data_7UG2 # _entry.id 7UG2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UG2 pdb_00007ug2 10.2210/pdb7ug2/pdb WWPDB D_1000264106 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UG2 _pdbx_database_status.recvd_initial_deposition_date 2022-03-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lou, X.H.' 1 ? 'Ma, B.B.' 2 ? 'Zhuang, Y.' 3 ? 'Li, X.C.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Comput Struct Biotechnol J' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2001-0370 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 20 _citation.language ? _citation.page_first 4921 _citation.page_last 4929 _citation.title 'Structural studies of the coiled-coil domain of TRIM75 reveal a tetramer architecture facilitating its E3 ligase complex.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.csbj.2022.08.069 _citation.pdbx_database_id_PubMed 36147661 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lou, X.' 1 ? primary 'Ma, B.' 2 ? primary 'Zhuang, Y.' 3 ? primary 'Xiao, X.' 4 ? primary 'Minze, L.J.' 5 ? primary 'Xing, J.' 6 ? primary 'Zhang, Z.' 7 ? primary 'Li, X.C.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7UG2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.070 _cell.length_a_esd ? _cell.length_b 43.070 _cell.length_b_esd ? _cell.length_c 134.320 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UG2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tripartite motif-containing protein 75' 6817.631 1 ? ? ? ? 2 non-polymer syn 'ACETYL GROUP' 44.053 2 ? ? ? ? 3 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 1 ? ? ? ? 4 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPGGVTLREQAEAQRSQLTSECEKLMRFLDQEERAAFSRLEDEEMRLEKRLLDNIAALE _entity_poly.pdbx_seq_one_letter_code_can GPGGVTLREQAEAQRSQLTSECEKLMRFLDQEERAAFSRLEDEEMRLEKRLLDNIAALE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 GLY n 1 5 VAL n 1 6 THR n 1 7 LEU n 1 8 ARG n 1 9 GLU n 1 10 GLN n 1 11 ALA n 1 12 GLU n 1 13 ALA n 1 14 GLN n 1 15 ARG n 1 16 SER n 1 17 GLN n 1 18 LEU n 1 19 THR n 1 20 SER n 1 21 GLU n 1 22 CYS n 1 23 GLU n 1 24 LYS n 1 25 LEU n 1 26 MET n 1 27 ARG n 1 28 PHE n 1 29 LEU n 1 30 ASP n 1 31 GLN n 1 32 GLU n 1 33 GLU n 1 34 ARG n 1 35 ALA n 1 36 ALA n 1 37 PHE n 1 38 SER n 1 39 ARG n 1 40 LEU n 1 41 GLU n 1 42 ASP n 1 43 GLU n 1 44 GLU n 1 45 MET n 1 46 ARG n 1 47 LEU n 1 48 GLU n 1 49 LYS n 1 50 ARG n 1 51 LEU n 1 52 LEU n 1 53 ASP n 1 54 ASN n 1 55 ILE n 1 56 ALA n 1 57 ALA n 1 58 LEU n 1 59 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 59 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Trim75, Gm794' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRI75_MOUSE _struct_ref.pdbx_db_accession Q3UWZ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VTLREQAEAQRSQLTSECEKLMRFLDQEERAAFSRLEDEEMRLEKRLLDNIAALE _struct_ref.pdbx_align_begin 168 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UG2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q3UWZ0 _struct_ref_seq.db_align_beg 168 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 222 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 168 _struct_ref_seq.pdbx_auth_seq_align_end 222 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7UG2 GLY A 1 ? UNP Q3UWZ0 ? ? 'expression tag' 164 1 1 7UG2 PRO A 2 ? UNP Q3UWZ0 ? ? 'expression tag' 165 2 1 7UG2 GLY A 3 ? UNP Q3UWZ0 ? ? 'expression tag' 166 3 1 7UG2 GLY A 4 ? UNP Q3UWZ0 ? ? 'expression tag' 167 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UG2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Acetate pH 4.6 20% Isopropanol 0.2 M Calcium chloride ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-02-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7UG2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.05 _reflns.d_resolution_low 8.