data_7U9A # _entry.id 7U9A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7U9A pdb_00007u9a 10.2210/pdb7u9a/pdb WWPDB D_1000263770 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7U9A _pdbx_database_status.recvd_initial_deposition_date 2022-03-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Beyett, T.S.' 1 ? 'Eck, M.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 15679 _citation.page_last 15697 _citation.title 'Macrocyclization of Quinazoline-Based EGFR Inhibitors Leads to Exclusive Mutant Selectivity for EGFR L858R and Del19.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01041 _citation.pdbx_database_id_PubMed 36384036 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Amrhein, J.A.' 1 ? primary 'Beyett, T.S.' 2 ? primary 'Feng, W.W.' 3 ? primary 'Kramer, A.' 4 ? primary 'Weckesser, J.' 5 ? primary 'Schaeffner, I.K.' 6 ? primary 'Rana, J.K.' 7 ? primary 'Janne, P.A.' 8 ? primary 'Eck, M.J.' 9 ? primary 'Knapp, S.' 10 ? primary 'Hanke, T.' 11 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7U9A _cell.details ? _cell.formula_units_Z ? _cell.length_a 145.825 _cell.length_a_esd ? _cell.length_b 145.825 _cell.length_b_esd ? _cell.length_c 145.825 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7U9A _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37636.441 1 2.7.10.1 ? 'kinase domain, residues 695-1022' ? 2 non-polymer syn '4-(5-chloro-4-fluoro-2-hydroxyanilino)-7-methoxyquinazolin-6-ol' 335.718 1 ? ? ? ? 3 non-polymer syn 'CITRATE ANION' 189.100 1 ? ? ? ? 4 water nat water 18.015 24 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSTSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDN PHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHV KITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGE RLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVV DADEYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSTSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDN PHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHV KITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGE RLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVV DADEYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 SER n 1 5 GLY n 1 6 GLU n 1 7 ALA n 1 8 PRO n 1 9 ASN n 1 10 GLN n 1 11 ALA n 1 12 LEU n 1 13 LEU n 1 14 ARG n 1 15 ILE n 1 16 LEU n 1 17 LYS n 1 18 GLU n 1 19 THR n 1 20 GLU n 1 21 PHE n 1 22 LYS n 1 23 LYS n 1 24 ILE n 1 25 LYS n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 SER n 1 30 GLY n 1 31 ALA n 1 32 PHE n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 TYR n 1 37 LYS n 1 38 GLY n 1 39 LEU n 1 40 TRP n 1 41 ILE n 1 42 PRO n 1 43 GLU n 1 44 GLY n 1 45 GLU n 1 46 LYS n 1 47 VAL n 1 48 LYS n 1 49 ILE n 1 50 PRO n 1 51 VAL n 1 52 ALA n 1 53 ILE n 1 54 LYS n 1 55 GLU n 1 56 LEU n 1 57 ARG n 1 58 GLU n 1 59 ALA n 1 60 THR n 1 61 SER n 1 62 PRO n 1 63 LYS n 1 64 ALA n 1 65 ASN n 1 66 LYS n 1 67 GLU n 1 68 ILE n 1 69 LEU n 1 70 ASP n 1 71 GLU n 1 72 ALA n 1 73 TYR n 1 74 VAL n 1 75 MET n 1 76 ALA n 1 77 SER n 1 78 VAL n 1 79 ASP n 1 80 ASN n 1 81 PRO n 1 82 HIS n 1 83 VAL n 1 84 CYS n 1 85 ARG n 1 86 LEU n 1 87 LEU n 1 88 GLY n 1 89 ILE n 1 90 CYS n 1 91 LEU n 1 92 THR n 1 93 SER n 1 94 THR n 1 95 VAL n 1 96 GLN n 1 97 LEU n 1 98 ILE n 1 99 THR n 1 100 GLN n 1 101 LEU n 1 102 MET n 1 103 PRO n 1 104 PHE n 1 105 GLY n 1 106 CYS n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 TYR n 1 111 VAL n 1 112 ARG n 1 113 GLU n 1 114 HIS n 1 115 LYS n 1 116 ASP n 1 117 ASN n 1 118 ILE n 1 119 GLY n 1 120 SER n 1 121 GLN n 1 122 TYR n 1 123 LEU n 1 124 LEU n 1 125 ASN n 1 126 TRP n 1 127 CYS n 1 128 VAL n 1 129 GLN n 1 130 ILE n 1 131 ALA n 1 132 LYS n 1 133 GLY n 1 134 MET n 1 135 ASN n 1 136 TYR n 1 137 LEU n 1 138 GLU n 1 139 ASP n 1 140 ARG n 1 141 ARG n 1 142 LEU n 1 143 VAL n 1 144 HIS n 1 145 ARG n 1 146 ASP n 1 147 LEU n 1 148 ALA n 1 149 ALA n 1 150 ARG n 1 151 ASN n 1 152 VAL n 1 153 LEU n 1 154 VAL n 1 155 LYS n 1 156 THR n 1 157 PRO n 1 158 GLN n 1 159 HIS n 1 160 VAL n 1 161 LYS n 1 162 ILE n 1 163 THR n 1 164 ASP n 1 165 PHE n 1 166 GLY n 1 167 LEU n 1 168 ALA n 1 169 LYS n 1 170 LEU n 1 171 LEU n 1 172 GLY n 1 173 ALA n 1 174 GLU n 1 175 GLU n 1 176 LYS n 1 177 GLU n 1 178 TYR n 1 179 HIS n 1 180 ALA n 1 181 GLU n 1 182 GLY n 1 183 GLY n 1 184 LYS n 1 185 VAL n 1 186 PRO n 1 187 ILE n 1 188 LYS n 1 189 TRP n 1 190 MET n 1 191 ALA n 1 192 LEU n 1 193 GLU n 1 194 SER n 1 195 ILE n 1 196 LEU n 1 197 HIS n 1 198 ARG n 1 199 ILE n 1 200 TYR n 1 201 THR n 1 202 HIS n 1 203 GLN n 1 204 SER n 1 205 ASP n 1 206 VAL n 1 207 TRP n 1 208 SER n 1 209 TYR n 1 210 GLY n 1 211 VAL n 1 212 THR n 1 213 VAL n 1 214 TRP n 1 215 GLU n 1 216 LEU n 1 217 MET n 1 218 THR n 1 219 PHE n 1 220 GLY n 1 221 SER n 1 222 LYS n 1 223 PRO n 1 224 TYR n 1 225 ASP n 1 226 GLY n 1 227 ILE n 1 228 PRO n 1 229 ALA n 1 230 SER n 1 231 GLU n 1 232 ILE n 1 233 SER n 1 234 SER n 1 235 ILE n 1 236 LEU n 1 237 GLU n 1 238 LYS n 1 239 GLY n 1 240 GLU n 1 241 ARG n 1 242 LEU n 1 243 PRO n 1 244 GLN n 1 245 PRO n 1 246 PRO n 1 247 ILE n 1 248 CYS n 1 249 THR n 1 250 ILE n 1 251 