data_7UPO # _entry.id 7UPO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UPO pdb_00007upo 10.2210/pdb7upo/pdb WWPDB D_1000264610 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-12-14 2 'Structure model' 1 1 2023-01-04 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UPO _pdbx_database_status.recvd_initial_deposition_date 2022-04-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 damian.ekiert@ekiertlab.org Damian Ekiert C 'principal investigator/group leader' 0000-0002-2570-0404 4 gira.bhabha@gmail.com Gira Bhabha ? 'principal investigator/group leader' 0000-0003-0624-6178 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chang, Y.' 1 0000-0003-2580-4622 'Bhabha, G.' 2 ? 'Ekiert, D.C.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 1266 _citation.page_last 1276 _citation.title 'De novo design of obligate ABC-type heterotrimeric proteins.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41594-022-00879-4 _citation.pdbx_database_id_PubMed 36522429 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bermeo, S.' 1 ? primary 'Favor, A.' 2 0000-0002-9977-2785 primary 'Chang, Y.T.' 3 0000-0003-2580-4622 primary 'Norris, A.' 4 ? primary 'Boyken, S.E.' 5 0000-0002-5378-0632 primary 'Hsia, Y.' 6 0000-0001-7467-8373 primary 'Haddox, H.K.' 7 ? primary 'Xu, C.' 8 ? primary 'Brunette, T.J.' 9 ? primary 'Wysocki, V.H.' 10 0000-0003-0495-2538 primary 'Bhabha, G.' 11 0000-0003-0624-6178 primary 'Ekiert, D.C.' 12 0000-0002-2570-0404 primary 'Baker, D.' 13 0000-0001-7896-6217 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DHT03 protein A' 8841.385 1 ? ? ? ? 2 polymer man 'DHT03 protein B' 9071.513 1 ? ? ? ? 3 polymer man 'DHT03 protein C' 9078.849 1 ? ? ? ? 4 water nat water 18.015 5 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GSSPEEEKLKELLKELKKVLDRLKKILERNDEEIKKSDELDDESLLEDIVELLKEIIKLWKILVELSDILLKLIS GSSPEEEKLKELLKELKKVLDRLKKILERNDEEIKKSDELDDESLLEDIVELLKEIIKLWKILVELSDILLKLIS A ? 2 'polypeptide(L)' no no SSPVDEIDKEVKKLEEEAKKSQEEVERLKQEVEKASKAGLDHEGDSRIFKKIHDVVTKQIKVIIRLIEVYVRLVEIIL SSPVDEIDKEVKKLEEEAKKSQEEVERLKQEVEKASKAGLDHEGDSRIFKKIHDVVTKQIKVIIRLIEVYVRLVEIIL B ? 3 'polypeptide(L)' no no GSKQKEAIKVYLELLEVHSRVLKALIEQIKLFIELIKRPDEDLADKVRKSSEELKKIIKEVEKILRKVDDILYKVKS GSKQKEAIKVYLELLEVHSRVLKALIEQIKLFIELIKRPDEDLADKVRKSSEELKKIIKEVEKILRKVDDILYKVKS C ? # _pdbx_entity_nonpoly.entity_id 4 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 PRO n 1 5 GLU n 1 6 GLU n 1 7 GLU n 1 8 LYS n 1 9 LEU n 1 10 LYS n 1 11 GLU n 1 12 LEU n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 LEU n 1 17 LYS n 1 18 LYS n 1 19 VAL n 1 20 LEU n 1 21 ASP n 1 22 ARG n 1 23 LEU n 1 24 LYS n 1 25 LYS n 1 26 ILE n 1 27 LEU n 1 28 GLU n 1 29 ARG n 1 30 ASN n 1 31 ASP n 1 32 GLU n 1 33 GLU n 1 34 ILE n 1 35 LYS n 1 36 LYS n 1 37 SER n 1 38 ASP n 1 39 GLU n 1 40 LEU n 1 41 ASP n 1 42 ASP n 1 43 GLU n 1 44 SER n 1 45 LEU n 1 46 LEU n 1 47 GLU n 1 48 ASP n 1 49 ILE n 1 50 VAL n 1 51 GLU n 1 52 LEU n 1 53 LEU n 1 54 LYS n 1 55 GLU n 1 56 ILE n 1 57 ILE n 1 58 LYS n 1 59 LEU n 1 60 TRP n 1 61 LYS n 1 62 ILE n 1 63 LEU n 1 64 VAL n 1 65 GLU n 1 