data_7UP6 # _entry.id 7UP6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UP6 pdb_00007up6 10.2210/pdb7up6/pdb WWPDB D_1000264419 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-31 2 'Structure model' 1 1 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UP6 _pdbx_database_status.recvd_initial_deposition_date 2022-04-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email adrian.hall@ucb.com _pdbx_contact_author.name_first Adrian _pdbx_contact_author.name_last Hall _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7869-6835 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yano, J.K.' 1 ? 'Abendroth, J.' 2 ? 'Hall, A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 1099 _citation.page_last 1108 _citation.title 'Discovery and Characterization of a Novel Series of Chloropyrimidines as Covalent Inhibitors of the Kinase MSK1.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.2c00134 _citation.pdbx_database_id_PubMed 35859861 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hall, A.' 1 0000-0001-7869-6835 primary 'Abendroth, J.' 2 ? primary 'Bolejack, M.J.' 3 0000-0002-0911-2338 primary 'Ceska, T.' 4 ? primary ;Dell'Aiera, S. ; 5 ? primary 'Ellis, V.' 6 ? primary 'Fox 3rd, D.' 7 ? primary 'Francois, C.' 8 ? primary 'Muruthi, M.M.' 9 ? primary 'Prevel, C.' 10 ? primary 'Poullennec, K.' 11 ? primary 'Romanov, S.' 12 ? primary 'Valade, A.' 13 ? primary 'Vanbellinghen, A.' 14 ? primary 'Yano, J.' 15 ? primary 'Geraerts, M.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribosomal protein S6 kinase alpha-5' 34668.809 1 2.7.11.1 ? 'Msk1 CTD 414-738 Delta Pro573-Pro596 GSG' ? 2 non-polymer syn '(E)-3-(3-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)phenyl)-2-cyanoacrylamide bound form' 291.307 1 ? ? ? ? 3 non-polymer syn 'OXAMIC ACID' 89.050 2 ? ? ? ? 4 water nat water 18.015 49 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;S6K-alpha-5,90 kDa ribosomal protein S6 kinase 5,Nuclear mitogen- and stress-activated protein kinase 1,RSK-like protein kinase,RSKL ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHDQL HTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKIIDFGFARLK PGSGNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDP NKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKA ; _entity_poly.pdbx_seq_one_letter_code_can ;GMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHDQL HTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKIIDFGFARLK PGSGNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDP NKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(E)-3-(3-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)phenyl)-2-cyanoacrylamide bound form' SUU 3 'OXAMIC ACID' OXM 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 LYS n 1 4 ASP n 1 5 SER n 1 6 PRO n 1 7 PHE n 1 8 TYR n 1 9 GLN n 1 10 HIS n 1 11 TYR n 1 12 ASP n 1 13 LEU n 1 14 ASP n 1 15 LEU n 1 16 LYS n 1 17 ASP n 1 18 LYS n 1 19 PRO n 1 20 LEU n 1 21 GLY n 1 22 GLU n 1 23 GLY n 1 24 SER n 1 25 PHE n 1 26 SER n 1 27 ILE n 1 28 CYS n 1 29 ARG n 1 30 LYS n 1 31 CYS n 1 32 VAL n 1 33 HIS n 1 34 LYS n 1 35 LYS n 1 36 SER n 1 37 ASN n 1 38 GLN n 1 39 ALA n 1 40 PHE n 1 41 ALA n 1 42 VAL n 1 43 LYS n 1 44 ILE n 1 45 ILE n 1 46 SER n 1 47 LYS n 1 48 ARG n 1 49 MET n 1 50 GLU n 1 51 ALA n 1 52 ASN n 1 53 THR n 1 54 GLN n 1 55 LYS n 1 56 GLU n 1 57 ILE n 1 58 THR n 1 59 ALA n 1 60 LEU n 1 61 LYS n 1 62 LEU n 1 63 CYS n 1 64 GLU n 1 65 GLY n 1 66 HIS n 1 67 PRO n 1 68 ASN n 1 69 ILE n 1 70 VAL n 1 71 LYS n 1 72 LEU n 1 73 HIS n 1 74 GLU n 1 75 VAL n 1 76 PHE n 1 77 HIS n 1 78 ASP n 1 79 GLN n 1 80 LEU n 1 81 HIS n 1 82 THR n 1 83 PHE n 1 84 LEU n 1 85 VAL n 1 86 MET n 1 87 GLU n 1 88 LEU n 1 89 LEU n 1 90 ASN n 1 91 GLY n 1 92 GLY n 1 93 GLU n 1 94 LEU n 1 95 PHE n 1 96 GLU n 1 97 ARG n 1 98 ILE n 1 99 LYS n 1 100 LYS n 1 101 LYS n 1 102 LYS n 1 103 HIS n 1 104 PHE n 1 105 SER n 1 106 GLU n 1 107 THR n 1 108 GLU n 1 109 ALA n 1 110 SER n 1 111 TYR n 1 112 ILE n 1 113 MET n 1 114 ARG n 1 115 LYS n 1 116 LEU n 1 117 VAL n 1 118 SER n 1 119 ALA n 1 120 VAL n 1 121 SER n 1 122 HIS n 1 123 MET n 1 124 HIS n 1 125 ASP n 1 126 VAL n 1 127 GLY n 1 128 VAL n 1 129 VAL n 1 130 HIS n 1 131 ARG n 1 132 ASP n 1 133 LEU n 1 134 LYS n 1 135 PRO n 1 136 GLU n 1 137 ASN n 1 138 LEU n 1 139 LEU n 1 140 PHE n 1 141 THR n 1 142 ASP n 1 143 GLU n 1 144 ASN n 1 145 ASP n 1 146 ASN n 1 147 LEU n 1 148 GLU n 1 149 ILE n 1 150 LYS n 1 151 ILE n 1 152 ILE n 1 153 ASP n 1 154 PHE n 1 155 GLY n 1 156 PHE n 1 157 ALA n 1 158 ARG n 1 159 LEU n 1 160 LYS n 1 161 PRO n 1 162 GLY n 1 163 SER n 1 164 GLY n 1 165 ASN n 1 166 GLY n 1 167 TYR n 1 168 ASP n 1 169 GLU n 1 170 SER n 1 171 CYS n 1 172 ASP n 1 173 LEU n 1 174 TRP n 1 175 SER n 1 176 LEU n 1 177 GLY n 1 178 VAL n 1 179 ILE n 1 180 LEU n 1 181 TYR n 1 182 THR n 1 183 MET n 1 184 LEU n 1 185 SER n 1 186 GLY n 1 187 GLN n 1 188 VAL n 1 189 PRO n 1 190 PHE n 1 191 GLN n 1 192 SER n 1 193 HIS n 1 194 ASP n 1 195 ARG n 1 196 SER n 1 197 LEU n 1 198 THR n 1 199 CYS n 1 200 THR n 1 201 SER n 1 202 ALA n 1 203 VAL n 1 204 GLU n 1 205 ILE n 1 206 MET n 1 207 LYS n 1 208 LYS n 1 209 ILE n 1 210 LYS n 1 211 LYS n 1 212 GLY n 1 213 ASP n 1 214 PHE n 1 215 SER n 1 