ASP n 1 252 VAL n 1 253 TYR n 1 254 MET n 1 255 ILE n 1 256 MET n 1 257 VAL n 1 258 LYS n 1 259 CYS n 1 260 TRP n 1 261 MET n 1 262 ILE n 1 263 ASP n 1 264 ALA n 1 265 ASP n 1 266 SER n 1 267 ARG n 1 268 PRO n 1 269 LYS n 1 270 PHE n 1 271 ARG n 1 272 GLU n 1 273 LEU n 1 274 ILE n 1 275 ILE n 1 276 GLU n 1 277 PHE n 1 278 SER n 1 279 LYS n 1 280 MET n 1 281 ALA n 1 282 ARG n 1 283 ASP n 1 284 PRO n 1 285 GLN n 1 286 ARG n 1 287 TYR n 1 288 LEU n 1 289 VAL n 1 290 ILE n 1 291 GLN n 1 292 GLY n 1 293 ASP n 1 294 GLU n 1 295 ARG n 1 296 MET n 1 297 HIS n 1 298 LEU n 1 299 PRO n 1 300 SER n 1 301 PRO n 1 302 THR n 1 303 ASP n 1 304 SER n 1 305 ASN n 1 306 PHE n 1 307 TYR n 1 308 ARG n 1 309 ALA n 1 310 LEU n 1 311 MET n 1 312 ASP n 1 313 GLU n 1 314 GLU n 1 315 ASP n 1 316 MET n 1 317 ASP n 1 318 ASP n 1 319 VAL n 1 320 VAL n 1 321 ASP n 1 322 ALA n 1 323 ASP n 1 324 GLU n 1 325 TYR n 1 326 LEU n 1 327 ILE n 1 328 PRO n 1 329 GLN n 1 330 GLN n 1 331 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 331 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTriEX _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _struct_ref.pdbx_align_begin 695 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7U9A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 331 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 695 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 695 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7U9A GLY A 1 ? UNP P00533 ? ? 'expression tag' 692 1 1 7U9A SER A 2 ? UNP P00533 ? ? 'expression tag' 693 2 1 7U9A THR A 3 ? UNP P00533 ? ? 'expression tag' 694 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FLC non-polymer . 'CITRATE ANION' ? 'C6 H5 O7 -3' 189.100 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M19 non-polymer . '4-(5-chloro-4-fluoro-2-hydroxyanilino)-7-methoxyquinazolin-6-ol' ? 'C15 H11 Cl F N3 O3' 335.718 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7U9A _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.053 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES pH 6.5, 1.1 M Sodium Citrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-07-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 64.330 _reflns.entry_id 7U9A _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 103.110 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16002 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.000 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.125 _reflns.pdbx_Rpim_I_all 0.055 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 80669 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.600 2.650 ? 1.000 3989 ? ? ? 778 100.000 ? ? ? ? ? ? ? ? ? ? ? ? ? 5.100 ? ? ? ? 1.391 0.606 ? 1 1 ? ? ? ? ? ? ? ? ? ? ? 7.060 103.190 ? 29.400 4015 ? ? ? 855 99.200 ? ? ? ? ? ? ? ? ? ? ? ? ? 4.700 ? ? ? ? 0.058 0.026 ? 2 1 ? ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 163.220 _refine.B_iso_mean 69.2666 _refine.B_iso_min 30.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7U9A _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6000 _refine.ls_d_res_low 103.1100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15995 _refine.ls_number_reflns_R_free 750 _refine.ls_number_reflns_R_work 15245 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9000 _refine.ls_percent_reflns_R_free 4.6900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1957 _refine.ls_R_factor_R_free 0.2260 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1941 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6VHP _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.0500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6000 _refine_hist.d_res_low 103.1100 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 2417 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 295 _refine_hist.pdbx_B_iso_mean_ligand 87.09 _refine_hist.pdbx_B_iso_mean_solvent 62.95 _refine_hist.pdbx_number_atoms_protein 2357 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6000 2.8000 3160 . 120 3040 100.0000 . . . 0.3155 0.0000 0.3061 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.8000 3.0800 3169 . 172 2997 100.0000 . . . 0.2883 0.0000 0.2700 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.0900 3.5300 3157 . 121 3036 100.0000 . . . 0.2936 0.0000 0.2242 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.5300 4.4500 3220 . 174 3046 100.0000 . . . 0.2089 0.0000 0.1773 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.4500 103.1100 3289 . 163 3126 100.0000 . . . 0.1921 0.0000 0.1595 . . . . . . . 5 . . . # _struct.entry_id 7U9A _struct.title 'EGFR in complex with a macrocyclic inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7U9A _struct_keywords.text 'EGFR, kinase, macrocycle, inhibitor, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 17 ? THR A 19 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 LYS A 63 ? VAL A 78 ? LYS A 754 VAL A 769 1 ? 16 HELX_P HELX_P3 AA3 CYS A 106 ? HIS A 114 ? CYS A 797 HIS A 805 1 ? 9 HELX_P HELX_P4 AA4 LYS A 115 ? ILE A 118 ? LYS A 806 ILE A 809 5 ? 