66 LEU n 1 67 SER n 1 68 ASP n 1 69 ILE n 1 70 LEU n 1 71 LEU n 1 72 LYS n 1 73 LEU n 1 74 ILE n 1 75 SER n 2 1 SER n 2 2 SER n 2 3 PRO n 2 4 VAL n 2 5 ASP n 2 6 GLU n 2 7 ILE n 2 8 ASP n 2 9 LYS n 2 10 GLU n 2 11 VAL n 2 12 LYS n 2 13 LYS n 2 14 LEU n 2 15 GLU n 2 16 GLU n 2 17 GLU n 2 18 ALA n 2 19 LYS n 2 20 LYS n 2 21 SER n 2 22 GLN n 2 23 GLU n 2 24 GLU n 2 25 VAL n 2 26 GLU n 2 27 ARG n 2 28 LEU n 2 29 LYS n 2 30 GLN n 2 31 GLU n 2 32 VAL n 2 33 GLU n 2 34 LYS n 2 35 ALA n 2 36 SER n 2 37 LYS n 2 38 ALA n 2 39 GLY n 2 40 LEU n 2 41 ASP n 2 42 HIS n 2 43 GLU n 2 44 GLY n 2 45 ASP n 2 46 SER n 2 47 ARG n 2 48 ILE n 2 49 PHE n 2 50 LYS n 2 51 LYS n 2 52 ILE n 2 53 HIS n 2 54 ASP n 2 55 VAL n 2 56 VAL n 2 57 THR n 2 58 LYS n 2 59 GLN n 2 60 ILE n 2 61 LYS n 2 62 VAL n 2 63 ILE n 2 64 ILE n 2 65 ARG n 2 66 LEU n 2 67 ILE n 2 68 GLU n 2 69 VAL n 2 70 TYR n 2 71 VAL n 2 72 ARG n 2 73 LEU n 2 74 VAL n 2 75 GLU n 2 76 ILE n 2 77 ILE n 2 78 LEU n 3 1 GLY n 3 2 SER n 3 3 LYS n 3 4 GLN n 3 5 LYS n 3 6 GLU n 3 7 ALA n 3 8 ILE n 3 9 LYS n 3 10 VAL n 3 11 TYR n 3 12 LEU n 3 13 GLU n 3 14 LEU n 3 15 LEU n 3 16 GLU n 3 17 VAL n 3 18 HIS n 3 19 SER n 3 20 ARG n 3 21 VAL n 3 22 LEU n 3 23 LYS n 3 24 ALA n 3 25 LEU n 3 26 ILE n 3 27 GLU n 3 28 GLN n 3 29 ILE n 3 30 LYS n 3 31 LEU n 3 32 PHE n 3 33 ILE n 3 34 GLU n 3 35 LEU n 3 36 ILE n 3 37 LYS n 3 38 ARG n 3 39 PRO n 3 40 ASP n 3 41 GLU n 3 42 ASP n 3 43 LEU n 3 44 ALA n 3 45 ASP n 3 46 LYS n 3 47 VAL n 3 48 ARG n 3 49 LYS n 3 50 SER n 3 51 SER n 3 52 GLU n 3 53 GLU n 3 54 LEU n 3 55 LYS n 3 56 LYS n 3 57 ILE n 3 58 ILE n 3 59 LYS n 3 60 GLU n 3 61 VAL n 3 62 GLU n 3 63 LYS n 3 64 ILE n 3 65 LEU n 3 66 ARG n 3 67 LYS n 3 68 VAL n 3 69 ASP n 3 70 ASP n 3 71 ILE n 3 72 LEU n 3 73 TYR n 3 74 LYS n 3 75 VAL n 3 76 LYS n 3 77 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 75 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 78 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 sample 'Biological sequence' 1 77 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 SER 3 0 0 SER SER A . n A 1 4 PRO 4 1 1 PRO PRO A . n A 1 5 GLU 5 2 2 GLU GLU A . n A 1 6 GLU 6 3 3 GLU GLU A . n A 1 7 GLU 7 4 4 GLU GLU A . n A 1 8 LYS 8 5 5 LYS LYS A . n A 1 9 LEU 9 6 6 LEU LEU A . n A 1 10 LYS 10 7 7 LYS LYS A . n A 1 11 GLU 11 8 8 GLU GLU A . n A 1 12 LEU 12 9 9 LEU LEU A . n A 1 13 LEU 13 10 10 LEU LEU A . n A 1 14 LYS 14 11 11 LYS LYS A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 LYS 17 14 14 LYS LYS A . n A 1 18 LYS 18 15 15 LYS LYS A . n A 1 19 VAL 19 16 16 VAL VAL A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 ASP 21 18 18 ASP ASP A . n A 1 22 ARG 22 19 19 ARG ARG A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 ILE 26 23 23 ILE ILE A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 ARG 29 26 26 ARG ARG A . n A 1 30 ASN 30 27 27 ASN ASN A . n A 1 31 ASP 31 28 28 ASP ASP A . n A 1 32 GLU 32 29 29 GLU GLU A . n A 1 33 GLU 33 30 30 GLU GLU A . n A 1 34 ILE 34 31 31 ILE ILE A . n A 1 35 LYS 35 32 32 LYS LYS A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 SER 37 34 34 SER SER