216 PHE n 1 217 GLU n 1 218 GLY n 1 219 GLU n 1 220 ALA n 1 221 TRP n 1 222 LYS n 1 223 ASN n 1 224 VAL n 1 225 SER n 1 226 GLN n 1 227 GLU n 1 228 ALA n 1 229 LYS n 1 230 ASP n 1 231 LEU n 1 232 ILE n 1 233 GLN n 1 234 GLY n 1 235 LEU n 1 236 LEU n 1 237 THR n 1 238 VAL n 1 239 ASP n 1 240 PRO n 1 241 ASN n 1 242 LYS n 1 243 ARG n 1 244 LEU n 1 245 LYS n 1 246 MET n 1 247 SER n 1 248 GLY n 1 249 LEU n 1 250 ARG n 1 251 TYR n 1 252 ASN n 1 253 GLU n 1 254 TRP n 1 255 LEU n 1 256 GLN n 1 257 ASP n 1 258 GLY n 1 259 SER n 1 260 GLN n 1 261 LEU n 1 262 SER n 1 263 SER n 1 264 ASN n 1 265 PRO n 1 266 LEU n 1 267 MET n 1 268 THR n 1 269 PRO n 1 270 ASP n 1 271 ILE n 1 272 LEU n 1 273 GLY n 1 274 SER n 1 275 SER n 1 276 GLY n 1 277 ALA n 1 278 ALA n 1 279 VAL n 1 280 HIS n 1 281 THR n 1 282 CYS n 1 283 VAL n 1 284 LYS n 1 285 ALA n 1 286 THR n 1 287 PHE n 1 288 HIS n 1 289 ALA n 1 290 PHE n 1 291 ASN n 1 292 LYS n 1 293 TYR n 1 294 LYS n 1 295 ARG n 1 296 GLU n 1 297 GLY n 1 298 PHE n 1 299 CYS n 1 300 LEU n 1 301 GLN n 1 302 ASN n 1 303 VAL n 1 304 ASP n 1 305 LYS n 1 306 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 306 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RPS6KA5, MSK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OXM non-polymer . 'OXAMIC ACID' ? 'C2 H3 N O3' 89.050 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SUU non-polymer . '(E)-3-(3-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)phenyl)-2-cyanoacrylamide bound form' ? 'C16 H13 N5 O' 291.307 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 413 ? ? ? A . n A 1 2 MET 2 414 ? ? ? A . n A 1 3 LYS 3 415 ? ? ? A . n A 1 4 ASP 4 416 416 ASP ASP A . n A 1 5 SER 5 417 417 SER SER A . n A 1 6 PRO 6 418 418 PRO PRO A . n A 1 7 PHE 7 419 419 PHE PHE A . n A 1 8 TYR 8 420 420 TYR TYR A . n A 1 9 GLN 9 421 421 GLN GLN A . n A 1 10 HIS 10 422 422 HIS HIS A . n A 1 11 TYR 11 423 423 TYR TYR A . n A 1 12 ASP 12 424 424 ASP ASP A . n A 1 13 LEU 13 425 425 LEU LEU A . n A 1 14 ASP 14 426 426 ASP ASP A . n A 1 15 LEU 15 427 427 LEU LEU A . n A 1 16 LYS 16 428 428 LYS LYS A . n A 1 17 ASP 17 429 429 ASP ASP A . n A 1 18 LYS 18 430 430 LYS LYS A . n A 1 19 PRO 19 431 431 PRO PRO A . n A 1 20 LEU 20 432 432 LEU LEU A . n A 1 21 GLY 21 433 433 GLY GLY A . n A 1 22 GLU 22 434 434 GLU GLU A . n A 1 23 GLY 23 435 435 GLY GLY A . n A 1 24 SER 24 436 436 SER SER A . n A 1 25 PHE 25 437 437 PHE PHE A . n A 1 26 SER 26 438 438 SER SER A . n A 1 27 ILE 27 439 439 ILE ILE A . n A 1 28 CYS 28 440 440 CYS CYS A . n A 1 29 ARG 29 441 441 ARG ARG A . n A 1 30 LYS 30 442 442 LYS LYS A . n A 1 31 CYS 31 443 443 CYS CYS A . n A 1 32 VAL 32 444 444 VAL VAL A . n A 1 33 HIS 33 445 445 HIS HIS A . n A 1 34 LYS 34 446 446 LYS LYS A . n A 1 35 LYS 35 447 447 LYS LYS A . n A 1 36 SER 36 448 448 SER SER A . n A 1 37 ASN 37 449 449 ASN ASN A . n A 1 38 GLN 38 450 450 GLN GLN A . n A 1 39 ALA 39 451 451 ALA ALA A . n A 1 40 PHE 40 452 452 PHE PHE A . n A 1 41 ALA 41 453 453 ALA ALA A . n A 1 42 VAL 42 454 454 VAL VAL A . n A 1 43 LYS 43 455 455 LYS LYS A . n A 1 44 ILE 44 456 456 ILE ILE A . n A 1 45 ILE 45 457 457 ILE ILE A . n A 1 46 SER 46 458 458 SER SER A . n A 1 47 LYS 47 459 459 LYS LYS A . n A 1 48 ARG 48 460 460 ARG ARG A . n A 1 49 MET 49 461 461 MET MET A . n A 1 50 GLU 50 462 462 GLU GLU A . n A 1 51 ALA 51 463 463 ALA ALA A . n A 1 52 ASN 52 464 464 ASN ASN A . n A 1 53 THR 53 465 465 THR THR A . n A 1 54 GLN 54 466 466 GLN GLN A . n A 1 55 LYS 55 467 467 LYS LYS A . n A 1 56 GLU 56 468 468 GLU GLU A . n A 1 57 ILE 57 469 469 ILE ILE A . n A 1 58 THR 58 470 470 THR THR A . n A 1 59 ALA 59 471 471 ALA ALA A . n A 1 60 LEU 60 472 472 LEU LEU A . n A 1 61 LYS 61 473 473 LYS LYS A . n A 1 62 LEU 62 474 474 LEU LEU A . n A 1 63 CYS 63 475 475 CYS CYS A . n A 1 64 GLU 64 476 476 GLU GLU A . n A 1 65 GLY 65 477 477 GLY GLY A . n A 1 66 HIS 66 478 478 HIS HIS A . n A 1 67 PRO 67 479 479 PRO PRO A . n A 1 68 ASN 68 480 480 ASN ASN A . n A 1 69 ILE 69 481 481 ILE ILE A . n A 1 70 VAL 70 482 482 VAL VAL A . n A 1 71 LYS 71 483 483 LYS LYS A . n A 1 72 LEU 72 484 484 LEU LEU A . n A 1 73 HIS 73 485 485 HIS HIS A . n A 1 74 GLU 74 486 486 GLU GLU A . n A 1 75 VAL 75 487 487 VAL VAL A . n A 1 76 PHE 76 488 488 PHE PHE A . n A 1 77 HIS 77 489 489 HIS HIS A . n A 1 78 ASP 78 490 490 ASP ASP A . n A 1 79 GLN 79 491 491 GLN GLN A . n A 1 80 LEU 80 492 492 LEU LEU A . n A 1 81 HIS 81 493 493 HIS HIS A . n A 1 82 THR 82 494 494 THR THR A . n A 1 83 PHE 83 495 495 PHE PHE A . n A 1 84 LEU 84 496 496 LEU LEU A . n A 1 85 VAL 85 497 497 VAL VAL A . n A 1 86 MET 86 498 498 MET MET A . n A 1 87 GLU 87 499 499 GLU GLU A . n A 1 88 LEU 88 500 500 LEU LEU A . n A 1 89 LEU 89 501 501 LEU LEU A . n A 1 90 ASN 90 502 502 ASN ASN A . n A 1 91 GLY 91 503 503 GLY GLY A . n A 1 92 GLY 92 504 504 GLY GLY A . n A 1 93 GLU 93 505 505 GLU GLU A . n A 1 94 LEU 94 506 506 LEU LEU A . n A 1 95 PHE 95 507 507 PHE PHE A . n A 1 96 GLU 96 508 508 GLU GLU A . n A 1 97 ARG 97 509 509 ARG ARG A . n A 1 98 ILE 98 510 510 ILE ILE A . n A 1 99 LYS 99 511 511 LYS LYS A . n A 1 100 LYS 100 512 512 LYS LYS A . n A 1 101 LYS 101 513 513 LYS LYS A . n A 1 102 LYS 102 514 514 LYS LYS A . n