4 HELX_P HELX_P5 AA5 GLY A 119 ? ARG A 140 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 AA6 ALA A 148 ? ARG A 150 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 AA7 PRO A 186 ? MET A 190 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P8 AA8 ALA A 191 ? ARG A 198 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P9 AA9 THR A 201 ? THR A 218 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P10 AB1 PRO A 228 ? LYS A 238 ? PRO A 919 LYS A 929 1 ? 11 HELX_P HELX_P11 AB2 THR A 249 ? CYS A 259 ? THR A 940 CYS A 950 1 ? 11 HELX_P HELX_P12 AB3 ASP A 263 ? ARG A 267 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P13 AB4 LYS A 269 ? ARG A 282 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P14 AB5 ASP A 283 ? TYR A 287 ? ASP A 974 TYR A 978 5 ? 5 HELX_P HELX_P15 AB6 ASP A 321 ? TYR A 325 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 21 ? SER A 29 ? PHE A 712 SER A 720 AA1 2 THR A 34 ? TRP A 40 ? THR A 725 TRP A 731 AA1 3 ILE A 49 ? GLU A 55 ? ILE A 740 GLU A 746 AA1 4 VAL A 95 ? GLN A 100 ? VAL A 786 GLN A 791 AA1 5 LEU A 86 ? LEU A 91 ? LEU A 777 LEU A 782 AA2 1 LEU A 142 ? VAL A 143 ? LEU A 833 VAL A 834 AA2 2 LYS A 169 ? LEU A 170 ? LYS A 860 LEU A 861 AA3 1 VAL A 152 ? THR A 156 ? VAL A 843 THR A 847 AA3 2 HIS A 159 ? ILE A 162 ? HIS A 850 ILE A 853 AA4 1 TYR A 178 ? HIS A 179 ? TYR A 869 HIS A 870 AA4 2 ILE A 199 ? TYR A 200 ? ILE A 890 TYR A 891 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 28 ? N GLY A 719 O VAL A 35 ? O VAL A 726 AA1 2 3 N TRP A 40 ? N TRP A 731 O ILE A 49 ? O ILE A 740 AA1 3 4 N LYS A 54 ? N LYS A 745 O LEU A 97 ? O LEU A 788 AA1 4 5 O ILE A 98 ? O ILE A 789 N LEU A 87 ? N LEU A 778 AA2 1 2 N VAL A 143 ? N VAL A 834 O LYS A 169 ? O LYS A 860 AA3 1 2 N LEU A 153 ? N LEU A 844 O LYS A 161 ? O LYS A 852 AA4 1 2 N TYR A 178 ? N TYR A 869 O TYR A 200 ? O TYR A 891 # _atom_sites.entry_id 7U9A _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006858 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006858 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006858 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 692 ? ? ? A . n A 1 2 SER 2 693 ? ? ? A . n A 1 3 THR 3 694 694 THR THR A . n A 1 4 SER 4 695 695 SER SER A . n A 1 5 GLY 5 696 696 GLY GLY A . n A 1 6 GLU 6 697 697 GLU GLU A . n A 1 7 ALA 7 698 698 ALA ALA A . n A 1 8 PRO 8 699 699 PRO PRO A . n A 1 9 ASN 9 700 700 ASN ASN A . n A 1 10 GLN 10 701 701 GLN GLN A . n A 1 11 ALA 11 702 702 ALA ALA A . n A 1 12 LEU 12 703 703 LEU LEU A . n A 1 13 LEU 13 704 704 LEU LEU A . n A 1 14 ARG 14 705 705 ARG ARG A . n A 1 15 ILE 15 706 706 ILE ILE A . n A 1 16 LEU 16 707 707 LEU LEU A . n A 1 17 LYS 17 708 708 LYS LYS A . n A 1 18 GLU 18 709 709 GLU GLU A . n A 1 19 THR 19 710 710 THR THR A . n A 1 20 GLU 20 711 711 GLU GLU A . n A 1 21 PHE 21 712 712 PHE PHE A . n A 1 22 LYS 22 713 713 LYS LYS A . n A 1 23 LYS 23 714 714 LYS LYS A . n A 1 24 ILE 24 715 715 ILE ILE A . n A 1 25 LYS 25 716 716 LYS LYS A . n A 1 26 VAL 26 717 717 VAL VAL A . n A 1 27 LEU 27 718 718 LEU LEU A . n A 1 28 GLY 28 719 719 GLY GLY A . n A 1 29 SER 29 720 720 SER SER A . n A 1 30 GLY 30 721 721 GLY GLY A . n A 1 31 ALA 31 722 722 ALA ALA A . n A 1 32 PHE 32 723 723 PHE PHE A . n A 1 33 GLY 33 724 724 GLY GLY A . n A 1 34 THR 34 725 725 THR THR A . n A 1 35 VAL 35 726 726 VAL VAL A . n A 1 36 TYR 36 727 727 TYR TYR A . n A 1 37 LYS 37 728 728 LYS LYS A . n A 1 38 GLY 38 729 729 GLY GLY A . n A 1 39 LEU 39 730 730 LEU LEU A . n A 1 40 TRP 40 731 731 TRP TRP A . n A 1 41 ILE 41 732 732 ILE ILE A . n A 1 42 PRO 42 733 733 PRO PRO A . n A 1 43 GLU 43 734 734 GLU GLU A . n A 1 44 GLY 44 735 735 GLY GLY A . n A 1 45 GLU 45 736 736 GLU GLU A . n A 1 46 LYS 46 737 737 LYS LYS A . n A 1 47 VAL 47 738 738 VAL VAL A . n A 1 48 LYS 48 739 739 LYS LYS A . n A 1 49 ILE 49 740 740 ILE ILE A . n A 1 50 PRO 50 741 741 PRO PRO A . n A 1 51 VAL 51 742 742 VAL VAL A . n A 1 52 ALA 52 743 743 ALA ALA A . n A 1 53 ILE 53 744 744 ILE ILE A . n A 1 54 LYS 54 745 745 LYS LYS A . n A 1 55 GLU 55 746 746 GLU GLU A . n A 1 56 LEU 56 747 ? ? ? A . n A 1 57 ARG 57 748 ? ? ? A . n A 1 58 GLU 58 749 ? ? ? A . n A 1 59 ALA 59 750 ? ? ? A . n A 1 60 THR 60 751 ? ? ? A . n A 1 61 SER 61 752 752 SER SER A . n A 1 62 PRO 62 753 753 PRO PRO A . n A 1 63 LYS 63 754 754 LYS LYS A . n A 1 64 ALA 64 755 755 ALA ALA A . n A 1 65 ASN 65 756 756 ASN ASN A . n A 1 66 LYS 66 757 757 LYS LYS A . n A 1 67 GLU 67 758 758 GLU GLU A . n A 1 68 ILE 68 759 759 ILE ILE A . n A 1 69 LEU 69 760 760 LEU LEU A . n A 1 70 ASP 70 761 761 ASP ASP A . n A 1 71 GLU 71 762 762 GLU GLU A . n A 1 72 ALA 72 763 763 ALA ALA A . n A 1 73 TYR 73 764 764 TYR TYR A . n A 1 74 VAL 74 765 765 VAL VAL A . n A 1 75 MET 75 766 766 MET MET A . n A 1 76 ALA 76 767 767 ALA ALA A . n A 1 77 SER 77 768 768 SER SER A . n A 1 78 VAL 78 769 769 VAL VAL A . n A 1 79 ASP 79 770 770 ASP ASP A . n A 1 80 ASN 80 771 771 ASN ASN A . n A 1 81 PRO 81 772 772 PRO PRO A . n A 1 82 HIS 82 773 773 HIS HIS A . n A 1 83 VAL 83 774 774 VAL VAL A . n A 1 84 CYS 84 775 775 CYS CYS A . n A 1 85 ARG 85 776 776 ARG ARG A . n A 1 86 LEU 86 777 777 LEU LEU A . n A 