A . n A 1 38 ASP 38 35 35 ASP ASP A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 ASP 41 38 38 ASP ASP A . n A 1 42 ASP 42 39 39 ASP ASP A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 SER 44 41 41 SER SER A . n A 1 45 LEU 45 42 42 LEU LEU A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 GLU 47 44 44 GLU GLU A . n A 1 48 ASP 48 45 45 ASP ASP A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 VAL 50 47 47 VAL VAL A . n A 1 51 GLU 51 48 48 GLU GLU A . n A 1 52 LEU 52 49 49 LEU LEU A . n A 1 53 LEU 53 50 50 LEU LEU A . n A 1 54 LYS 54 51 51 LYS LYS A . n A 1 55 GLU 55 52 52 GLU GLU A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 ILE 57 54 54 ILE ILE A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 LEU 59 56 56 LEU LEU A . n A 1 60 TRP 60 57 57 TRP TRP A . n A 1 61 LYS 61 58 58 LYS LYS A . n A 1 62 ILE 62 59 59 ILE ILE A . n A 1 63 LEU 63 60 60 LEU LEU A . n A 1 64 VAL 64 61 61 VAL VAL A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 LEU 66 63 63 LEU LEU A . n A 1 67 SER 67 64 64 SER SER A . n A 1 68 ASP 68 65 65 ASP ASP A . n A 1 69 ILE 69 66 66 ILE ILE A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 LYS 72 69 69 LYS LYS A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 ILE 74 71 71 ILE ILE A . n A 1 75 SER 75 72 72 SER SER A . n B 2 1 SER 1 -1 -1 SER SER B . n B 2 2 SER 2 0 0 SER SER B . n B 2 3 PRO 3 1 1 PRO PRO B . n B 2 4 VAL 4 2 2 VAL VAL B . n B 2 5 ASP 5 3 3 ASP ASP B . n B 2 6 GLU 6 4 4 GLU GLU B . n B 2 7 ILE 7 5 5 ILE ILE B . n B 2 8 ASP 8 6 6 ASP ASP B . n B 2 9 LYS 9 7 7 LYS LYS B . n B 2 10 GLU 10 8 8 GLU GLU B . n B 2 11 VAL 11 9 9 VAL VAL B . n B 2 12 LYS 12 10 10 LYS LYS B . n B 2 13 LYS 13 11 11 LYS LYS B . n B 2 14 LEU 14 12 12 LEU LEU B . n B 2 15 GLU 15 13 13 GLU GLU B . n B 2 16 GLU 16 14 14 GLU GLU B . n B 2 17 GLU 17 15 15 GLU GLU B . n B 2 18 ALA 18 16 16 ALA ALA B . n B 2 19 LYS 19 17 17 LYS LYS B . n B 2 20 LYS 20 18 18 LYS LYS B . n B 2 21 SER 21 19 19 SER SER B . n B 2 22 GLN 22 20 20 GLN GLN B . n B 2 23 GLU 23 21 21 GLU GLU B . n B 2 24 GLU 24 22 22 GLU GLU B . n B 2 25 VAL 25 23 23 VAL VAL B . n B 2 26 GLU 26 24 24 GLU GLU B . n B 2 27 ARG 27 25 25 ARG ARG B . n B 2 28 LEU 28 26 26 LEU LEU B . n B 2 29 LYS 29 27 27 LYS LYS B . n B 2 30 GLN 30 28 28 GLN GLN B . n B 2 31 GLU 31 29 29 GLU GLU B . n B 2 32 VAL 32 30 30 VAL VAL B . n B 2 33 GLU 33 31 31 GLU GLU B . n B 2 34 LYS 34 32 32 LYS LYS B . n B 2 35 ALA 35 33 33 ALA ALA B . n B 2 36 SER 36 34 34 SER SER B . n B 2 37 LYS 37 35 35 LYS LYS B . n B 2 38 ALA 38 36 36 ALA ALA B . n B 2 39 GLY 39 37 37 GLY GLY B . n B 2 40 LEU 40 38 38 LEU LEU B . n B 2 41 ASP 41 39 39 ASP ASP B . n B 2 42 HIS 42 40 40 HIS HIS B . n B 2 43 GLU 43 41 41 GLU GLU B . n B 2 44 GLY 44 42 42 GLY GLY B . n B 2 45 ASP 45 43 43 ASP ASP B . n B 2 46 SER 46 44 44 SER SER B . n B 2 47 ARG 47 45 45 ARG ARG B . n B 2 48 ILE 48 46 46 ILE ILE B . n B 2 49 PHE 49 47 47 PHE PHE B . n B 2 50 LYS 50 48 48 LYS LYS B . n B 2 51 LYS 51 49 49 LYS LYS B . n B 2 52 ILE 52 50 50 ILE ILE B . n B 2 53 HIS 53 51 51 HIS HIS B . n B 2 54 ASP 54 52 52 ASP