A 1 103 HIS 103 515 515 HIS HIS A . n A 1 104 PHE 104 516 516 PHE PHE A . n A 1 105 SER 105 517 517 SER SER A . n A 1 106 GLU 106 518 518 GLU GLU A . n A 1 107 THR 107 519 519 THR THR A . n A 1 108 GLU 108 520 520 GLU GLU A . n A 1 109 ALA 109 521 521 ALA ALA A . n A 1 110 SER 110 522 522 SER SER A . n A 1 111 TYR 111 523 523 TYR TYR A . n A 1 112 ILE 112 524 524 ILE ILE A . n A 1 113 MET 113 525 525 MET MET A . n A 1 114 ARG 114 526 526 ARG ARG A . n A 1 115 LYS 115 527 527 LYS LYS A . n A 1 116 LEU 116 528 528 LEU LEU A . n A 1 117 VAL 117 529 529 VAL VAL A . n A 1 118 SER 118 530 530 SER SER A . n A 1 119 ALA 119 531 531 ALA ALA A . n A 1 120 VAL 120 532 532 VAL VAL A . n A 1 121 SER 121 533 533 SER SER A . n A 1 122 HIS 122 534 534 HIS HIS A . n A 1 123 MET 123 535 535 MET MET A . n A 1 124 HIS 124 536 536 HIS HIS A . n A 1 125 ASP 125 537 537 ASP ASP A . n A 1 126 VAL 126 538 538 VAL VAL A . n A 1 127 GLY 127 539 539 GLY GLY A . n A 1 128 VAL 128 540 540 VAL VAL A . n A 1 129 VAL 129 541 541 VAL VAL A . n A 1 130 HIS 130 542 542 HIS HIS A . n A 1 131 ARG 131 543 543 ARG ARG A . n A 1 132 ASP 132 544 544 ASP ASP A . n A 1 133 LEU 133 545 545 LEU LEU A . n A 1 134 LYS 134 546 546 LYS LYS A . n A 1 135 PRO 135 547 547 PRO PRO A . n A 1 136 GLU 136 548 548 GLU GLU A . n A 1 137 ASN 137 549 549 ASN ASN A . n A 1 138 LEU 138 550 550 LEU LEU A . n A 1 139 LEU 139 551 551 LEU LEU A . n A 1 140 PHE 140 552 552 PHE PHE A . n A 1 141 THR 141 553 553 THR THR A . n A 1 142 ASP 142 554 554 ASP ASP A . n A 1 143 GLU 143 555 555 GLU GLU A . n A 1 144 ASN 144 556 ? ? ? A . n A 1 145 ASP 145 557 ? ? ? A . n A 1 146 ASN 146 558 558 ASN ASN A . n A 1 147 LEU 147 559 559 LEU LEU A . n A 1 148 GLU 148 560 560 GLU GLU A . n A 1 149 ILE 149 561 561 ILE ILE A . n A 1 150 LYS 150 562 562 LYS LYS A . n A 1 151 ILE 151 563 563 ILE ILE A . n A 1 152 ILE 152 564 564 ILE ILE A . n A 1 153 ASP 153 565 565 ASP ASP A . n A 1 154 PHE 154 566 566 PHE PHE A . n A 1 155 GLY 155 567 567 GLY GLY A . n A 1 156 PHE 156 568 568 PHE PHE A . n A 1 157 ALA 157 569 569 ALA ALA A . n A 1 158 ARG 158 570 570 ARG ARG A . n A 1 159 LEU 159 571 571 LEU LEU A . n A 1 160 LYS 160 572 572 LYS LYS A . n A 1 161 PRO 161 573 573 PRO PRO A . n A 1 162 GLY 162 574 574 GLY GLY A . n A 1 163 SER 163 594 ? ? ? A . n A 1 164 GLY 164 595 ? ? ? A . n A 1 165 ASN 165 596 ? ? ? A . n A 1 166 GLY 166 597 ? ? ? A . n A 1 167 TYR 167 598 598 TYR TYR A . n A 1 168 ASP 168 599 599 ASP ASP A . n A 1 169 GLU 169 600 600 GLU GLU A . n A 1 170 SER 170 601 601 SER SER A . n A 1 171 CYS 171 602 602 CYS CYS A . n A 1 172 ASP 172 603 603 ASP ASP A . n A 1 173 LEU 173 604 604 LEU LEU A . n A 1 174 TRP 174 605 605 TRP TRP A . n A 1 175 SER 175 606 606 SER SER A . n A 1 176 LEU 176 607 607 LEU LEU A . n A 1 177 GLY 177 608 608 GLY GLY A . n A 1 178 VAL 178 609 609 VAL VAL A . n A 1 179 ILE 179 610 610 ILE ILE A . n A 1 180 LEU 180 611 611 LEU LEU A . n A 1 181 TYR 181 612 612 TYR TYR A . n A 1 182 THR 182 613 613 THR THR A . n A 1 183 MET 183 614 614 MET MET A . n A 1 184 LEU 184 615 615 LEU LEU A . n A 1 185 SER 185 616 616 SER SER A . n A 1 186 GLY 186 617 617 GLY GLY A . n A 1 187 GLN 187 618 618 GLN GLN A . n A 1 188 VAL 188 619 619 VAL VAL A . n A 1 189 PRO 189 620 620 PRO PRO A . n A 1 190 PHE 190 621 621 PHE PHE A . n A 1 191 GLN 191 622 622 GLN GLN A . n A 1 192 SER 192 623 ? ? ? A . n A 1 193 HIS 193 624 ? ? ? A . n A 1 194 ASP 194 625 ? ? ? A . n A 1 195 ARG 195 626 ? ? ? A . n A 1 196 SER 196 627 ? ? ? A . n A 1 197 LEU 197 628 ? ? ? A . n A 1 198 THR 198 629 ? ? ? A . n A 1 199 CYS 199 630 ? ? ? A . n A 1 200 THR 200 631 ? ? ? A . n A 1 201 SER 201 632 632 SER SER A . n A 1 202 ALA 202 633 633 ALA ALA A . n A 1 203 VAL 203 634 634 VAL VAL A . n A 1 204 GLU 204 635 635 GLU GLU A . n A 1 205 ILE 205 636 636 ILE ILE A . n A 1 206 MET 206 637 637 MET MET A . n A 1 207 LYS 207 638 638 LYS LYS A . n A 1 208 LYS 208 639 639 LYS LYS A . n A 1 209 ILE 209 640 640 ILE ILE A . n A 1 210 LYS 210 641 641 LYS LYS A . n A 1 211 LYS 211 642 642 LYS LYS A . n A 1 212 GLY 212 643 643 GLY GLY A . n A 1 213 ASP 213 644 644 ASP ASP A . n A 1 214 PHE 214 645 645 PHE PHE A . n A 1 215 SER 215 646 646 SER SER A . n A 1 216 PHE 216 647 647 PHE PHE A . n A 1 217 GLU 217 648 648 GLU GLU A . n A 1 218 GLY 218 649 649 GLY GLY A . n A 1 219 GLU 219 650 650 GLU GLU A . n A 1 220 ALA 220 651 651 ALA ALA A . n A 1 221 TRP 221 652 652 TRP TRP A . n A 1 222 LYS 222 653 653 LYS LYS A . n A 1 223 ASN 223 654 654 ASN ASN A . n A 1 224 VAL 224 655 655 VAL VAL A . n A 1 225 SER 225 656 656 SER SER A . n A 1 226 GLN 226 657 657 GLN GLN A . n A 1 227 GLU 227 658 658 GLU GLU A . n A 1 228 ALA 228 659 659 ALA ALA A . n A 1 229 LYS 229 660 660 LYS LYS A . n A 1 230 ASP 230 661 661 ASP ASP A . n A 1 231 LEU 231 662 662 LEU LEU A . n A 1 232 ILE 232 663 663 ILE ILE A . n A 1 233 GLN 233 664 664 GLN GLN A . n A 1 234 GLY 234 665 665 GLY GLY A . n A 1 235 LEU 235 666 666 LEU LEU A . n A 1 236 LEU 236 667 667 LEU LEU A . n A 1 237 THR 237 668 668 THR THR A . n A 1 238 VAL 238 669 669 VAL VAL A . n A 1 239 ASP 239 670 670 ASP ASP A . n A 1 240 PRO 240 671 671 PRO PRO A . n A 1 241 ASN 241 672 672 ASN ASN A . n A 