1 87 LEU 87 778 778 LEU LEU A . n A 1 88 GLY 88 779 779 GLY GLY A . n A 1 89 ILE 89 780 780 ILE ILE A . n A 1 90 CYS 90 781 781 CYS CYS A . n A 1 91 LEU 91 782 782 LEU LEU A . n A 1 92 THR 92 783 783 THR THR A . n A 1 93 SER 93 784 784 SER SER A . n A 1 94 THR 94 785 785 THR THR A . n A 1 95 VAL 95 786 786 VAL VAL A . n A 1 96 GLN 96 787 787 GLN GLN A . n A 1 97 LEU 97 788 788 LEU LEU A . n A 1 98 ILE 98 789 789 ILE ILE A . n A 1 99 THR 99 790 790 THR THR A . n A 1 100 GLN 100 791 791 GLN GLN A . n A 1 101 LEU 101 792 792 LEU LEU A . n A 1 102 MET 102 793 793 MET MET A . n A 1 103 PRO 103 794 794 PRO PRO A . n A 1 104 PHE 104 795 795 PHE PHE A . n A 1 105 GLY 105 796 796 GLY GLY A . n A 1 106 CYS 106 797 797 CYS CYS A . n A 1 107 LEU 107 798 798 LEU LEU A . n A 1 108 LEU 108 799 799 LEU LEU A . n A 1 109 ASP 109 800 800 ASP ASP A . n A 1 110 TYR 110 801 801 TYR TYR A . n A 1 111 VAL 111 802 802 VAL VAL A . n A 1 112 ARG 112 803 803 ARG ARG A . n A 1 113 GLU 113 804 804 GLU GLU A . n A 1 114 HIS 114 805 805 HIS HIS A . n A 1 115 LYS 115 806 806 LYS LYS A . n A 1 116 ASP 116 807 807 ASP ASP A . n A 1 117 ASN 117 808 808 ASN ASN A . n A 1 118 ILE 118 809 809 ILE ILE A . n A 1 119 GLY 119 810 810 GLY GLY A . n A 1 120 SER 120 811 811 SER SER A . n A 1 121 GLN 121 812 812 GLN GLN A . n A 1 122 TYR 122 813 813 TYR TYR A . n A 1 123 LEU 123 814 814 LEU LEU A . n A 1 124 LEU 124 815 815 LEU LEU A . n A 1 125 ASN 125 816 816 ASN ASN A . n A 1 126 TRP 126 817 817 TRP TRP A . n A 1 127 CYS 127 818 818 CYS CYS A . n A 1 128 VAL 128 819 819 VAL VAL A . n A 1 129 GLN 129 820 820 GLN GLN A . n A 1 130 ILE 130 821 821 ILE ILE A . n A 1 131 ALA 131 822 822 ALA ALA A . n A 1 132 LYS 132 823 823 LYS LYS A . n A 1 133 GLY 133 824 824 GLY GLY A . n A 1 134 MET 134 825 825 MET MET A . n A 1 135 ASN 135 826 826 ASN ASN A . n A 1 136 TYR 136 827 827 TYR TYR A . n A 1 137 LEU 137 828 828 LEU LEU A . n A 1 138 GLU 138 829 829 GLU GLU A . n A 1 139 ASP 139 830 830 ASP ASP A . n A 1 140 ARG 140 831 831 ARG ARG A . n A 1 141 ARG 141 832 832 ARG ARG A . n A 1 142 LEU 142 833 833 LEU LEU A . n A 1 143 VAL 143 834 834 VAL VAL A . n A 1 144 HIS 144 835 835 HIS HIS A . n A 1 145 ARG 145 836 836 ARG ARG A . n A 1 146 ASP 146 837 837 ASP ASP A . n A 1 147 LEU 147 838 838 LEU LEU A . n A 1 148 ALA 148 839 839 ALA ALA A . n A 1 149 ALA 149 840 840 ALA ALA A . n A 1 150 ARG 150 841 841 ARG ARG A . n A 1 151 ASN 151 842 842 ASN ASN A . n A 1 152 VAL 152 843 843 VAL VAL A . n A 1 153 LEU 153 844 844 LEU LEU A . n A 1 154 VAL 154 845 845 VAL VAL A . n A 1 155 LYS 155 846 846 LYS LYS A . n A 1 156 THR 156 847 847 THR THR A . n A 1 157 PRO 157 848 848 PRO PRO A . n A 1 158 GLN 158 849 849 GLN GLN A . n A 1 159 HIS 159 850 850 HIS HIS A . n A 1 160 VAL 160 851 851 VAL VAL A . n A 1 161 LYS 161 852 852 LYS LYS A . n A 1 162 ILE 162 853 853 ILE ILE A . n A 1 163 THR 163 854 854 THR THR A . n A 1 164 ASP 164 855 855 ASP ASP A . n A 1 165 PHE 165 856 856 PHE PHE A . n A 1 166 GLY 166 857 857 GLY GLY A . n A 1 167 LEU 167 858 858 LEU LEU A . n A 1 168 ALA 168 859 859 ALA ALA A . n A 1 169 LYS 169 860 860 LYS LYS A . n A 1 170 LEU 170 861 861 LEU LEU A . n A 1 171 LEU 171 862 862 LEU LEU A . n A 1 172 GLY 172 863 863 GLY GLY A . n A 1 173 ALA 173 864 864 ALA ALA A . n A 1 174 GLU 174 865 ? ? ? A . n A 1 175 GLU 175 866 ? ? ? A . n A 1 176 LYS 176 867 867 LYS LYS A . n A 1 177 GLU 177 868 868 GLU GLU A . n A 1 178 TYR 178 869 869 TYR TYR A . n A 1 179 HIS 179 870 870 HIS HIS A . n A 1 180 ALA 180 871 871 ALA ALA A . n A 1 181 GLU 181 872 872 GLU GLU A . n A 1 182 GLY 182 873 ? ? ? A . n A 1 183 GLY 183 874 ? ? ? A . n A 1 184 LYS 184 875 875 LYS LYS A . n A 1 185 VAL 185 876 876 VAL VAL A . n A 1 186 PRO 186 877 877 PRO PRO A . n A 1 187 ILE 187 878 878 ILE ILE A . n A 1 188 LYS 188 879 879 LYS LYS A . n A 1 189 TRP 189 880 880 TRP TRP A . n A 1 190 MET 190 881 881 MET MET A . n A 1 191 ALA 191 882 882 ALA ALA A . n A 1 192 LEU 192 883 883 LEU LEU A . n A 1 193 GLU 193 884 884 GLU GLU A . n A 1 194 SER 194 885 885 SER SER A . n A 1 195 ILE 195 886 886 ILE ILE A . n A 1 196 LEU 196 887 887 LEU LEU A . n A 1 197 HIS 197 888 888 HIS HIS A . n A 1 198 ARG 198 889 889 ARG ARG A . n A 1 199 ILE 199 890 890 ILE ILE A . n A 1 200 TYR 200 891 891 TYR TYR A . n A 1 201 THR 201 892 892 THR THR A . n A 1 202 HIS 202 893 893 HIS HIS A . n A 1 203 GLN 203 894 894 GLN GLN A . n A 1 204 SER 204 895 895 SER SER A . n A 1 205 ASP 205 896 896 ASP ASP A . n A 1 206 VAL 206 897 897 VAL VAL A . n A 1 207 TRP 207 898 898 TRP TRP A . n A 1 208 SER 208 899 899 SER SER A . n A 1 209 TYR 209 900 900 TYR TYR A . n A 1 210 GLY 210 901 901 GLY GLY A . n A 1 211 VAL 211 902 902 VAL VAL A . n A 1 212 THR 212 903 903 THR THR A . n A 1 213 VAL 213 904 904 VAL VAL A . n A 1 214 TRP 214 905 905 TRP TRP A . n A 1 215 GLU 215 906 906 GLU GLU A . n A 1 216 LEU 216 907 907 LEU LEU A . n A 1 217 MET 217 908 908 MET MET A . n A 1 218 THR 218 909 909 THR THR A . n A 1 219 PHE 219 910 910 PHE PHE A . n A 1 220 GLY 220 911 911 GLY GLY A . n A 1 221 SER 221 912 912 SER SER A . n A 1 222 LYS 222 