ASP B . n B 2 55 VAL 55 53 53 VAL VAL B . n B 2 56 VAL 56 54 54 VAL VAL B . n B 2 57 THR 57 55 55 THR THR B . n B 2 58 LYS 58 56 56 LYS LYS B . n B 2 59 GLN 59 57 57 GLN GLN B . n B 2 60 ILE 60 58 58 ILE ILE B . n B 2 61 LYS 61 59 59 LYS LYS B . n B 2 62 VAL 62 60 60 VAL VAL B . n B 2 63 ILE 63 61 61 ILE ILE B . n B 2 64 ILE 64 62 62 ILE ILE B . n B 2 65 ARG 65 63 63 ARG ARG B . n B 2 66 LEU 66 64 64 LEU LEU B . n B 2 67 ILE 67 65 65 ILE ILE B . n B 2 68 GLU 68 66 66 GLU GLU B . n B 2 69 VAL 69 67 67 VAL VAL B . n B 2 70 TYR 70 68 68 TYR TYR B . n B 2 71 VAL 71 69 69 VAL VAL B . n B 2 72 ARG 72 70 70 ARG ARG B . n B 2 73 LEU 73 71 71 LEU LEU B . n B 2 74 VAL 74 72 72 VAL VAL B . n B 2 75 GLU 75 73 73 GLU GLU B . n B 2 76 ILE 76 74 74 ILE ILE B . n B 2 77 ILE 77 75 75 ILE ILE B . n B 2 78 LEU 78 76 76 LEU LEU B . n C 3 1 GLY 1 -1 ? ? ? C . n C 3 2 SER 2 0 0 SER SER C . n C 3 3 LYS 3 1 1 LYS LYS C . n C 3 4 GLN 4 2 2 GLN GLN C . n C 3 5 LYS 5 3 3 LYS LYS C . n C 3 6 GLU 6 4 4 GLU GLU C . n C 3 7 ALA 7 5 5 ALA ALA C . n C 3 8 ILE 8 6 6 ILE ILE C . n C 3 9 LYS 9 7 7 LYS LYS C . n C 3 10 VAL 10 8 8 VAL VAL C . n C 3 11 TYR 11 9 9 TYR TYR C . n C 3 12 LEU 12 10 10 LEU LEU C . n C 3 13 GLU 13 11 11 GLU GLU C . n C 3 14 LEU 14 12 12 LEU LEU C . n C 3 15 LEU 15 13 13 LEU LEU C . n C 3 16 GLU 16 14 14 GLU GLU C . n C 3 17 VAL 17 15 15 VAL VAL C . n C 3 18 HIS 18 16 16 HIS HIS C . n C 3 19 SER 19 17 17 SER SER C . n C 3 20 ARG 20 18 18 ARG ARG C . n C 3 21 VAL 21 19 19 VAL VAL C . n C 3 22 LEU 22 20 20 LEU LEU C . n C 3 23 LYS 23 21 21 LYS LYS C . n C 3 24 ALA 24 22 22 ALA ALA C . n C 3 25 LEU 25 23 23 LEU LEU C . n C 3 26 ILE 26 24 24 ILE ILE C . n C 3 27 GLU 27 25 25 GLU GLU C . n C 3 28 GLN 28 26 26 GLN GLN C . n C 3 29 ILE 29 27 27 ILE ILE C . n C 3 30 LYS 30 28 28 LYS LYS C . n C 3 31 LEU 31 29 29 LEU LEU C . n C 3 32 PHE 32 30 30 PHE PHE C . n C 3 33 ILE 33 31 31 ILE ILE C . n C 3 34 GLU 34 32 32 GLU GLU C . n C 3 35 LEU 35 33 33 LEU LEU C . n C 3 36 ILE 36 34 34 ILE ILE C . n C 3 37 LYS 37 35 35 LYS LYS C . n C 3 38 ARG 38 36 36 ARG ARG C . n C 3 39 PRO 39 37 37 PRO PRO C . n C 3 40 ASP 40 38 38 ASP ASP C . n C 3 41 GLU 41 39 39 GLU GLU C . n C 3 42 ASP 42 40 40 ASP ASP C . n C 3 43 LEU 43 41 41 LEU LEU C . n C 3 44 ALA 44 42 42 ALA ALA C . n C 3 45 ASP 45 43 43 ASP ASP C . n C 3 46 LYS 46 44 44 LYS LYS C . n C 3 47 VAL 47 45 45 VAL VAL C . n C 3 48 ARG 48 46 46 ARG ARG C . n C 3 49 LYS 49 47 47 LYS LYS C . n C 3 50 SER 50 48 48 SER SER C . n C 3 51 SER 51 49 49 SER SER C . n C 3 52 GLU 52 50 50 GLU GLU C . n C 3 53 GLU 53 51 51 GLU GLU C . n C 3 54 LEU 54 52 52 LEU LEU C . n C 3 55 LYS 55 53 53 LYS LYS C . n C 3 56 LYS 56 54 54 LYS LYS C . n C 3 57 ILE 57 55 55 ILE ILE C . n C 3 58 ILE 58 56 56 ILE ILE C . n C 3 59 LYS 59 57 57 LYS LYS C . n C 3 60 GLU 60 58 58 GLU GLU C . n C 3 61 VAL 61 59 59 VAL VAL C . n C 3 62 GLU 62 60 60 GLU GLU C . n C 3 63 LYS 63 61 61 LYS LYS C . n C 3 64 ILE 64 62 62 ILE ILE C . n C 3 65 LEU 65 63 63 LEU LEU C . n C 3 66 ARG 66 64 64 ARG ARG C . n C 3 67 LYS 67 65 65 LYS LYS C . n C 3 68 VAL 68 66 66 VAL VAL C . n C 3 69 ASP 69 67 67 ASP ASP C . n C 3 70 ASP 70 68 68 ASP ASP C . n C 3 71 ILE 71 69 69 ILE ILE C . n C 3 72 LEU 72 70 70 LEU LEU C . n C 3 73 TYR 73 71 71 TYR TYR C . n C 3 74 LYS 74 72 72 LYS LYS C . n C 3 75 VAL 75 73 73 VAL VAL C . n C 3 76 LYS 76 74 74 LYS LYS C . n C 3 77 SER 77 75 75 SER SER C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 HOH 1 101 5 HOH HOH A . E 4 HOH 1 101 3 HOH HOH B . F 4 HOH 1 101 4 HOH HOH C . F 4 HOH 2 102 2 HOH HOH C . F 4 HOH 3 103 1 HOH HOH C . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _cell.angle_alpha 88.974 _cell.angle_alpha_esd ? _cell.angle_beta 105.789 _cell.angle_beta_esd ? _cell.angle_gamma 115.319 _cell.angle_gamma_esd ? _cell.entry_id 7UPO _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.250 _cell.length_a_esd ? _cell.length_b 39.920 _cell.length_b_esd ? _cell.length_c 50.420 _cell.length_c_esd ? _cell.volume 64797.244 _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UPO _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall 'P 1' _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UPO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES pH7.5, 20%(w/v) PEG8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-04-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033167 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033167 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 49.24 _reflns.entry_id 7UPO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 48.21 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11814 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 73.95 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.9 _reflns.pdbx_Rmerge_I_obs 0.04049 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.04049 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.68 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.05723 _reflns.pdbx_Rpim_I_all 0.04045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.175 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.95 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 500 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.7093 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.7093 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.003 _reflns_shell.pdbx_Rpim_I_all 0.7093 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.646 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 75.62 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UPO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 48.21 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10829 _refine.ls_number_reflns_R_free 1094 _refine.ls_number_reflns_R_work 9735 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 73.95 _refine.ls_percent_reflns_R_free 10.