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4039 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs 0.042 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 594 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.248 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.913 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.407 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 1.407 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -2.814 _refine.B_iso_max ? _refine.B_iso_mean 53.022 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.934 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UG2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.052 _refine.ls_d_res_low 7.985 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4038 _refine.ls_number_reflns_R_free 317 _refine.ls_number_reflns_R_work 3721 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.500 _refine.ls_percent_reflns_R_free 7.850 _refine.ls_R_factor_all 0.215 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2562 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2114 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.274 _refine.ls_wR_factor_R_work 0.220 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7SI8 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selectoin' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.243 _refine.pdbx_overall_ESU_R_Free 0.201 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work 0.9290 _refine.pdbx_average_fsc_free 0.9037 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.052 _refine_hist.d_res_low 7.985 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 440 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 410 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 471 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.806 1.647 631 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 3.500 5.000 60 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 28.619 22.286 35 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.781 15.000 96 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.087 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.102 0.200 58 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 373 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.260 0.200 203 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.280 0.200 294 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.258 0.200 17 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.328 0.200 71 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 7 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 5.364 4.887 227 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 7.063 7.237 287 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.683 5.590 243 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 11.021 8.083 340 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 14.928 91.207 2027 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.052 2.102 . . 31 245 98.9247 . . . 0.224 . 0.243 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.102 2.155 . . 21 257 99.2857 . . . 0.357 . 0.230 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.155 2.213 . . 24 242 99.2537 . . . 0.200 . 0.216 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.213 2.276 . . 20 247 98.5240 . . . 0.306 . 0.219 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.276 2.344 . . 14 240 99.2188 . . . 0.140 . 0.239 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.344 2.419 . . 16 230 97.2332 . . . 0.289 . 0.218 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.419 2.501 . . 17 211 95.3975 . . . 0.423 . 0.237 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.501 2.593 . . 17 205 94.0678 . . . 0.389 . 