913 913 LYS LYS A . n A 1 223 PRO 223 914 914 PRO PRO A . n A 1 224 TYR 224 915 915 TYR TYR A . n A 1 225 ASP 225 916 916 ASP ASP A . n A 1 226 GLY 226 917 917 GLY GLY A . n A 1 227 ILE 227 918 918 ILE ILE A . n A 1 228 PRO 228 919 919 PRO PRO A . n A 1 229 ALA 229 920 920 ALA ALA A . n A 1 230 SER 230 921 921 SER SER A . n A 1 231 GLU 231 922 922 GLU GLU A . n A 1 232 ILE 232 923 923 ILE ILE A . n A 1 233 SER 233 924 924 SER SER A . n A 1 234 SER 234 925 925 SER SER A . n A 1 235 ILE 235 926 926 ILE ILE A . n A 1 236 LEU 236 927 927 LEU LEU A . n A 1 237 GLU 237 928 928 GLU GLU A . n A 1 238 LYS 238 929 929 LYS LYS A . n A 1 239 GLY 239 930 930 GLY GLY A . n A 1 240 GLU 240 931 931 GLU GLU A . n A 1 241 ARG 241 932 932 ARG ARG A . n A 1 242 LEU 242 933 933 LEU LEU A . n A 1 243 PRO 243 934 934 PRO PRO A . n A 1 244 GLN 244 935 935 GLN GLN A . n A 1 245 PRO 245 936 936 PRO PRO A . n A 1 246 PRO 246 937 937 PRO PRO A . n A 1 247 ILE 247 938 938 ILE ILE A . n A 1 248 CYS 248 939 939 CYS CYS A . n A 1 249 THR 249 940 940 THR THR A . n A 1 250 ILE 250 941 941 ILE ILE A . n A 1 251 ASP 251 942 942 ASP ASP A . n A 1 252 VAL 252 943 943 VAL VAL A . n A 1 253 TYR 253 944 944 TYR TYR A . n A 1 254 MET 254 945 945 MET MET A . n A 1 255 ILE 255 946 946 ILE ILE A . n A 1 256 MET 256 947 947 MET MET A . n A 1 257 VAL 257 948 948 VAL VAL A . n A 1 258 LYS 258 949 949 LYS LYS A . n A 1 259 CYS 259 950 950 CYS CYS A . n A 1 260 TRP 260 951 951 TRP TRP A . n A 1 261 MET 261 952 952 MET MET A . n A 1 262 ILE 262 953 953 ILE ILE A . n A 1 263 ASP 263 954 954 ASP ASP A . n A 1 264 ALA 264 955 955 ALA ALA A . n A 1 265 ASP 265 956 956 ASP ASP A . n A 1 266 SER 266 957 957 SER SER A . n A 1 267 ARG 267 958 958 ARG ARG A . n A 1 268 PRO 268 959 959 PRO PRO A . n A 1 269 LYS 269 960 960 LYS LYS A . n A 1 270 PHE 270 961 961 PHE PHE A . n A 1 271 ARG 271 962 962 ARG ARG A . n A 1 272 GLU 272 963 963 GLU GLU A . n A 1 273 LEU 273 964 964 LEU LEU A . n A 1 274 ILE 274 965 965 ILE ILE A . n A 1 275 ILE 275 966 966 ILE ILE A . n A 1 276 GLU 276 967 967 GLU GLU A . n A 1 277 PHE 277 968 968 PHE PHE A . n A 1 278 SER 278 969 969 SER SER A . n A 1 279 LYS 279 970 970 LYS LYS A . n A 1 280 MET 280 971 971 MET MET A . n A 1 281 ALA 281 972 972 ALA ALA A . n A 1 282 ARG 282 973 973 ARG ARG A . n A 1 283 ASP 283 974 974 ASP ASP A . n A 1 284 PRO 284 975 975 PRO PRO A . n A 1 285 GLN 285 976 976 GLN GLN A . n A 1 286 ARG 286 977 977 ARG ARG A . n A 1 287 TYR 287 978 978 TYR TYR A . n A 1 288 LEU 288 979 979 LEU LEU A . n A 1 289 VAL 289 980 980 VAL VAL A . n A 1 290 ILE 290 981 981 ILE ILE A . n A 1 291 GLN 291 982 982 GLN GLN A . n A 1 292 GLY 292 983 983 GLY GLY A . n A 1 293 ASP 293 984 984 ASP ASP A . n A 1 294 GLU 294 985 ? ? ? A . n A 1 295 ARG 295 986 ? ? ? A . n A 1 296 MET 296 987 ? ? ? A . n A 1 297 HIS 297 988 ? ? ? A . n A 1 298 LEU 298 989 ? ? ? A . n A 1 299 PRO 299 990 ? ? ? A . n A 1 300 SER 300 991 ? ? ? A . n A 1 301 PRO 301 992 ? ? ? A . n A 1 302 THR 302 993 ? ? ? A . n A 1 303 ASP 303 994 ? ? ? A . n A 1 304 SER 304 995 ? ? ? A . n A 1 305 ASN 305 996 ? ? ? A . n A 1 306 PHE 306 997 ? ? ? A . n A 1 307 TYR 307 998 ? ? ? A . n A 1 308 ARG 308 999 ? ? ? A . n A 1 309 ALA 309 1000 ? ? ? A . n A 1 310 LEU 310 1001 ? ? ? A . n A 1 311 MET 311 1002 ? ? ? A . n A 1 312 ASP 312 1003 ? ? ? A . n A 1 313 GLU 313 1004 ? ? ? A . n A 1 314 GLU 314 1005 ? ? ? A . n A 1 315 ASP 315 1006 1006 ASP ASP A . n A 1 316 MET 316 1007 1007 MET MET A . n A 1 317 ASP 317 1008 1008 ASP ASP A . n A 1 318 ASP 318 1009 1009 ASP ASP A . n A 1 319 VAL 319 1010 1010 VAL VAL A . n A 1 320 VAL 320 1011 1011 VAL VAL A . n A 1 321 ASP 321 1012 1012 ASP ASP A . n A 1 322 ALA 322 1013 1013 ALA ALA A . n A 1 323 ASP 323 1014 1014 ASP ASP A . n A 1 324 GLU 324 1015 1015 GLU GLU A . n A 1 325 TYR 325 1016 1016 TYR TYR A . n A 1 326 LEU 326 1017 1017 LEU LEU A . n A 1 327 ILE 327 1018 1018 ILE ILE A . n A 1 328 PRO 328 1019 ? ? ? A . n A 1 329 GLN 329 1020 ? ? ? A . n A 1 330 GLN 330 1021 ? ? ? A . n A 1 331 GLY 331 1022 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email eck@crystal.harvard.edu _pdbx_contact_author.name_first Michael _pdbx_contact_author.name_last Eck _pdbx_contact_author.name_mi J _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4247-9403 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 M19 1 1101 1101 M19 J36 A . C 3 FLC 1 1102 1102 FLC FLC A . D 4 HOH 1 1201 13 HOH HOH A . D 4 HOH 2 1202 24 HOH HOH A . D 4 HOH 3 1203 2 HOH HOH A . D 4 HOH 4 1204 22 HOH HOH A . D 4 HOH 5 1205 4 HOH HOH A . D 4 HOH 6 1206 1 HOH HOH A . D 4 HOH 7 1207 19 HOH HOH A . D 4 HOH 8 1208 3 HOH HOH A . D 4 HOH 9 1209 5 HOH HOH A . D 4 HOH 10 1210 12 HOH HOH A . D 4 HOH 11 1211 14 HOH HOH A . D 4 HOH 12 1212 6 HOH HOH A . D 4 HOH 13 1213 18 HOH HOH A . D 4 HOH 14 1214 8 HOH HOH A . D 4 HOH 15 1215 21 HOH HOH A . D 4 HOH 16 1216 16 HOH HOH A . D 4 HOH 17 1217 15 HOH HOH A . D 4 HOH 18 1218 17 HOH HOH A . D 4 HOH 19 1219 7 HOH HOH A . D 4 HOH 20 1220 10 HOH HOH A . D 4 HOH 21 1221 23 HOH HOH A . D 4 HOH 22 1222 9 HOH HOH A . D 4 HOH 23 1223 20 HOH HOH A . D 4 HOH 24 1224 11 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2022-11-30 3 'Structure model' 1 2 2022-12-21 4 'Structure model' 1 3 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 53.8131 6.2687 31.6695 0.4137 ? 