing N N 388 TYR CG CD1 doub Y N 389 TYR CG CD2 sing Y N 390 TYR CD1 CE1 sing Y N 391 TYR CD1 HD1 sing N N 392 TYR CD2 CE2 doub Y N 393 TYR CD2 HD2 sing N N 394 TYR CE1 CZ doub Y N 395 TYR CE1 HE1 sing N N 396 TYR CE2 CZ sing Y N 397 TYR CE2 HE2 sing N N 398 TYR CZ OH sing N N 399 TYR OH HH sing N N 400 TYR OXT HXT sing N N 401 VAL N CA sing N N 402 VAL N H sing N N 403 VAL N H2 sing N N 404 VAL CA C sing N N 405 VAL CA CB sing N N 406 VAL CA HA sing N N 407 VAL C O doub N N 408 VAL C OXT sing N N 409 VAL CB CG1 sing N N 410 VAL CB CG2 sing N N 411 VAL CB HB sing N N 412 VAL CG1 HG11 sing N N 413 VAL CG1 HG12 sing N N 414 VAL CG1 HG13 sing N N 415 VAL CG2 HG21 sing N N 416 VAL CG2 HG22 sing N N 417 VAL CG2 HG23 sing N N 418 VAL OXT HXT sing N N 419 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number '1 R01 CA 250329-01' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MLZ ? ? MLZ ? ? 'SUBJECT OF INVESTIGATION' ? 2 SAH ? ? SAH ? ? 'SUBJECT OF INVESTIGATION' ? 3 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 7U5V _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018355 _atom_sites.fract_transf_matrix[1][2] 0.010597 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021195 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009467 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_