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2310 _refine.ls_R_factor_R_free 0.2726 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2261 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.03 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'de novo designed DHT03' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.3000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 1.1000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 40.6648 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3481 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 48.21 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1892 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1887 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0018 ? 1926 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3594 ? 2573 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0310 ? 311 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0024 ? 318 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.6491 ? 804 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.10 2.20 . . 52 439 26.73 . . . 0.3985 . 0.3195 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.20 2.31 . . 79 707 43.04 . . . 0.3534 . 0.3380 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.31 2.46 . . 129 1127 69.05 . . . 0.3719 . 0.3110 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.46 2.65 . . 159 1392 84.62 . . . 0.3753 . 0.2954 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.65 2.91 . . 160 1456 88.40 . . . 0.3263 . 0.2906 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.91 3.33 . . 167 1491 90.60 . . . 0.3675 . 0.2755 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.33 4.20 . . 174 1560 94.44 . . . 0.3072 . 0.2167 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.20 48.21 . . 174 1563 95.02 . . . 0.1905 . 0.1789 . . . . . . . . . . . # _struct.entry_id 7UPO _struct.title 'Crystal structure of designed heterotrimeric assembly DHT03' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UPO _struct_keywords.text 'de novo designed protein, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 7UPO 7UPO ? 1 ? 1 2 PDB 7UPO 7UPO ? 2 ? 1 3 PDB 7UPO 7UPO ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7UPO A 1 ? 75 ? 7UPO -2 ? 72 ? -2 72 2 2 7UPO B 1 ? 78 ? 7UPO -1 ? 76 ? -1 76 3 3 7UPO C 1 ? 77 ? 7UPO -1 ? 75 ? -1 75 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6700 ? 1 MORE -71 ? 1 'SSA (A^2)' 12180 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 1 'mass spectrometry' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? LYS A 35 ? SER A 0 LYS A 32 1 ? 33 HELX_P HELX_P2 AA2 ASP A 41 ? SER A 75 ? ASP A 38 SER A 72 1 ? 35 HELX_P HELX_P3 AA3 SER B 2 ? LYS B 37 ? SER B 0 LYS B 35 1 ? 36 HELX_P HELX_P4 AA4 ASP B 41 ? LEU B 78 ? ASP B 39 LEU B 76 1 ? 38 HELX_P HELX_P5 AA5 LYS C 3 ? ARG C 38 ? LYS C 1 ARG C 36 1 ? 36 HELX_P HELX_P6 AA6 ASP C 40 ? LYS C 76 ? ASP C 38 LYS C 74 1 ? 37 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 34 ? ? 61.59 -170.50 2 1 ASP A 35 ? ? 60.55 -139.75 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 7.08447110515 16.0499922568 19.7052115859 0.684203429233 ? -0.304302790231 ? -0.0751796894812 ? 0.74628888111 ? 0.158979921355 ? 0.363778727852 ? 7.25919717235 ? -2.27838474128 ? -2.11419015985 ? 9.3282798718 ? 3.75108246482 ? 8.87098871734 ? -0.262788685426 ? -1.29176239604 ? -0.722108680793 ? 1.13208808125 ? -0.425102901251 ? 1.78790579823 ? 