0.0853 ? 0.0124 ? 0.4858 ? -0.1257 ? 0.4852 ? 5.1897 ? -1.1774 ? 0.0746 ? 4.9881 ? -2.0253 ? 9.1078 ? -0.0745 ? -0.2249 ? 0.2532 ? 0.0956 ? 0.0111 ? 0.6804 ? -0.4124 ? -1.1878 ? 0.0663 ? 2 'X-RAY DIFFRACTION' ? refined 61.0084 -15.0292 22.9510 0.3664 ? 0.0155 ? 0.0816 ? 0.4367 ? -0.0524 ? 0.3436 ? 3.2147 ? -0.5894 ? -0.6779 ? 6.0830 ? 1.3882 ? 3.1969 ? -0.1246 ? -0.0853 ? -0.2280 ? 0.5043 ? -0.2131 ? 0.6058 ? 0.1468 ? -0.4728 ? 0.2918 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 694 ? ? ? A 791 ? ? ;chain 'A' and (resid 694 through 791 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 792 ? ? ? A 1018 ? ? ;chain 'A' and (resid 792 through 1018 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_entry_details.entry_id 7U9A _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 715 ? ? -138.68 -47.52 2 1 PRO A 753 ? ? -89.76 -125.81 3 1 LEU A 782 ? ? -111.29 65.98 4 1 ASN A 808 ? ? -143.80 20.61 5 1 ARG A 832 ? ? 70.53 34.01 6 1 ASP A 837 ? ? -158.53 43.46 7 1 ASP A 855 ? ? 57.15 83.56 8 1 ASP A 974 ? ? -155.08 70.83 9 1 ASP A 1009 ? ? -96.69 31.42 10 1 ASP A 1014 ? ? -58.17 -8.86 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 692 ? A GLY 1 2 1 Y 1 A SER 693 ? A SER 2 3 1 Y 1 A LEU 747 ? A LEU 56 4 1 Y 1 A ARG 748 ? A ARG 57 5 1 Y 1 A GLU 749 ? A GLU 58 6 1 Y 1 A ALA 750 ? A ALA 59 7 1 Y 1 A THR 751 ? A THR 60 8 1 Y 1 A GLU 865 ? A GLU 174 9 1 Y 1 A GLU 866 ? A GLU 175 10 1 Y 1 A GLY 873 ? A GLY 182 11 1 Y 1 A GLY 874 ? A GLY 183 12 1 Y 1 A GLU 985 ? A GLU 294 13 1 Y 1 A ARG 986 ? A ARG 295 14 1 Y 1 A MET 987 ? A MET 296 15 1 Y 1 A HIS 988 ? A HIS 297 16 1 Y 1 A LEU 989 ? A LEU 298 17 1 Y 1 A PRO 990 ? A PRO 299 18 1 Y 1 A SER 991 ? A SER 300 19 1 Y 1 A PRO 992 ? A PRO 301 20 1 Y 1 A THR 993 ? A THR 302 21 1 Y 1 A ASP 994 ? A ASP 303 22 1 Y 1 A SER 995 ? A SER 304 23 1 Y 1 A ASN 996 ? A ASN 305 24 1 Y 1 A PHE 997 ? A PHE 306 25 1 Y 1 A TYR 998 ? A TYR 307 26 1 Y 1 A ARG 999 ? A ARG 308 27 1 Y 1 A ALA 1000 ? A ALA 309 28 1 Y 1 A LEU 1001 ? A LEU 310 29 1 Y 1 A MET 1002 ? A MET 311 30 1 Y 1 A ASP 1003 ? A ASP 312 31 1 Y 1 A GLU 1004 ? A GLU 313 32 1 Y 1 A GLU 1005 ? A GLU 314 33 1 Y 1 A PRO 1019 ? A PRO 328 34 1 Y 1 A GLN 1020 ? A GLN 329 35 1 Y 1 A GLN 1021 ? A GLN 330 36 1 Y 1 A GLY 1022 ? A GLY 331 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FLC CAC C N N 88 FLC CA C N N 89 FLC CB C N N 90 FLC CBC C N N 91 FLC CG C N N 92 FLC CGC C N N 93 FLC OA1 O N N 94 FLC OA2 O N N 95 FLC OB1 O N N 96 FLC OB2 O N N 97 FLC OG1 O N N 98 FLC OG2 O N N 99 FLC OHB O N N 100 FLC HA1 H N N 101 FLC HA2 H N N 102 FLC HG1 H N N 103 FLC HG2 H N N 104 FLC HOB H N N 105 GLN N N N N 106 GLN CA C N S 107 GLN C C N N 108 GLN O O N N 109 GLN CB C N N 110 GLN CG C N N 111 GLN CD C N N 112 GLN OE1 O N N 113 GLN NE2 N N N 114 GLN OXT O N N 115 GLN H H N N 116 GLN H2 H N N 117 GLN HA H N N 118 GLN HB2 H N N 119 GLN HB3 H N N 120 GLN HG2 H N N 121 GLN HG3 H N N 122 GLN HE21 H N N 123 GLN HE22 H N N 124 GLN HXT H N N 125 GLU N N N N 126 GLU CA C N S 127 GLU C C N N 128 GLU O O N N 129 GLU CB C N N 130 GLU CG C N N 131 GLU CD C N N 132 GLU OE1 O N N 133 GLU OE2 O N N 134 GLU OXT O N N 135 GLU H H N N 136 GLU H2 H N N 137 GLU HA H N N 138 GLU HB2 H N N 139 GLU HB3 H N N 140 GLU HG2 H N N 141 GLU HG3 H N N 142 GLU HE2 H N N 143 GLU HXT H N N 144 GLY N N N N 145 GLY CA C N N 146 GLY C C N N 147 GLY O O N N 148 GLY OXT O N N 149 GLY H H N N 150 GLY H2 H N N 151 GLY HA2 H N N 152 GLY HA3 H N N 153 GLY HXT H N N 154 HIS N N N N 155 HIS CA C N S 156 HIS C C N N 157 HIS O O N N 158 HIS CB C N N 159 HIS CG C Y N 160 HIS ND1 N Y N 161 HIS CD2 C Y N 162 HIS CE1 C Y N 163 HIS NE2 N Y N 164 HIS OXT O N N 165 HIS H H N N 166 HIS H2 H N N 167 HIS HA H N N 168 HIS HB2 H N N 169 HIS HB3 H N N 170 HIS HD1 H N N 171 HIS HD2 H N N 172 HIS HE1 H N N 173 HIS HE2 H N N 174 HIS HXT H N N 175 HOH O O N N 176 HOH H1 H N N 177 HOH H2 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 M19 C11 C Y N 248 M19 C13 C Y N 249 M19 C14 C Y N 250 M19 C15 C Y N 251 M19 C17 C Y N 252 M19 C02 C Y N 253 M19 C03 C Y N 254 M19 C05 C N N 255 M19 C06 C Y N 256 M19 C07 C Y N 257 M19 C09 C Y N 258 M19 C19 C Y N 259 M19 C20 C Y N 260 M19 C22 C Y N 261 M19 C23 C Y N 262 M19 F18 F N N 263 M19 N08 N Y N 264 M19 N10 N Y N 265 M19 N12 N N N 266 M19 O01 O N N 267 M19 O04 O N N 268 M19 O21 O N N 269 M19 CL16 CL N N 270 M19 H1 H N N 271 M19 H2 H N N 272 M19 H3 H N N 273 M19 H4 H N N 274 M19 H5 H N N 275 M19 H6 H N N 276 M19 H7 H N N 277 M19 H8 H N N 278 M19 H9 H N N 279 M19 H10 H N N 280 M19 H11 H N N 281 MET N N N N 282 MET CA C N S 283 MET C C N N 284 MET O O N N 285 MET CB C N N 286 MET CG C N N 287 MET SD S N N 288 MET CE C N N 289 MET OXT O N N 290 MET H H N N 291 MET H2 H N N 292 MET HA H N N 293 MET HB2 H N N 294 MET HB3 H N N 295 MET HG2 H N N 296 MET HG3 H N N 297 MET HE1 H N N 298 MET HE2 H N N 299 MET HE3 H N N 300 