0.228 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.593 2.696 . . 24 206 99.1379 . . . 0.314 . 0.231 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.696 2.811 . . 13 203 98.1818 . . . 0.359 . 0.219 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.811 2.943 . . 22 189 98.5981 . . . 0.306 . 0.225 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.943 3.096 . . 11 191 97.5845 . . . 0.365 . 0.228 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.096 3.275 . . 20 163 96.8254 . . . 0.294 . 0.241 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.275 3.489 . . 14 163 95.6757 . . . 0.233 . 0.211 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.489 3.751 . . 9 144 90.5325 . . . 0.222 . 0.164 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.751 4.083 . . 9 146 93.3735 . . . 0.163 . 0.161 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.083 4.522 . . 12 127 93.2886 . . . 0.157 . 0.147 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.522 5.143 . . 7 125 94.2857 . . . 0.209 . 0.173 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.143 6.118 . . 8 108 93.5484 . . . 0.189 . 0.259 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.118 7.985 . . 8 79 87.0000 . . . 0.437 . 0.421 . . . . . . . . . . . # _struct.entry_id 7UG2 _struct.title 'Crystal structure of the coiled-coil domain of TRIM75' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UG2 _struct_keywords.text 'TRIM75, tetramerization, E3 ubiquitin ligase, Ubiquitination, coiled-coil, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 11 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 58 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 174 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 221 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 48 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 22 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 22 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 185 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 185 _struct_conn.ptnr2_symmetry 10_665 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.097 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7UG2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023218 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023218 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007445 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 164 ? ? ? A . n A 1 2 PRO 2 165 ? ? ? A . n A 1 3 GLY 3 166 ? ? ? A . n A 1 4 GLY 4 167 ? ? ? A . n A 1 5 VAL 5 168 ? ? ? A . n A 1 6 THR 6 169 ? ? ? A . n A 1 7 LEU 7 170 ? ? ? A . n A 1 8 ARG 8 171 ? ? ? A . n A 1 9 GLU 9 172 ? ? ? A . n A 1 10 GLN 10 173 ? ? ? A . n A 1 11 ALA 11 174 174 ALA ALA A . n A 1 12 GLU 12 175 175 GLU GLU A . n A 1 13 ALA 13 176 176 ALA ALA A . n A 1 14 GLN 14 177 177 GLN GLN A . n A 1 15 ARG 15 178 178 ARG ARG A . n A 1 16 SER 16 179 179 SER SER A . n A 1 17 GLN 17 180 180 GLN GLN A . n A 1 18 LEU 18 181 181 LEU LEU A . n A 1 19 THR 19 182 182 THR THR A . n A 1 20 SER 20 183 183 SER SER A . n A 1 21 GLU 21 184 184 GLU GLU A . n A 1 22 CYS 22 185 185 CYS CYS A . n A 1 23 GLU 23 186 186 GLU GLU A . n A 1 24 LYS 24 187 187 LYS LYS A . n A 1 25 LEU 25 188 188 LEU LEU A . n A 1 26 MET 26 189 189 MET MET A . n A 1 27 ARG 27 190 190 ARG ARG A . n A 1 28 PHE 28 191 191 PHE PHE A . n A 1 29 LEU 29 192 192 LEU LEU A . n A 1 30 ASP 30 193 193 ASP ASP A . n A 1 31 GLN 31 194 194 GLN GLN A . n A 1 32 GLU 32 195 195 GLU GLU A . n A 1 33 GLU 33 196 196 GLU GLU A . n A 1 34 ARG 34 197 197 ARG ARG A . n A 1 35 ALA 35 198 198 ALA ALA A . n A 1 36 ALA 36 199 199 ALA ALA A . n A 1 37 PHE 37 200 200 PHE PHE A . n A 1 38 SER 38 201 201 SER SER A . n A 1 39 ARG 39 202 202 ARG ARG A . n A 1 40 LEU 40 203 203 LEU