0.733983206175 ? -0.112776128054 ? 0.316914933426 ? 2 'X-RAY DIFFRACTION' ? refined 5.49461628488 19.191674405 10.8299123555 0.40561190603 ? -0.0584338468731 ? -0.0402820835673 ? 0.538485649551 ? 0.0450641587571 ? 0.45985913994 ? 6.57892896642 ? -0.136314396344 ? 1.65728541068 ? 0.946725090587 ? -1.60738794569 ? 3.63334510098 ? 0.263415088029 ? -0.183537234941 ? -0.255310244967 ? 0.319391431955 ? 0.11750091551 ? 0.528296310432 ? 0.46608456688 ? 0.473179733378 ? -0.241437500552 ? 3 'X-RAY DIFFRACTION' ? refined 25.0660522815 21.4891034399 7.62149481398 0.243788196511 ? -0.00142892403388 ? 0.0124134194592 ? 0.31675670076 ? -0.0439838287094 ? 0.551966418485 ? 6.34468965157 ? 1.63112474079 ? -0.0503975334602 ? 7.99749075196 ? 5.26710550454 ? 3.8154868852 ? 0.0404575060549 ? 0.043096017015 ? 0.110192984398 ? 0.189344192766 ? 0.338630691851 ? -0.466556263616 ? 0.0339004806423 ? 0.74454748469 ? -0.453242819829 ? 4 'X-RAY DIFFRACTION' ? refined 16.4155856176 14.6555313211 7.60079301869 0.464180017234 ? 0.0929805820825 ? -0.087034896078 ? 0.366630993765 ? 0.0235362418818 ? 0.421849354384 ? 4.40798816535 ? 1.96221315318 ? -0.472612673778 ? 6.70961852236 ? 4.68905739461 ? 8.86341898898 ? 0.134965081152 ? 0.323216448544 ? -0.0744786999137 ? 0.296436574622 ? 0.0156388710092 ? -0.232339551096 ? 1.10368283713 ? -0.16669540022 ? -0.17464471749 ? 5 'X-RAY DIFFRACTION' ? refined 14.5537010723 25.8672852226 7.47571844178 0.396178388797 ? -0.0400520024847 ? 0.0263915415376 ? 0.369123055899 ? 0.0829739533807 ? 0.378281865529 ? 6.2386622155 ? 0.937942090343 ? 0.75816686499 ? 6.30624038653 ? 3.7401540663 ? 4.48850490925 ? 0.139466998591 ? 0.380710191314 ? 0.371529205075 ? -0.0167447723832 ? 0.228321306148 ? -0.2919714379 ? -0.268251304177 ? 0.474468489532 ? -0.284604529866 ? 6 'X-RAY DIFFRACTION' ? refined 3.6477655184 26.1853514333 4.29975959988 0.383460756815 ? 0.00729547045546 ? -0.0710825662436 ? 0.312842998351 ? 0.0361990411683 ? 0.486665462533 ? 9.07804141872 ? 7.69945909446 ? 4.25319928906 ? 8.70597750421 ? 5.08906830142 ? 5.70690014038 ? -0.462195406626 ? 0.441621046247 ? 0.612800201695 ? -0.87703469778 ? 0.0402891135948 ? 0.398874862349 ? -0.893456892304 ? 0.302971109141 ? 0.46887160573 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A -1 ? A 35 A 33 ? ? ;chain 'A' and (resid -1 through 33 ) ; 2 'X-RAY DIFFRACTION' 2 A 36 A 34 ? A 75 A 72 ? ? ;chain 'A' and (resid 34 through 72 ) ; 3 'X-RAY DIFFRACTION' 3 B 1 B -1 ? B 37 B 34 ? ? ;chain 'B' and (resid -1 through 34 ) ; 4 'X-RAY DIFFRACTION' 4 B 38 B 35 ? B 79 B 76 ? ? ;chain 'B' and (resid 35 through 76 ) ; 5 'X-RAY DIFFRACTION' 5 C 1 C 0 ? C 39 C 38 ? ? ;chain 'C' and (resid 0 through 38 ) ; 6 'X-RAY DIFFRACTION' 6 C 40 C 39 ? C 77 C 75 ? ? ;chain 'C' and (resid 39 through 75 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 C GLY -1 ? C GLY 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TRP N N N N 287 TRP CA C N S 288 TRP C C N N 289 TRP O O N N 290 TRP CB C N N 291 TRP CG C Y N 292 TRP CD1 C Y N 293 TRP CD2 C Y N 294 TRP NE1 N Y N 295 TRP CE2 C Y N 296 TRP CE3 C Y N 297 TRP CZ2 C Y N 298 TRP CZ3 C Y N 299 TRP CH2 C Y N 300 TRP OXT O N N 301 TRP H H N N 302 TRP H2 H N N 303 TRP HA H N N 304 TRP HB2 H N N 305 TRP HB3 H N N 306 TRP HD1 H N N 307 TRP HE1 H N N 308 TRP HE3 H N N 309 TRP HZ2 H N N 310 TRP HZ3 H N N 311 TRP HH2 H N N 312 TRP HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PRO N CA sing N N 228 PRO N CD sing N N 229 PRO N H sing N N 230 PRO CA C sing N N 231 PRO CA CB sing N N 232 PRO CA HA sing N N 233 PRO C O doub N N 234 PRO C OXT sing N N 235 PRO CB CG sing N N 236 PRO CB HB2 sing N N 237 PRO CB HB3 sing N N 238 PRO CG CD sing N N 239 PRO CG HG2 sing N N 240 PRO CG HG3 sing N N 241 PRO CD HD2 sing N N 242 PRO CD HD3 sing N N 243 PRO OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TRP N CA sing N N 274 TRP N H sing N N 275 TRP N H2 sing N N 276 TRP CA C sing N N 277 TRP CA CB sing N N 278 TRP CA HA sing N N 279 TRP C O doub N N 280 TRP C OXT sing N N 281 TRP CB CG sing N N 282 TRP CB HB2 sing N N 283 TRP CB HB3 sing N N 284 TRP CG CD1 doub Y N 285 TRP CG CD2 sing Y N 286 TRP CD1 NE1 sing Y N 287 TRP CD1 HD1 sing N N 288 TRP CD2 CE2 doub Y N 289 TRP CD2 CE3 sing Y N 290 TRP NE1 CE2 sing Y N 291 TRP NE1 HE1 sing N N 292 TRP CE2 CZ2 sing Y N 293 TRP CE3 CZ3 doub Y N 294 TRP CE3 HE3 sing N N 295 TRP CZ2 CH2 doub Y N 296 TRP CZ2 HZ2 sing N N 297 TRP CZ3 CH2 sing Y N 298 TRP CZ3 HZ3 sing N N 299 TRP CH2 HH2 sing N N 300 TRP OXT HXT sing N N 301 TYR N CA sing N N 302 TYR N H sing N N 303 TYR N H2 sing N N 304 TYR CA C sing N N 305 TYR CA CB sing N N 306 TYR CA HA sing N N 307 TYR C O doub N N 308 TYR C OXT sing N N 309 TYR CB CG sing N N 310 TYR CB HB2 sing N N 311 TYR CB HB3 sing N N 312 TYR CG CD1 doub Y N 313 TYR CG CD2 sing Y N 314 TYR CD1 CE1 sing Y N 315 TYR CD1 HD1 sing N N 316 TYR CD2 CE2 doub Y N 317 TYR CD2 HD2 sing N N 318 TYR CE1 CZ doub Y N 319 TYR CE1 HE1 sing N N 320 TYR CE2 CZ sing Y N 321 TYR CE2 HE2 sing N N 322 TYR CZ OH sing N N 323 TYR OH HH sing N N 324 TYR OXT HXT sing N N 325 VAL N CA sing N N 326 VAL N H sing N N 327 VAL N H2 sing N N 328 VAL CA C sing N N 329 VAL CA CB sing N N 330 VAL CA HA sing N N 331 VAL C O doub N N 332 VAL C OXT sing N N 333 VAL CB CG1 sing N N 334 VAL CB CG2 sing N N 335 VAL CB HB sing N N 336 VAL CG1 HG11 sing N N 337 VAL CG1 HG12 sing N N 338 VAL CG1 HG13 sing N N 339 VAL CG2 HG21 sing N N 340 VAL CG2 HG22 sing N N 341 VAL CG2 HG23 sing N N 342 VAL OXT HXT sing N N 343 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM128777 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'de novo designed DHT03' # _space_group.name_H-M_alt 'P 1' _space_group.name_Hall 'P 1' _space_group.IT_number 1 _space_group.crystal_system triclinic _space_group.id 1 # _atom_sites.entry_id 7UPO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026846 _atom_sites.fract_transf_matrix[1][2] 0.012701 _atom_sites.fract_transf_matrix[1][3] 0.009087 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027712 _atom_sites.fract_transf_matrix[2][3] 0.003157 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020744 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_