MET HXT H N N 301 PHE N N N N 302 PHE CA C N S 303 PHE C C N N 304 PHE O O N N 305 PHE CB C N N 306 PHE CG C Y N 307 PHE CD1 C Y N 308 PHE CD2 C Y N 309 PHE CE1 C Y N 310 PHE CE2 C Y N 311 PHE CZ C Y N 312 PHE OXT O N N 313 PHE H H N N 314 PHE H2 H N N 315 PHE HA H N N 316 PHE HB2 H N N 317 PHE HB3 H N N 318 PHE HD1 H N N 319 PHE HD2 H N N 320 PHE HE1 H N N 321 PHE HE2 H N N 322 PHE HZ H N N 323 PHE HXT H N N 324 PRO N N N N 325 PRO CA C N S 326 PRO C C N N 327 PRO O O N N 328 PRO CB C N N 329 PRO CG C N N 330 PRO CD C N N 331 PRO OXT O N N 332 PRO H H N N 333 PRO HA H N N 334 PRO HB2 H N N 335 PRO HB3 H N N 336 PRO HG2 H N N 337 PRO HG3 H N N 338 PRO HD2 H N N 339 PRO HD3 H N N 340 PRO HXT H N N 341 SER N N N N 342 SER CA C N S 343 SER C C N N 344 SER O O N N 345 SER CB C N N 346 SER OG O N N 347 SER OXT O N N 348 SER H H N N 349 SER H2 H N N 350 SER HA H N N 351 SER HB2 H N N 352 SER HB3 H N N 353 SER HG H N N 354 SER HXT H N N 355 THR N N N N 356 THR CA C N S 357 THR C C N N 358 THR O O N N 359 THR CB C N R 360 THR OG1 O N N 361 THR CG2 C N N 362 THR OXT O N N 363 THR H H N N 364 THR H2 H N N 365 THR HA H N N 366 THR HB H N N 367 THR HG1 H N N 368 THR HG21 H N N 369 THR HG22 H N N 370 THR HG23 H N N 371 THR HXT H N N 372 TRP N N N N 373 TRP CA C N S 374 TRP C C N N 375 TRP O O N N 376 TRP CB C N N 377 TRP CG C Y N 378 TRP CD1 C Y N 379 TRP CD2 C Y N 380 TRP NE1 N Y N 381 TRP CE2 C Y N 382 TRP CE3 C Y N 383 TRP CZ2 C Y N 384 TRP CZ3 C Y N 385 TRP CH2 C Y N 386 TRP OXT O N N 387 TRP H H N N 388 TRP H2 H N N 389 TRP HA H N N 390 TRP HB2 H N N 391 TRP HB3 H N N 392 TRP HD1 H N N 393 TRP HE1 H N N 394 TRP HE3 H N N 395 TRP HZ2 H N N 396 TRP HZ3 H N N 397 TRP HH2 H N N 398 TRP HXT H N N 399 TYR N N N N 400 TYR CA C N S 401 TYR C C N N 402 TYR O O N N 403 TYR CB C N N 404 TYR CG C Y N 405 TYR CD1 C Y N 406 TYR CD2 C Y N 407 TYR CE1 C Y N 408 TYR CE2 C Y N 409 TYR CZ C Y N 410 TYR OH O N N 411 TYR OXT O N N 412 TYR H H N N 413 TYR H2 H N N 414 TYR HA H N N 415 TYR HB2 H N N 416 TYR HB3 H N N 417 TYR HD1 H N N 418 TYR HD2 H N N 419 TYR HE1 H N N 420 TYR HE2 H N N 421 TYR HH H N N 422 TYR HXT H N N 423 VAL N N N N 424 VAL CA C N S 425 VAL C C N N 426 VAL O O N N 427 VAL CB C N N 428 VAL CG1 C N N 429 VAL CG2 C N N 430 VAL OXT O N N 431 VAL H H N N 432 VAL H2 H N N 433 VAL HA H N N 434 VAL HB H N N 435 VAL HG11 H N N 436 VAL HG12 H N N 437 VAL HG13 H N N 438 VAL HG21 H N N 439 VAL HG22 H N N 440 VAL HG23 H N N 441 VAL HXT H N N 442 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FLC CAC CA sing N N 83 FLC CAC OA1 doub N N 84 FLC CAC OA2 sing N N 85 FLC CA CB sing N N 86 FLC CA HA1 sing N N 87 FLC CA HA2 sing N N 88 FLC CB CBC sing N N 89 FLC CB CG sing N N 90 FLC CB OHB sing N N 91 FLC CBC OB1 doub N N 92 FLC CBC OB2 sing N N 93 FLC CG CGC sing N N 94 FLC CG HG1 sing N N 95 FLC CG HG2 sing N N 96 FLC CGC OG1 doub N N 97 FLC CGC OG2 sing N N 98 FLC OHB HOB sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 HIS N CA sing N N 146 HIS N H sing N N 147 HIS N H2 sing N N 148 HIS CA C sing N N 149 HIS CA CB sing N N 150 HIS CA HA sing N N 151 HIS C O doub N N 152 HIS C OXT sing N N 153 HIS CB CG sing N N 154 HIS CB HB2 sing N N 155 HIS CB HB3 sing N N 156 HIS CG ND1 sing Y N 157 HIS CG CD2 doub Y N 158 HIS ND1 CE1 doub Y N 159 HIS ND1 HD1 sing N N 160 HIS CD2 NE2 sing Y N 161 HIS CD2 HD2 sing N N 162 HIS CE1 NE2 sing Y N 163 HIS CE1 HE1 sing N N 164 HIS NE2 HE2 sing N N 165 HIS OXT HXT sing N N 166 HOH O H1 sing N N 167 HOH O H2 sing N N 168 ILE N CA sing N N 169 ILE N H sing N N 170 ILE N H2 sing N N 171 ILE CA C sing N N 172 ILE CA CB sing N N 173 ILE CA HA sing N N 174 ILE C O doub N N 175 ILE C OXT sing N N 176 ILE CB CG1 sing N N 177 ILE CB CG2 sing N N 178 ILE CB HB sing N N 179 ILE CG1 CD1 sing N N 180 ILE CG1 HG12 sing N N 181 ILE CG1 HG13 sing N N 182 ILE CG2 HG21 sing N N 183 ILE CG2 HG22 sing N N 184 ILE CG2 HG23 sing N N 185 ILE CD1 HD11 sing N N 186 ILE CD1 HD12 sing N N 187 ILE CD1 HD13 sing N N 188 ILE OXT HXT sing N N 189 LEU N CA sing N N 190 LEU N H sing N N 191 LEU N H2 sing N N 192 LEU CA C sing N N 193 LEU CA CB sing N N 194 LEU CA HA sing N N 195 LEU C O doub N N 196 LEU C OXT sing N N 197 LEU CB CG sing N N 198 LEU CB HB2 sing N N 199 LEU CB HB3 sing N N 200 LEU CG CD1 sing N N 201 LEU CG CD2 sing N N 202 LEU CG HG sing N N 203 LEU CD1 HD11 sing N N 204 LEU CD1 HD12 sing N N 205 LEU CD1 HD13 sing N N 206 LEU CD2 HD21 sing N N 207 LEU CD2 HD22 sing N N 208 LEU CD2 HD23 sing N N 209 LEU OXT HXT sing N N 210 LYS N CA sing N N 211 LYS N H sing N N 212 LYS N H2 sing N N 213 LYS CA C sing N N 214 LYS CA CB sing N N 215 LYS CA HA sing N N 216 LYS C O doub N N 217 LYS C OXT sing N N 218 LYS CB CG sing N N 219 LYS CB HB2 sing N N 220 LYS CB HB3 sing N N 221 LYS CG CD sing N N 222 LYS CG HG2 sing N N 223 LYS CG HG3 sing N N 224 LYS CD CE sing N N 225 LYS CD HD2 sing N N 226 LYS CD HD3 sing N N 227 LYS CE NZ sing N N 228 LYS CE HE2 sing N N 229 LYS CE HE3 sing N N 230 LYS NZ HZ1 sing N N 231 LYS NZ HZ2 sing N N 232 LYS NZ HZ3 sing N N 233 LYS OXT HXT sing N N 234 M19 C05 O04 sing N N 235 M19 