LEU A . n A 1 41 GLU 41 204 204 GLU GLU A . n A 1 42 ASP 42 205 205 ASP ASP A . n A 1 43 GLU 43 206 206 GLU GLU A . n A 1 44 GLU 44 207 207 GLU GLU A . n A 1 45 MET 45 208 208 MET MET A . n A 1 46 ARG 46 209 209 ARG ARG A . n A 1 47 LEU 47 210 210 LEU LEU A . n A 1 48 GLU 48 211 211 GLU GLU A . n A 1 49 LYS 49 212 212 LYS LYS A . n A 1 50 ARG 50 213 213 ARG ARG A . n A 1 51 LEU 51 214 214 LEU LEU A . n A 1 52 LEU 52 215 215 LEU LEU A . n A 1 53 ASP 53 216 216 ASP ASP A . n A 1 54 ASN 54 217 217 ASN ASN A . n A 1 55 ILE 55 218 218 ILE ILE A . n A 1 56 ALA 56 219 219 ALA ALA A . n A 1 57 ALA 57 220 220 ALA ALA A . n A 1 58 LEU 58 221 221 LEU LEU A . n A 1 59 GLU 59 222 222 GLU GLU A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email xcli@houstonmethodist.org _pdbx_contact_author.name_first Xianchang _pdbx_contact_author.name_last Li _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5981-2762 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACE 1 301 303 ACE ACE A . C 2 ACE 1 302 304 ACE ACE A . D 3 IPA 1 303 401 IPA IPA A . E 4 HOH 1 401 529 HOH HOH A . E 4 HOH 2 402 501 HOH HOH A . E 4 HOH 3 403 510 HOH HOH A . E 4 HOH 4 404 520 HOH HOH A . E 4 HOH 5 405 523 HOH HOH A . E 4 HOH 6 406 517 HOH HOH A . E 4 HOH 7 407 513 HOH HOH A . E 4 HOH 8 408 504 HOH HOH A . E 4 HOH 9 409 516 HOH HOH A . E 4 HOH 10 410 502 HOH HOH A . E 4 HOH 11 411 515 HOH HOH A . E 4 HOH 12 412 503 HOH HOH A . E 4 HOH 13 413 519 HOH HOH A . E 4 HOH 14 414 522 HOH HOH A . E 4 HOH 15 415 511 HOH HOH A . E 4 HOH 16 416 512 HOH HOH A . E 4 HOH 17 417 509 HOH HOH A . E 4 HOH 18 418 526 HOH HOH A . E 4 HOH 19 419 508 HOH HOH A . E 4 HOH 20 420 518 HOH HOH A . E 4 HOH 21 421 507 HOH HOH A . E 4 HOH 22 422 524 HOH HOH A . E 4 HOH 23 423 505 HOH HOH A . E 4 HOH 24 424 506 HOH HOH A . E 4 HOH 25 425 514 HOH HOH A . E 4 HOH 26 426 527 HOH HOH A . E 4 HOH 27 427 528 HOH HOH A . E 4 HOH 28 428 521 HOH HOH A . E 4 HOH 29 429 525 HOH HOH A . E 4 HOH 30 430 530 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9800 ? 1 MORE -40 ? 1 'SSA (A^2)' 11370 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_666 -y+1,-x+1,-z+1 0.0000000000 -1.0000000000 0.0000000000 43.0700000000 -1.0000000000 0.0000000000 0.0000000000 43.0700000000 0.0000000000 0.0000000000 -1.0000000000 134.3200000000 3 'crystal symmetry operation' 10_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 43.0700000000 0.0000000000 -1.0000000000 0.0000000000 43.0700000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 134.3200000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ACE _pdbx_struct_special_symmetry.auth_seq_id 302 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id ACE _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-15 2 'Structure model' 1 1 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7UG2 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 175 ? CG ? A GLU 12 CG 2 1 Y 1 A GLU 175 ? CD ? A GLU 12 CD 3 1 Y 1 A GLU 175 ? OE1 ? A GLU 12 OE1 4 1 Y 1 A GLU 175 ? OE2 ? A GLU 12 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 164 ? A GLY 1 2 1 Y 1 A PRO 165 ? A PRO 2 3 1 Y 1 A GLY 166 ? A GLY 3 4 1 Y 1 A GLY 167 ? A GLY 4 5 1 Y 1 A VAL 168 ? A VAL 5 6 1 Y 1 A THR 169 ? A THR 6 7 1 Y 1 A LEU 170 ? A LEU 7 8 1 Y 1 A ARG 171 ? A ARG 8 9 1 Y 1 A GLU 172 ? A GLU 9 10 1 Y 1 A GLN 173 ? A GLN 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 IPA C1 C N N 169 IPA C2 C N N 170 IPA C3 C N N 171 IPA O2 O N N 172 IPA H11 H N N 173 IPA H12 H N N 174 IPA H13 H N N 175 IPA H2 H N N 176 IPA H31 H N N 177 IPA H32 H N N 178 IPA H33 H N N 179 IPA HO2 H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HOH O H1 sing N N 135 HOH O H2 sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 IPA C1 C2 sing N N 158 IPA C1 H11 sing N N 159 IPA C1 H12 sing N N 160 IPA C1 H13 sing N N 161 IPA C2 C3 sing N N 162 IPA C2 O2 sing N N 163 IPA C2 H2 sing N N 164 IPA C3 H31 sing N N 165 IPA C3 H32 sing N N 166 IPA C3 H33 sing N N 167 IPA O2 HO2 sing N N 168 LEU N CA sing N N 169 LEU N H sing N N 170 LEU N H2 sing N N 171 LEU CA C sing N N 172 LEU CA CB sing N N 173 LEU CA HA sing N N 174 LEU C O doub N N 175 LEU C OXT sing N N 176 LEU CB CG sing N N 177 LEU CB HB2 sing N N 178 LEU CB HB3 sing N N 179 LEU CG CD1 sing N N 180 LEU CG CD2 sing N N 181 LEU CG HG sing N N 182 LEU CD1 HD11 sing N N 183 LEU CD1 HD12 sing N N 184 LEU CD1 HD13 sing N N 185 LEU CD2 HD21 sing N N 186 LEU CD2 HD22 sing N N 187 LEU CD2 HD23 sing N N 188 LEU OXT HXT sing N N 189 LYS N CA sing N N 190 LYS N H sing N N 191 LYS N H2 sing N N 192 LYS CA C sing N N 193 LYS CA CB sing N N 194 LYS CA HA sing N N 195 LYS C O doub N N 196 LYS C OXT sing N N 197 LYS CB CG sing N N 198 LYS CB HB2 sing N N 199 LYS CB HB3 sing N N 200 LYS CG CD sing N N 201 LYS CG HG2 sing N N 202 LYS CG HG3 sing N N 203 LYS CD CE sing N N 204 LYS CD HD2 sing N N 205 LYS CD HD3 sing N N 206 LYS CE NZ sing N N 207 LYS CE HE2 sing N N 208 LYS CE HE3 sing N N 209 LYS NZ HZ1 sing N N 210 LYS NZ HZ2 sing N N 211 LYS NZ HZ3 sing N N 212 LYS OXT HXT sing N N 213 MET N CA sing N N 214 MET N H sing N N 215 MET N H2 sing N N 216 MET CA C sing N N 217 MET CA CB sing N N 218 MET CA HA sing N N 219 MET C O doub N N 220 MET C OXT sing N N 221 MET CB CG sing N N 222 MET CB HB2 sing N N 223 MET CB HB3 sing N N 224 MET CG SD sing N N 225 MET CG HG2 sing N N 226 MET CG HG3 sing N N 227 MET SD CE sing N N 228 MET CE HE1 sing N N 229 MET CE HE2 sing N N 230 MET CE HE3 sing N N 231 MET OXT HXT sing N N 232 PHE N CA sing N N 233 PHE N H sing N N 234 PHE N H2 sing N N 235 PHE CA C sing N N 236 PHE CA CB sing N N 237 PHE CA HA sing N N 238 PHE C O doub N N 239 PHE C OXT sing N N 240 PHE CB CG sing N N 241 PHE CB HB2 sing N N 242 PHE CB HB3 sing N N 243 PHE CG CD1 doub Y N 244 PHE CG CD2 sing Y N 245 PHE CD1 CE1 sing Y N 246 PHE CD1 HD1 sing N N 247 PHE CD2 CE2 doub Y N 248 PHE CD2 HD2 sing N N 249 PHE CE1 CZ doub Y N 250 PHE CE1 HE1 sing N N 251 PHE CE2 CZ sing Y N 252 PHE CE2 HE2 sing N N 253 PHE CZ HZ sing N N 254 PHE OXT HXT sing N N 255 PRO N CA sing N N 256 PRO N CD sing N N 257 PRO N H sing N N 258 PRO CA C sing N N 259 PRO CA CB sing N N 260 PRO CA HA sing N N 261 PRO C O doub N N 262 PRO C OXT sing N N 263 PRO CB CG sing N N 264 PRO CB HB2 sing N N 265 PRO CB HB3 sing N N 266 PRO CG CD sing N N 267 PRO CG HG2 sing N N 268 PRO CG HG3 sing N N 269 PRO CD HD2 sing N N 270 PRO CD HD3 sing N N 271 PRO OXT HXT sing N N 272 SER N CA sing N N 273 SER N H sing N N 274 SER N H2 sing N N 275 SER CA C sing N N 276 SER CA CB sing N N 277 SER CA HA sing N N 278 SER C O doub N N 279 SER C OXT sing N N 280 SER CB OG sing N N 281 SER CB HB2 sing N N 282 SER CB HB3 sing N N 283 SER OG HG sing N N 284 SER OXT HXT sing N N 285 THR N CA sing N N 286 THR N H sing N N 287 THR N H2 sing N N 288 THR CA C sing N N 289 THR CA CB sing N N 290 THR CA HA sing N N 291 THR C O doub N N 292 THR C OXT sing N N 293 THR CB OG1 sing N N 294 THR CB CG2 sing N N 295 THR CB HB sing N N 296 THR OG1 HG1 sing N N 297 THR CG2 HG21 sing N N 298 THR CG2 HG22 sing N N 299 THR CG2 HG23 sing N N 300 THR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'R01 AI080779' 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'R56 AI148215' 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETYL GROUP' ACE 3 'ISOPROPYL ALCOHOL' IPA 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7SI8 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details 'SEC-MALS confirmed the tetrameric state of the coiled-coil domain in solution.' #