1 242 LYS 242 673 673 LYS LYS A . n A 1 243 ARG 243 674 674 ARG ARG A . n A 1 244 LEU 244 675 675 LEU LEU A . n A 1 245 LYS 245 676 676 LYS LYS A . n A 1 246 MET 246 677 677 MET MET A . n A 1 247 SER 247 678 678 SER SER A . n A 1 248 GLY 248 679 679 GLY GLY A . n A 1 249 LEU 249 680 680 LEU LEU A . n A 1 250 ARG 250 681 681 ARG ARG A . n A 1 251 TYR 251 682 682 TYR TYR A . n A 1 252 ASN 252 683 683 ASN ASN A . n A 1 253 GLU 253 684 684 GLU GLU A . n A 1 254 TRP 254 685 685 TRP TRP A . n A 1 255 LEU 255 686 686 LEU LEU A . n A 1 256 GLN 256 687 687 GLN GLN A . n A 1 257 ASP 257 688 688 ASP ASP A . n A 1 258 GLY 258 689 689 GLY GLY A . n A 1 259 SER 259 690 690 SER SER A . n A 1 260 GLN 260 691 691 GLN GLN A . n A 1 261 LEU 261 692 692 LEU LEU A . n A 1 262 SER 262 693 693 SER SER A . n A 1 263 SER 263 694 694 SER SER A . n A 1 264 ASN 264 695 695 ASN ASN A . n A 1 265 PRO 265 696 696 PRO PRO A . n A 1 266 LEU 266 697 697 LEU LEU A . n A 1 267 MET 267 698 698 MET MET A . n A 1 268 THR 268 699 699 THR THR A . n A 1 269 PRO 269 700 700 PRO PRO A . n A 1 270 ASP 270 701 701 ASP ASP A . n A 1 271 ILE 271 702 702 ILE ILE A . n A 1 272 LEU 272 703 703 LEU LEU A . n A 1 273 GLY 273 704 704 GLY GLY A . n A 1 274 SER 274 705 705 SER SER A . n A 1 275 SER 275 706 706 SER SER A . n A 1 276 GLY 276 707 ? ? ? A . n A 1 277 ALA 277 708 ? ? ? A . n A 1 278 ALA 278 709 ? ? ? A . n A 1 279 VAL 279 710 ? ? ? A . n A 1 280 HIS 280 711 ? ? ? A . n A 1 281 THR 281 712 ? ? ? A . n A 1 282 CYS 282 713 ? ? ? A . n A 1 283 VAL 283 714 ? ? ? A . n A 1 284 LYS 284 715 ? ? ? A . n A 1 285 ALA 285 716 ? ? ? A . n A 1 286 THR 286 717 ? ? ? A . n A 1 287 PHE 287 718 ? ? ? A . n A 1 288 HIS 288 719 ? ? ? A . n A 1 289 ALA 289 720 ? ? ? A . n A 1 290 PHE 290 721 ? ? ? A . n A 1 291 ASN 291 722 ? ? ? A . n A 1 292 LYS 292 723 ? ? ? A . n A 1 293 TYR 293 724 ? ? ? A . n A 1 294 LYS 294 725 ? ? ? A . n A 1 295 ARG 295 726 ? ? ? A . n A 1 296 GLU 296 727 ? ? ? A . n A 1 297 GLY 297 728 ? ? ? A . n A 1 298 PHE 298 729 ? ? ? A . n A 1 299 CYS 299 730 ? ? ? A . n A 1 300 LEU 300 731 ? ? ? A . n A 1 301 GLN 301 732 ? ? ? A . n A 1 302 ASN 302 733 ? ? ? A . n A 1 303 VAL 303 734 ? ? ? A . n A 1 304 ASP 304 735 ? ? ? A . n A 1 305 LYS 305 736 ? ? ? A . n A 1 306 ALA 306 737 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SUU 1 900 900 SUU 493 A . C 3 OXM 1 901 901 OXM OXM A . D 3 OXM 1 902 902 OXM OXM A . E 4 HOH 1 1001 48 HOH HOH A . E 4 HOH 2 1002 39 HOH HOH A . E 4 HOH 3 1003 52 HOH HOH A . E 4 HOH 4 1004 2 HOH HOH A . E 4 HOH 5 1005 47 HOH HOH A . E 4 HOH 6 1006 9 HOH HOH A . E 4 HOH 7 1007 7 HOH HOH A . E 4 HOH 8 1008 42 HOH HOH A . E 4 HOH 9 1009 36 HOH HOH A . E 4 HOH 10 1010 14 HOH HOH A . E 4 HOH 11 1011 29 HOH HOH A . E 4 HOH 12 1012 28 HOH HOH A . E 4 HOH 13 1013 15 HOH HOH A . E 4 HOH 14 1014 40 HOH HOH A . E 4 HOH 15 1015 38 HOH HOH A . E 4 HOH 16 1016 22 HOH HOH A . E 4 HOH 17 1017 35 HOH HOH A . E 4 HOH 18 1018 23 HOH HOH A . E 4 HOH 19 1019 12 HOH HOH A . E 4 HOH 20 1020 31 HOH HOH A . E 4 HOH 21 1021 20 HOH HOH A . E 4 HOH 22 1022 33 HOH HOH A . E 4 HOH 23 1023 26 HOH HOH A . E 4 HOH 24 1024 8 HOH HOH A . E 4 HOH 25 1025 55 HOH HOH A . E 4 HOH 26 1026 25 HOH HOH A . E 4 HOH 27 1027 11 HOH HOH A . E 4 HOH 28 1028 1 HOH HOH A . E 4 HOH 29 1029 21 HOH HOH A . E 4 HOH 30 1030 45 HOH HOH A . E 4 HOH 31 1031 49 HOH HOH A . E 4 HOH 32 1032 19 HOH HOH A . E 4 HOH 33 1033 32 HOH HOH A . E 4 HOH 34 1034 13 HOH HOH A . E 4 HOH 35 1035 50 HOH HOH A . E 4 HOH 36 1036 37 HOH HOH A . E 4 HOH 37 1037 43 HOH HOH A . E 4 HOH 38 1038 24 HOH HOH A . E 4 HOH 39 1039 41 HOH HOH A . E 4 HOH 40 1040 57 HOH HOH A . E 4 HOH 41 1041 18 HOH HOH A . E 4 HOH 42 1042 4 HOH HOH A . E 4 HOH 43 1043 56 HOH HOH A . E 4 HOH 44 1044 58 HOH HOH A . E 4 HOH 45 1045 16 HOH HOH A . E 4 HOH 46 1046 59 HOH HOH A . E 4 HOH 47 1047 54 HOH HOH A . E 4 HOH 48 1048 5 HOH HOH A . E 4 HOH 49 1049 6 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 416 ? CG ? A ASP 4 CG 2 1 Y 1 A ASP 416 ? OD1 ? A ASP 4 OD1 3 1 Y 1 A ASP 416 ? OD2 ? A ASP 4 OD2 4 1 Y 1 A ARG 460 ? CG ? A ARG 48 CG 5 1 Y 1 A ARG 460 ? CD ? A ARG 48 CD 6 1 Y 1 A ARG 460 ? NE ? A ARG 48 NE 7 1 Y 1 A ARG 460 ? CZ ? A ARG 48 CZ 8 1 Y 1 A ARG 460 ? NH1 ? A ARG 48 NH1 9 1 Y 1 A ARG 460 ? NH2 ? A ARG 48 NH2 10 1 Y 1 A GLU 476 ? CG ? A GLU 64 CG 11 1 Y 1 A GLU 476 ? CD ? A GLU 64 CD 12 1 Y 1 A GLU 476 ? OE1 ? A GLU 64 OE1 13 1 Y 1 A GLU 476 ? OE2 ? A GLU 64 OE2 14 1 Y 1 A LYS 483 ? CG ? A LYS 71 CG 15 1 Y 1 A LYS 483 ? CD ? A LYS 71 CD 16 1 Y 1 A LYS 483 ? CE ? A LYS 71 CE 17 1 Y 1 A LYS 483 ? NZ ? A LYS 71 NZ 18 1 Y 1 A GLN 491 ? CG ? A GLN 79 CG 19 1 Y 1 A GLN 491 ? CD ? A GLN 79 CD 20 1 Y 1 A GLN 491 ? OE1 ? A GLN 79 OE1 21 1 Y 1 A GLN 491 ? NE2 ? A GLN 79 NE2 22 1 Y 1 A LYS 511 ? CG ? A LYS 99 CG 23 1 Y 1 A LYS 511 ? CD ? A LYS 99 CD 24 1 Y 1 A LYS 511 ? CE ? A LYS 99 CE 25 1 Y 1 A LYS 511 ? NZ ? A LYS 99 NZ 26 1 Y 1 A LYS 514 ? CG ? A LYS 102 CG 27 1 Y 1 A LYS 514 ? CD ? A LYS 102 CD 28 1 Y 1 A LYS 514 ? CE ? A LYS 102 CE 29 1 Y 1 A LYS 514 ? NZ ? A LYS 102 NZ 30 1 Y 1 A HIS 515 ? CG ? A HIS 103 CG 31 1 Y 1 A HIS 515 ? ND1 ? A HIS 103 ND1 32 1 Y 1 A HIS 515 ? CD2 ? A HIS 103 CD2 33 1 Y 1 A HIS 515 ? CE1 ? A HIS 103 CE1 34 1 Y 1 A HIS 515 ? NE2 ? A HIS 103 NE2 35 1 Y 1 A GLU 555 ? CG ? A GLU 143 CG 36 1 Y 1 A GLU 555 ? CD ? A GLU 143 CD 37 1 Y 1 A GLU 555 ? OE1 ? A GLU 143 OE1 38 1 Y 1 A GLU 555 ? OE2 ? A GLU 143 OE2 39 1 Y 1 A ASN 558 ? CG ? A ASN 146 CG 40 1 Y 1 A ASN 558 ? OD1 ? A ASN 146 OD1 41 1 Y 1 A ASN 558 ? ND2 ? A ASN 146 ND2 42 1 Y 1 A LEU 559 ? CG ? A LEU 147 CG 43 1 Y 1 A LEU 559 ? CD1 ? A LEU 147 CD1 44 1 Y 1 A LEU 559 ? CD2 ? A LEU 147 CD2 45 1 Y 1 A ARG 570 ? CG ? A ARG 158 CG 46 1 Y 1 A ARG 570 ? CD ? A ARG 158 CD 47 1 Y 1 A ARG 570 ? NE ? A ARG 158 NE 48 1 Y 1 A ARG 570 ? CZ ? A ARG 158 CZ 49 1 Y 1 A ARG 570 ? NH1 ? A ARG 158 NH1 50 1 Y 1 A ARG 570 ? NH2 ? A ARG 158 NH2 51 1 Y 1 A TYR 598 ? CG ? A TYR 167 CG 52 1 Y 1 A TYR 598 ? CD1 ? A TYR 167 CD1 53 1 Y 1 A TYR 598 ? CD2 ? A TYR 167 CD2 54 1 Y 1 A TYR 598 ? CE1 ? A TYR 167 CE1 55 1 Y 1 A TYR 598 ? CE2 ? A TYR 167 CE2 56 1 Y 1 A TYR 598 ? CZ ? A TYR 167 CZ 57 1 Y 1 A TYR 598 ? OH ? A TYR 167 OH 58 1 Y 1 A VAL 634 ? CG1 ? A VAL 203 CG1 59 1 Y 1 A VAL 634 ? CG2 ? A VAL 203 CG2 60 1 Y 1 A GLU 635 ? CG ? A GLU 204 CG 61 1 Y 1 A GLU 635 ? CD ? A GLU 204 CD 62 1 Y 1 A GLU 635 ? OE1 ? A GLU 204 OE1 63 1 Y 1 A GLU 635 ? OE2 ? A GLU 204 OE2 64 1 Y 1 A MET 637 ? CG ? A MET 206 CG 65 1 Y 1 A MET 637 ? SD ? A MET 206 SD 66 1 Y 1 A MET 637 ? CE ? A MET 206 CE 67 1 Y 1 A LYS 638 ? CG ? A LYS 207 CG 68 1 Y 1 A LYS 638 ? CD ? A LYS 207 CD 69 1 Y 1 A LYS 638 ? CE ? A LYS 207 CE 70 1 Y 1 A LYS 638 ? NZ ? A LYS 207 NZ 71 1 Y 1 A LYS 639 ? CG ? A LYS 208 CG 72 1 Y 1 A LYS 639 ? CD ? A LYS 208 CD 73 1 Y 1 A LYS 639 ? CE ? A LYS 208 CE 74 1 Y 1 A LYS 639 ? NZ ? A LYS 208 NZ 75 1 Y 1 A LYS 641 ? CG ? A LYS 210 CG 76 1 Y 1 A LYS 641 ? CD ? A LYS 210 CD 77 1 Y 1 A LYS 641 ? CE ? A LYS 210 CE 78 1 Y 1 A LYS 641 ? NZ ? A LYS 210 NZ 79 1 Y 1 A LYS 642 ? CG ? A LYS 211 CG 80 1 Y 1 A LYS 642 ? CD ? A LYS 211 CD 81 1 Y 1 A LYS 642 ? CE ? A LYS 211 CE 82 1 Y 1 A LYS 642 ? NZ ? A LYS 211 NZ 83 1 Y 1 A ASP 644 ? CG ? A ASP 213 CG 84 1 Y 1 A ASP 644 ? OD1 ? A ASP 213 OD1 85 1 Y 1 A ASP 644 ? OD2 ? A ASP 213 OD2 86 1 Y 1 A GLU 650 ? CG ? A GLU 219 CG 87 1 Y 1 A GLU 650 ? CD ? A GLU 219 CD 88 1 Y 1 A GLU 650 ? OE1 ? A GLU 219 OE1 89 1 Y 1 A GLU 650 ? OE2 ? A GLU 219 OE2 90 1 Y 1 A LYS 653 ? CG ? A LYS 222 CG 91 1 Y 1 A LYS 653 ? CD ? A LYS 222 CD 92 1 Y 1 A LYS 653 ? CE ? A LYS 222 CE 93 1 Y 1 A LYS 653 ? NZ ? A LYS 222 NZ 94 1 Y 1 A VAL 669 ? CG1 ? A VAL 238 CG1 95 1 Y 1 A VAL 669 ? CG2 ? A VAL 238 CG2 96 1 Y 1 A ASN 672 ? CG ? A ASN 241 CG 97 1 Y 1 A ASN 672 ? OD1 ? A ASN 241 OD1 98 1 Y 1 A ASN 672 ? ND2 ? A ASN 241 ND2 99 1 Y 1 A LYS 673 ? CG ? A LYS 242 CG 100 1 Y 1 A LYS 673 ? CD ? A LYS 242 CD 101 1 Y 1 A LYS 673 ? CE ? A LYS 242 CE 102 1 Y 1 A LYS 673 ? NZ ? A LYS 242 NZ 103 1 Y 1 A LYS 676 ? CG ? A LYS 245 CG 104 1 Y 1 A LYS 676 ? CD ? A LYS 245 CD 105 1 Y 1 A LYS 676 ? CE ? A LYS 245 CE 106 1 Y 1 A LYS 676 ? NZ ? A LYS 245 NZ 107 1 Y 1 A TYR 682 ? CG ? A TYR 251 CG 108 1 Y 1 A TYR 682 ? CD1 ? A TYR 251 CD1 109 1 Y 1 A TYR 682 ? CD2 ? A TYR 251 CD2 110 1 Y 1 A TYR 682 ? CE1 ? A TYR 251 CE1 111 1 Y 1 A TYR 682 ? CE2 ? A TYR 251 CE2 112 1 Y 1 A TYR 682 ? CZ ? A TYR 251 CZ 113 1 Y 1 A TYR 682 ? OH ? A TYR 251 OH 114 1 Y 1 A GLN 691 ? CG ? A GLN 260 CG 115 1 Y 1 A GLN 691 ? CD ? A GLN 260 CD 116 1 Y 1 A GLN 691 ? OE1 ? A GLN 260 OE1 117 1 Y 1 A GLN 691 ? NE2 ? A GLN 260 NE2 118 1 Y 1 A ASN 695 ? CG ? A ASN 264 CG 119 1 Y 1 A ASN 695 ? OD1 ? A ASN 264 OD1 120 1 Y 1 A ASN 695 ? ND2 ? A ASN 264 ND2 121 1 Y 1 A ASP 701 ? CG ? A ASP 270 CG 122 1 Y 1 A ASP 701 ? OD1 ? A ASP 270 OD1 123 1 Y 1 A ASP 701 ? OD2 ? A ASP 270 OD2 124 1 Y 1 A SER 705 ? OG ? A SER 274 OG 125 1 Y 1 A SER 706 ? OG ? A SER 275 OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7UP6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.170 _cell.length_a_esd ? _cell.length_b 71.170 _cell.length_b_esd ? _cell.length_c 144.840 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UP6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UP6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.8 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystals were produced by sitting drop vapor diffusion with an equal volume of the protein, Msk1-C terminal domain (PID6598-1, CID101276) at 4.91 mg/ml in 25mM HEPES pH 7.5, 150mM NaCl, 5% Glycerol, 5mM BME and a crystallization buffer containing 12.5% PEG 1000, 12.5% PEG 3350, 12.5% MPD: 20mM of each sodium formate, ammonium acetate, trisodium citrate, sodium-potassium tartrate, sodium oxamate: 100 mM MOPS / HEPES-Na pH 7.5 (tray ID 298849, well G8, Morpheus). Crystals were direly vitrified in in liquid N2. Puck ID BOW0-8 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 51.890 _reflns.entry_id 7UP6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 35.590 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12830 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.700 _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.020 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.026 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.090 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 98583 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.600 _reflns_shell.d_res_low 2.67 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.820 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs 1042 _reflns_shell.number_possible 161 _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 154 _reflns_shell.percent_possible_all 100.000 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.575 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.500 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.037 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.999 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 158.580 _refine.B_iso_mean 61.8800 _refine.B_iso_min 24.320 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UP6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6000 _refine.ls_d_res_low 35.5900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12754 _refine.ls_number_reflns_R_free 1316 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7000 _refine.ls_percent_reflns_R_free 10.3200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1700 _refine.ls_R_factor_R_free 0.2090 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1660 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'in-house model' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 0 _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.1000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6000 _refine_hist.d_res_low 35.5900 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 2018 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 257 _refine_hist.pdbx_B_iso_mean_ligand 51.05 _refine_hist.pdbx_B_iso_mean_solvent 55.53 _refine_hist.pdbx_number_atoms_protein 1935 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.004 ? ? 2027 'X-RAY DIFFRACTION' ? f_angle_d 0.593 ? ? 2744 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.718 ? ? 1202 'X-RAY DIFFRACTION' ? f_chiral_restr 0.045 ? ? 311 'X-RAY DIFFRACTION' ? f_plane_restr 0.004 ? ? 352 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.6000 _refine_ls_shell.d_res_low 2.7000 _refine_ls_shell.number_reflns_all 1417 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 145 _refine_ls_shell.number_reflns_R_work 1272 _refine_ls_shell.percent_reflns_obs 99.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2467 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2035 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _database_PDB_matrix.entry_id 7UP6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _struct.entry_id 7UP6 _struct.title ;Crystal structure of C-terminal domain of MSK1 in complex with in covalently bound literature RSK2 inhibitor pyrrolopyrimidine cyanoacrylamide compound 25 (co-crystal) ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UP6 _struct_keywords.text 'MSK1, C-TERMINAL DOMAIN, PROTEIN KINASE, TRANSFERASE, PHOSPHORYLATION' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KS6A5_HUMAN _struct_ref.pdbx_db_accession O75582 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHDQLH TFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKIIDFGFARLKP PDNQPLKTPCFTLHYAAPELLNQNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAW KNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQ NVDKA ; _struct_ref.pdbx_align_begin 414 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UP6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 306 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75582 _struct_ref_seq.db_align_beg 414 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 738 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 414 _struct_ref_seq.pdbx_auth_seq_align_end 737 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7UP6 GLY A 1 ? UNP O75582 ? ? 'expression tag' 413 1 1 7UP6 GLY A 162 ? UNP O75582 PRO 574 linker 574 2 1 7UP6 SER A 163 ? UNP O75582 ASP 575 linker 594 3 1 7UP6 GLY A 164 ? UNP O75582 ASN 576 linker 595 4 1 7UP6 ? A ? ? UNP O75582 GLN 577 deletion ? 5 1 7UP6 ? A ? ? UNP O75582 PRO 578 deletion ? 6 1 7UP6 ? A ? ? UNP O75582 LEU 579 deletion ? 7 1 7UP6 ? A ? ? UNP O75582 LYS 580 deletion ? 8 1 7UP6 ? A ? ? UNP O75582 THR 581 deletion ? 9 1 7UP6 ? A ? ? UNP O75582 PRO 582 deletion ? 10 1 7UP6 ? A ? ? UNP O75582 CYS 583 deletion ? 11 1 7UP6 ? A ? ? UNP O75582 PHE 584 deletion ? 12 1 7UP6 ? A ? ? UNP O75582 THR 585 deletion ? 13 1 7UP6 ? A ? ? UNP O75582 LEU 586 deletion ? 14 1 7UP6 ? A ? ? UNP O75582 HIS 587 deletion ? 15 1 7UP6 ? A ? ? UNP O75582 TYR 588 deletion ? 16 1 7UP6 ? A ? ? UNP O75582 ALA 589 deletion ? 17 1 7UP6 ? A ? ? UNP O75582 ALA 590 deletion ? 18 1 7UP6 ? A ? ? UNP O75582 PRO 591 deletion ? 19 1 7UP6 ? A ? ? UNP O75582 GLU 592 deletion ? 20 1 7UP6 ? A ? ? UNP O75582 LEU 593 deletion ? 21 1 7UP6 ? A ? ? UNP O75582 LEU 594 deletion ? 22 1 7UP6 ? A ? ? UNP O75582 ASN 595 deletion ? 23 1 7UP6 ? A ? ? UNP O75582 GLN 596 deletion ? 24 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? HIS A 10 ? SER A 417 HIS A 422 1 ? 6 HELX_P HELX_P2 AA2 MET A 49 ? GLU A 64 ? MET A 461 GLU A 476 1 ? 16 HELX_P HELX_P3 AA3 LEU A 94 ? LYS A 101 ? LEU A 506 LYS A 513 1 ? 8 HELX_P HELX_P4 AA4 SER A 105 ? VAL A 126 ? SER A 517 VAL A 538 1 ? 22 HELX_P HELX_P5 AA5 LYS A 134 ? GLU A 136 ? LYS A 546 GLU A 548 5 ? 3 HELX_P HELX_P6 AA6 ASP A 168 ? GLY A 186 ? ASP A 599 GLY A 617 1 ? 19 HELX_P HELX_P7 AA7 ALA A 202 ? LYS A 211 ? ALA A 633 LYS A 642 1 ? 10 HELX_P HELX_P8 AA8 GLY A 218 ? LYS A 222 ? GLY A 649 LYS A 653 5 ? 5 HELX_P HELX_P9 AA9 SER A 225 ? THR A 237 ? SER A 656 THR A 668 1 ? 13 HELX_P HELX_P10 AB1 ASP A 239 ? ARG A 243 ? ASP A 670 ARG A 674 5 ? 5 HELX_P HELX_P11 AB2 LYS A 245 ? TYR A 251 ? LYS A 676 TYR A 682 1 ? 7 HELX_P HELX_P12 AB3 MET A 267 ? SER A 275 ? MET A 698 SER A 706 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 28 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id SUU _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C04 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 440 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id SUU _struct_conn.ptnr2_auth_seq_id 900 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.902 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 160 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 572 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 161 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 573 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.74 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 11 ? LEU A 13 ? TYR A 423 LEU A 425 AA1 2 SER A 26 ? HIS A 33 ? SER A 438 HIS A 445 AA1 3 GLY A 21 ? GLU A 22 ? GLY A 433 GLU A 434 AA2 1 TYR A 11 ? LEU A 13 ? TYR A 423 LEU A 425 AA2 2 SER A 26 ? HIS A 33 ? SER A 438 HIS A 445 AA2 3 ALA A 39 ? SER A 46 ? ALA A 451 SER A 458 AA2 4 HIS A 81 ? MET A 86 ? HIS A 493 MET A 498 AA2 5 LEU A 72 ? HIS A 77 ? LEU A 484 HIS A 489 AA3 1 GLY A 92 ? GLU A 93 ? GLY A 504 GLU A 505 AA3 2 LEU A 138 ? THR A 141 ? LEU A 550 THR A 553 AA3 3 GLU A 148 ? ILE A 151 ? GLU A 560 ILE A 563 AA4 1 VAL A 128 ? VAL A 129 ? VAL A 540 VAL A 541 AA4 2 ARG A 158 ? LEU A 159 ? ARG A 570 LEU A 571 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 12 ? N ASP A 424 O VAL A 32 ? O VAL A 444 AA1 2 3 O CYS A 28 ? O CYS A 440 N GLY A 21 ? N GLY A 433 AA2 1 2 N ASP A 12 ? N ASP A 424 O VAL A 32 ? O VAL A 444 AA2 2 3 N ILE A 27 ? N ILE A 439 O ILE A 44 ? O ILE A 456 AA2 3 4 N ALA A 41 ? N ALA A 453 O MET A 86 ? O MET A 498 AA2 4 5 O PHE A 83 ? O PHE A 495 N PHE A 76 ? N PHE A 488 AA3 1 2 N GLY A 92 ? N GLY A 504 O PHE A 140 ? O PHE A 552 AA3 2 3 N LEU A 139 ? N LEU A 551 O LYS A 150 ? O LYS A 562 AA4 1 2 N VAL A 129 ? N VAL A 541 O ARG A 158 ? O ARG A 570 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 695 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 1001 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 461 ? ? -99.20 32.54 2 1 ASP A 544 ? ? -148.43 41.77 3 1 ASP A 565 ? ? 57.79 81.54 4 1 TYR A 682 ? ? -87.56 33.23 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -19.7424 6.2836 47.3375 0.3117 ? 0.0438 ? -0.0203 ? 0.2483 ? 0.0249 ? 0.3487 ? 5.2511 ? 2.5928 ? 0.1656 ? 6.0483 ? -1.9701 ? 6.3704 ? 0.1166 ? -0.1371 ? -0.2491 ? 0.3646 ? -0.1060 ? -0.3889 ? 0.0718 ? 0.1287 ? -0.0216 ? 2 'X-RAY DIFFRACTION' ? refined -16.6215 12.3423 39.5092 0.2354 ? 0.0246 ? -0.0002 ? 0.2718 ? 0.0053 ? 0.2901 ? 2.6003 ? 1.6538 ? -0.4206 ? 3.7385 ? -1.8577 ? 6.1432 ? -0.0730 ? -0.2590 ? -0.0867 ? 0.1342 ? -0.1648 ? -0.4573 ? 0.0933 ? 0.4845 ? 0.1812 ? 3 'X-RAY DIFFRACTION' ? refined -30.6225 15.4267 28.3296 0.3320 ? 0.0548 ? -0.0006 ? 0.3270 ? -0.0095 ? 0.3091 ? 5.1457 ? 0.6703 ? 1.0247 ? 2.3582 ? -0.3779 ? 4.4688 ? -0.0050 ? 0.0983 ? 0.2080 ? 0.0826 ? -0.0809 ? 0.2336 ? -0.0482 ? -0.6817 ? 0.0459 ? 4 'X-RAY DIFFRACTION' ? refined -37.7071 8.0119 14.9419 0.5010 ? -0.0604 ? -0.0642 ? 0.4477 ? -0.0172 ? 0.3164 ? 7.0131 ? 0.5068 ? 2.3298 ? 4.9289 ? -0.7438 ? 7.9352 ? 0.1803 ? 0.0828 ? -0.4354 ? -0.2600 ? -0.0268 ? 0.1377 ? 0.7816 ? -0.3835 ? -0.2126 ? 5 'X-RAY DIFFRACTION' ? refined -39.3461 17.4454 16.7777 0.4812 ? 0.0657 ? -0.0978 ? 0.5718 ? -0.0442 ? 0.4382 ? 9.0736 ? 1.6780 ? 0.2036 ? 7.1945 ? -1.5325 ? 9.8782 ? 0.1360 ? -0.3112 ? 0.4131 ? 0.1396 ? -0.1870 ? 0.7790 ? -0.8596 ? -0.5071 ? 0.0523 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? ? A 0 ? ? ? 2 'X-RAY DIFFRACTION' 2 ? ? A 0 ? ? ? A 0 ? ? ? 3 'X-RAY DIFFRACTION' 3 ? ? A 0 ? ? ? A 0 ? ? ? 4 'X-RAY DIFFRACTION' 4 ? ? A 0 ? ? ? A 0 ? ? ? 5 'X-RAY DIFFRACTION' 5 ? ? A 0 ? ? ? A 0 ? ? ? # _pdbx_entry_details.entry_id 7UP6 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 413 ? A GLY 1 2 1 Y 1 A MET 414 ? A MET 2 3 1 Y 1 A LYS 415 ? A LYS 3 4 1 Y 1 A ASN 556 ? A ASN 144 5 1 Y 1 A ASP 557 ? A ASP 145 6 1 Y 1 A SER 594 ? A SER 163 7 1 Y 1 A GLY 595 ? A GLY 164 8 1 Y 1 A ASN 596 ? A ASN 165 9 1 Y 1 A GLY 597 ? A GLY 166 10 1 Y 1 A SER 623 ? A SER 192 11 1 Y 1 A HIS 624 ? A HIS 193 12 1 Y 1 A ASP 625 ? A ASP 194 13 1 Y 1 A ARG 626 ? A ARG 195 14 1 Y 1 A SER 627 ? A SER 196 15 1 Y 1 A LEU 628 ? A LEU 197 16 1 Y 1 A THR 629 ? A THR 198 17 1 Y 1 A CYS 630 ? A CYS 199 18 1 Y 1 A THR 631 ? A THR 200 19 1 Y 1 A GLY 707 ? A GLY 276 20 1 Y 1 A ALA 708 ? A ALA 277 21 1 Y 1 A ALA 709 ? A ALA 278 22 1 Y 1 A VAL 710 ? A VAL 279 23 1 Y 1 A HIS 711 ? A HIS 280 24 1 Y 1 A THR 712 ? A THR 281 25 1 Y 1 A CYS 713 ? A CYS 282 26 1 Y 1 A VAL 714 ? A VAL 283 27 1 Y 1 A LYS 715 ? A LYS 284 28 1 Y 1 A ALA 716 ? A ALA 285 29 1 Y 1 A THR 717 ? A THR 286 30 1 Y 1 A PHE 718 ? A PHE 287 31 1 Y 1 A HIS 719 ? A HIS 288 32 1 Y 1 A ALA 720 ? A ALA 289 33 1 Y 1 A PHE 721 ? A PHE 290 34 1 Y 1 A ASN 722 ? A ASN 291 35 1 Y 1 A LYS 723 ? A LYS 292 36 1 Y 1 A TYR 724 ? A TYR 293 37 1 Y 1 A LYS 725 ? A LYS 294 38 1 Y 1 A ARG 726 ? A ARG 295 39 1 Y 1 A GLU 727 ? A GLU 296 40 1 Y 1 A GLY 728 ? A GLY 297 41 1 Y 1 A PHE 729 ? A PHE 298 42 1 Y 1 A CYS 730 ? A CYS 299 43 1 Y 1 A LEU 731 ? A LEU 300 44 1 Y 1 A GLN 732 ? A GLN 301 45 1 Y 1 A ASN 733 ? A ASN 302 46 1 Y 1 A VAL 734 ? A VAL 303 47 1 Y 1 A ASP 735 ? A ASP 304 48 1 Y 1 A LYS 736 ? A LYS 305 49 1 Y 1 A ALA 737 ? A ALA 306 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 OXM C1 C N N 250 OXM N1 N N N 251 OXM O1 O N N 252 OXM C2 C N N 253 OXM O2 O N N 254 OXM O3 O N N 255 OXM HN1 H N N 256 OXM HN2 H N N 257 OXM HO3 H N N 258 PHE N N N N 259 PHE CA C N S 260 PHE C C N N 261 PHE O O N N 262 PHE CB C N N 263 PHE CG C Y N 264 PHE CD1 C Y N 265 PHE CD2 C Y N 266 PHE CE1 C Y N 267 PHE CE2 C Y N 268 PHE CZ C Y N 269 PHE OXT O N N 270 PHE H H N N 271 PHE H2 H N N 272 PHE HA H N N 273 PHE HB2 H N N 274 PHE HB3 H N N 275 PHE HD1 H N N 276 PHE HD2 H N N 277 PHE HE1 H N N 278 PHE HE2 H N N 279 PHE HZ H N N 280 PHE HXT H N N 281 PRO N N N N 282 PRO CA C N S 283 PRO C C N N 284 PRO O O N N 285 PRO CB C N N 286 PRO CG C N N 287 PRO CD C N N 288 PRO OXT O N N 289 PRO H H N N 290 PRO HA H N N 291 PRO HB2 H N N 292 PRO HB3 H N N 293 PRO HG2 H N N 294 PRO HG3 H N N 295 PRO HD2 H N N 296 PRO HD3 H N N 297 PRO HXT H N N 298 SER N N N N 299 SER CA C N S 300 SER C C N N 301 SER O O N N 302 SER CB C N N 303 SER OG O N N 304 SER OXT O N N 305 SER H H N N 306 SER H2 H N N 307 SER HA H N N 308 SER HB2 H N N 309 SER HB3 H N N 310 SER HG H N N 311 SER HXT H N N 312 SUU C11 C Y N 313 SUU C14 C Y N 314 SUU C15 C Y N 315 SUU C19 C Y N 316 SUU C21 C Y N 317 SUU C24 C Y N 318 SUU C25 C Y N 319 SUU C04 C N N 320 SUU C05 C N S 321 SUU C06 C N N 322 SUU C08 C N N 323 SUU C12 C Y N 324 SUU C13 C Y N 325 SUU C16 C Y N 326 SUU C17 C Y N 327 SUU C23 C Y N 328 SUU N07 N N N 329 SUU N09 N N N 330 SUU N18 N Y N 331 SUU N20 N Y N 332 SUU N22 N Y N 333 SUU O10 O N N 334 SUU H1 H N N 335 SUU H2 H N N 336 SUU H3 H N N 337 SUU H4 H N N 338 SUU H5 H N N 339 SUU H6 H N N 340 SUU H7 H N N 341 SUU H8 H N N 342 SUU H9 H N N 343 SUU H10 H N N 344 SUU H11 H N N 345 SUU H12 H N N 346 SUU H13 H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 OXM C1 N1 sing N N 237 OXM C1 O1 doub N N 238 OXM C1 C2 sing N N 239 OXM N1 HN1 sing N N 240 OXM N1 HN2 sing N N 241 OXM C2 O2 doub N N 242 OXM C2 O3 sing N N 243 OXM O3 HO3 sing N N 244 PHE N CA sing N N 245 PHE N H sing N N 246 PHE N H2 sing N N 247 PHE CA C sing N N 248 PHE CA CB sing N N 249 PHE CA HA sing N N 250 PHE C O doub N N 251 PHE C OXT sing N N 252 PHE CB CG sing N N 253 PHE CB HB2 sing N N 254 PHE CB HB3 sing N N 255 PHE CG CD1 doub Y N 256 PHE CG CD2 sing Y N 257 PHE CD1 CE1 sing Y N 258 PHE CD1 HD1 sing N N 259 PHE CD2 CE2 doub Y N 260 PHE CD2 HD2 sing N N 261 PHE CE1 CZ doub Y N 262 PHE CE1 HE1 sing N N 263 PHE CE2 CZ sing Y N 264 PHE CE2 HE2 sing N N 265 PHE CZ HZ sing N N 266 PHE OXT HXT sing N N 267 PRO N CA sing N N 268 PRO N CD sing N N 269 PRO N H sing N N 270 PRO CA C sing N N 271 PRO CA CB sing N N 272 PRO CA HA sing N N 273 PRO C O doub N N 274 PRO C OXT sing N N 275 PRO CB CG sing N N 276 PRO CB HB2 sing N N 277 PRO CB HB3 sing N N 278 PRO CG CD sing N N 279 PRO CG HG2 sing N N 280 PRO CG HG3 sing N N 281 PRO CD HD2 sing N N 282 PRO CD HD3 sing N N 283 PRO OXT HXT sing N N 284 SER N CA sing N N 285 SER N H sing N N 286 SER N H2 sing N N 287 SER CA C sing N N 288 SER CA CB sing N N 289 SER CA HA sing N N 290 SER C O doub N N 291 SER C OXT sing N N 292 SER CB OG sing N N 293 SER CB HB2 sing N N 294 SER CB HB3 sing N N 295 SER OG HG sing N N 296 SER OXT HXT sing N N 297 SUU N09 C08 sing N N 298 SUU N07 C06 trip N N 299 SUU C06 C05 sing N N 300 SUU C08 C05 sing N N 301 SUU C08 O10 doub N N 302 SUU C05 C04 sing N N 303 SUU C12 C13 doub Y N 304 SUU C12 C11 sing Y N 305 SUU C13 C14 sing Y N 306 SUU C04 C11 sing N N 307 SUU C11 C16 doub Y N 308 SUU C14 C15 doub Y N 309 SUU C24 C23 doub Y N 310 SUU C24 C25 sing Y N 311 SUU C16 C15 sing Y N 312 SUU C23 N22 sing Y N 313 SUU C15 C17 sing N N 314 SUU C25 C17 doub Y N 315 SUU C25 C21 sing Y N 316 SUU C17 N18 sing Y N 317 SUU N22 C21 sing Y N 318 SUU C21 N20 doub Y N 319 SUU N18 C19 doub Y N 320 SUU N20 C19 sing Y N 321 SUU C14 H1 sing N N 322 SUU C19 H2 sing N N 323 SUU C24 H3 sing N N 324 SUU C04 H4 sing N N 325 SUU C04 H5 sing N N 326 SUU C05 H6 sing N N 327 SUU C12 H7 sing N N 328 SUU C13 H8 sing N N 329 SUU C16 H9 sing N N 330 SUU C23 H10 sing N N 331 SUU N09 H11 sing N N 332 SUU N09 H12 sing N N 333 SUU N22 H13 sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SUU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SUU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'in-house model' # _atom_sites.entry_id 7UP6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014051 _atom_sites.fract_transf_matrix[1][2] 0.008112 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016225 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006904 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_