O04 C03 sing N N 236 M19 C03 C06 doub Y N 237 M19 C03 C02 sing Y N 238 M19 O01 C02 sing N N 239 M19 C06 C07 sing Y N 240 M19 C02 C23 doub Y N 241 M19 C07 N08 doub Y N 242 M19 C07 C22 sing Y N 243 M19 C23 C22 sing Y N 244 M19 N08 C09 sing Y N 245 M19 C22 C11 doub Y N 246 M19 C09 N10 doub Y N 247 M19 C11 N10 sing Y N 248 M19 C11 N12 sing N N 249 M19 N12 C13 sing N N 250 M19 C13 C14 doub Y N 251 M19 C13 C20 sing Y N 252 M19 O21 C20 sing N N 253 M19 C14 C15 sing Y N 254 M19 C20 C19 doub Y N 255 M19 C15 CL16 sing N N 256 M19 C15 C17 doub Y N 257 M19 C19 C17 sing Y N 258 M19 C17 F18 sing N N 259 M19 C14 H1 sing N N 260 M19 C05 H2 sing N N 261 M19 C05 H3 sing N N 262 M19 C05 H4 sing N N 263 M19 C06 H5 sing N N 264 M19 C09 H6 sing N N 265 M19 C19 H7 sing N N 266 M19 C23 H8 sing N N 267 M19 N12 H9 sing N N 268 M19 O01 H10 sing N N 269 M19 O21 H11 sing N N 270 MET N CA sing N N 271 MET N H sing N N 272 MET N H2 sing N N 273 MET CA C sing N N 274 MET CA CB sing N N 275 MET CA HA sing N N 276 MET C O doub N N 277 MET C OXT sing N N 278 MET CB CG sing N N 279 MET CB HB2 sing N N 280 MET CB HB3 sing N N 281 MET CG SD sing N N 282 MET CG HG2 sing N N 283 MET CG HG3 sing N N 284 MET SD CE sing N N 285 MET CE HE1 sing N N 286 MET CE HE2 sing N N 287 MET CE HE3 sing N N 288 MET OXT HXT sing N N 289 PHE N CA sing N N 290 PHE N H sing N N 291 PHE N H2 sing N N 292 PHE CA C sing N N 293 PHE CA CB sing N N 294 PHE CA HA sing N N 295 PHE C O doub N N 296 PHE C OXT sing N N 297 PHE CB CG sing N N 298 PHE CB HB2 sing N N 299 PHE CB HB3 sing N N 300 PHE CG CD1 doub Y N 301 PHE CG CD2 sing Y N 302 PHE CD1 CE1 sing Y N 303 PHE CD1 HD1 sing N N 304 PHE CD2 CE2 doub Y N 305 PHE CD2 HD2 sing N N 306 PHE CE1 CZ doub Y N 307 PHE CE1 HE1 sing N N 308 PHE CE2 CZ sing Y N 309 PHE CE2 HE2 sing N N 310 PHE CZ HZ sing N N 311 PHE OXT HXT sing N N 312 PRO N CA sing N N 313 PRO N CD sing N N 314 PRO N H sing N N 315 PRO CA C sing N N 316 PRO CA CB sing N N 317 PRO CA HA sing N N 318 PRO C O doub N N 319 PRO C OXT sing N N 320 PRO CB CG sing N N 321 PRO CB HB2 sing N N 322 PRO CB HB3 sing N N 323 PRO CG CD sing N N 324 PRO CG HG2 sing N N 325 PRO CG HG3 sing N N 326 PRO CD HD2 sing N N 327 PRO CD HD3 sing N N 328 PRO OXT HXT sing N N 329 SER N CA sing N N 330 SER N H sing N N 331 SER N H2 sing N N 332 SER CA C sing N N 333 SER CA CB sing N N 334 SER CA HA sing N N 335 SER C O doub N N 336 SER C OXT sing N N 337 SER CB OG sing N N 338 SER CB HB2 sing N N 339 SER CB HB3 sing N N 340 SER OG HG sing N N 341 SER OXT HXT sing N N 342 THR N CA sing N N 343 THR N H sing N N 344 THR N H2 sing N N 345 THR CA C sing N N 346 THR CA CB sing N N 347 THR CA HA sing N N 348 THR C O doub N N 349 THR C OXT sing N N 350 THR CB OG1 sing N N 351 THR CB CG2 sing N N 352 THR CB HB sing N N 353 THR OG1 HG1 sing N N 354 THR CG2 HG21 sing N N 355 THR CG2 HG22 sing N N 356 THR CG2 HG23 sing N N 357 THR OXT HXT sing N N 358 TRP N CA sing N N 359 TRP N H sing N N 360 TRP N H2 sing N N 361 TRP CA C sing N N 362 TRP CA CB sing N N 363 TRP CA HA sing N N 364 TRP C O doub N N 365 TRP C OXT sing N N 366 TRP CB CG sing N N 367 TRP CB HB2 sing N N 368 TRP CB HB3 sing N N 369 TRP CG CD1 doub Y N 370 TRP CG CD2 sing Y N 371 TRP CD1 NE1 sing Y N 372 TRP CD1 HD1 sing N N 373 TRP CD2 CE2 doub Y N 374 TRP CD2 CE3 sing Y N 375 TRP NE1 CE2 sing Y N 376 TRP NE1 HE1 sing N N 377 TRP CE2 CZ2 sing Y N 378 TRP CE3 CZ3 doub Y N 379 TRP CE3 HE3 sing N N 380 TRP CZ2 CH2 doub Y N 381 TRP CZ2 HZ2 sing N N 382 TRP CZ3 CH2 sing Y N 383 TRP CZ3 HZ3 sing N N 384 TRP CH2 HH2 sing N N 385 TRP OXT HXT sing N N 386 TYR N CA sing N N 387 TYR N H sing N N 388 TYR N H2 sing N N 389 TYR CA C sing N N 390 TYR CA CB sing N N 391 TYR CA HA sing N N 392 TYR C O doub N N 393 TYR C OXT sing N N 394 TYR CB CG sing N N 395 TYR CB HB2 sing N N 396 TYR CB HB3 sing N N 397 TYR CG CD1 doub Y N 398 TYR CG CD2 sing Y N 399 TYR CD1 CE1 sing Y N 400 TYR CD1 HD1 sing N N 401 TYR CD2 CE2 doub Y N 402 TYR CD2 HD2 sing N N 403 TYR CE1 CZ doub Y N 404 TYR CE1 HE1 sing N N 405 TYR CE2 CZ sing Y N 406 TYR CE2 HE2 sing N N 407 TYR CZ OH sing N N 408 TYR OH HH sing N N 409 TYR OXT HXT sing N N 410 VAL N CA sing N N 411 VAL N H sing N N 412 VAL N H2 sing N N 413 VAL CA C sing N N 414 VAL CA CB sing N N 415 VAL CA HA sing N N 416 VAL C O doub N N 417 VAL C OXT sing N N 418 VAL CB CG1 sing N N 419 VAL CB CG2 sing N N 420 VAL CB HB sing N N 421 VAL CG1 HG11 sing N N 422 VAL CG1 HG12 sing N N 423 VAL CG1 HG13 sing N N 424 VAL CG2 HG21 sing N N 425 VAL CG2 HG22 sing N N 426 VAL CG2 HG23 sing N N 427 VAL OXT HXT sing N N 428 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' 5F32CA247198-02 1 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' 5R01CA116020-15 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id M19 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id M19 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-(5-chloro-4-fluoro-2-hydroxyanilino)-7-methoxyquinazolin-6-ol' M19 3 'CITRATE ANION' FLC 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6VHP _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #