data_7UWZ # _entry.id 7UWZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UWZ pdb_00007uwz 10.2210/pdb7uwz/pdb WWPDB D_1000264996 ? ? BMRB 31018 ? 10.13018/BMR31018 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-22 2 'Structure model' 1 1 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7UWZ _pdbx_database_status.recvd_initial_deposition_date 2022-05-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of the De novo designed small beta-barrel protein 33_bp_sh3' _pdbx_database_related.db_id 31018 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email bvolkman@mcw.edu _pdbx_contact_author.name_first Brian _pdbx_contact_author.name_last Volkman _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6681-5179 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Peterson, F.C.' 1 0000-0001-9890-4224 'Kim, D.E.' 2 0000-0002-0023-956X 'Jensen, D.R.' 3 ? 'Saleem, A.' 4 ? 'Chow, C.M.' 5 ? 'Volkman, B.F.' 6 0000-0002-6681-5179 'Baker, D.' 7 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 120 _citation.language ? _citation.page_first e2207974120 _citation.page_last e2207974120 _citation.title 'De novo design of small beta barrel proteins.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2207974120 _citation.pdbx_database_id_PubMed 36897987 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, D.E.' 1 0000-0002-0023-956X primary 'Jensen, D.R.' 2 ? primary 'Feldman, D.' 3 ? primary 'Tischer, D.' 4 ? primary 'Saleem, A.' 5 ? primary 'Chow, C.M.' 6 0000-0001-5351-6412 primary 'Li, X.' 7 ? primary 'Carter, L.' 8 ? primary 'Milles, L.' 9 0000-0001-8417-3205 primary 'Nguyen, H.' 10 0000-0001-9696-4004 primary 'Kang, A.' 11 0000-0001-5487-0499 primary 'Bera, A.K.' 12 0000-0001-9473-2912 primary 'Peterson, F.C.' 13 ? primary 'Volkman, B.F.' 14 0000-0002-6681-5179 primary 'Ovchinnikov, S.' 15 0000-0003-2774-2744 primary 'Baker, D.' 16 0000-0001-7896-6217 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'De novo designed small beta-barrel protein 33_bp_sh3' _entity.formula_weight 7175.926 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDGFDRGADVTYTDSDGSKKTYKVLSYSGDKVTVQDSDGRTLTFDARLLRVKKWLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MDGFDRGADVTYTDSDGSKKTYKVLSYSGDKVTVQDSDGRTLTFDARLLRVKKWLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLY n 1 4 PHE n 1 5 ASP n 1 6 ARG n 1 7 GLY n 1 8 ALA n 1 9 ASP n 1 10 VAL n 1 11 THR n 1 12 TYR n 1 13 THR n 1 14 ASP n 1 15 SER n 1 16 ASP n 1 17 GLY n 1 18 SER n 1 19 LYS n 1 20 LYS n 1 21 THR n 1 22 TYR n 1 23 LYS n 1 24 VAL n 1 25 LEU n 1 26 SER n 1 27 TYR n 1 28 SER n 1 29 GLY n 1 30 ASP n 1 31 LYS n 1 32 VAL n 1 33 THR n 1 34 VAL n 1 35 GLN n 1 36 ASP n 1 37 SER n 1 38 ASP n 1 39 GLY n 1 40 ARG n 1 41 THR n 1 42 LEU n 1 43 THR n 1 44 PHE n 1 45 ASP n 1 46 ALA n 1 47 ARG n 1 48 LEU n 1 49 LEU n 1 50 ARG n 1 51 VAL n 1 52 LYS n 1 53 LYS n 1 54 TRP n 1 55 LEU n 1 56 GLU n 1 57 HIS n 1 58 HIS n 1 59 HIS n 1 60 HIS n 1 61 HIS n 1 62 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 62 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 HIS 62 62 62 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UWZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7UWZ _struct.title 'NMR solution structure of the De novo designed small beta-barrel protein 33_bp_sh3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UWZ _struct_keywords.text 'protein design, high-throughput screening, small beta barrels, machine learning, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7UWZ _struct_ref.pdbx_db_accession 7UWZ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UWZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7UWZ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 62 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 62 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 49 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 47 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 49 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 41 ? ASP A 45 ? THR A 41 ASP A 45 AA1 2 LYS A 31 ? GLN A 35 ? LYS A 31 GLN A 35 AA1 3 LYS A 19 ? SER A 28 ? LYS A 19 SER A 28 AA1 4 ASP A 9 ? THR A 13 ? ASP A 9 THR A 13 AA1 5 ARG A 50 ? VAL A 51 ? ARG A 50 VAL A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 44 ? O PHE A 44 N VAL A 32 ? N VAL A 32 AA1 2 3 O THR A 33 ? O THR A 33 N LEU A 25 ? N LEU A 25 AA1 3 4 O LYS A 20 ? O LYS A 20 N TYR A 12 ? N TYR A 12 AA1 4 5 N THR A 11 ? N THR A 11 O ARG A 50 ? O ARG A 50 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HZ1 A LYS 52 ? ? OE2 A GLU 56 ? ? 1.58 2 5 HZ2 A LYS 20 ? ? OD2 A ASP 36 ? ? 1.59 3 6 HZ2 A LYS 52 ? ? OE1 A GLU 56 ? ? 1.59 4 7 OD2 A ASP 9 ? ? HZ3 A LYS 23 ? ? 1.59 5 10 HZ3 A LYS 31 ? ? OD2 A ASP 45 ? ? 1.60 6 15 OD1 A ASP 30 ? ? HZ2 A LYS 31 ? ? 1.56 7 18 OD1 A ASP 9 ? ? HZ3 A LYS 23 ? ? 1.59 8 19 OD2 A ASP 30 ? ? HZ1 A LYS 31 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 55 ? ? -79.93 36.59 2 1 HIS A 61 ? ? 65.43 174.03 3 2 LYS A 52 ? ? -104.25 77.98 4 2 TRP A 54 ? ? 64.89 -168.16 5 2 HIS A 58 ? ? 64.03 102.39 6 2 HIS A 60 ? ? -100.93 -73.93 7 3 LYS A 53 ? ? -155.24 33.72 8 3 TRP A 54 ? ? 69.72 -167.27 9 3 HIS A 61 ? ? 59.86 86.91 10 6 LYS A 52 ? ? -101.01 76.34 11 6 LEU A 55 ? ? 54.43 76.83 12 6 HIS A 58 ? ? 72.02 -62.71 13 7 VAL A 51 ? ? -66.53 2.16 14 7 LYS A 52 ? ? 71.68 -47.32 15 7 LEU A 55 ? ? 75.60 98.40 16 7 HIS A 60 ? ? 67.21 167.78 17 7 HIS A 61 ? ? 60.08 105.93 18 8 TRP A 54 ? ? 73.33 162.55 19 8 HIS A 60 ? ? -117.24 68.57 20 8 HIS A 61 ? ? 179.14 158.18 21 9 TRP A 54 ? ? 67.37 161.79 22 9 LEU A 55 ? ? 64.22 173.91 23 9 HIS A 59 ? ? 54.72 95.57 24 11 HIS A 61 ? ? 172.30 -38.27 25 12 HIS A 58 ? ? 68.39 111.94 26 12 HIS A 59 ? ? -149.95 -59.10 27 12 HIS A 61 ? ? -152.39 -55.04 28 13 LEU A 55 ? ? -69.95 98.73 29 13 HIS A 58 ? ? 49.55 78.45 30 14 LYS A 53 ? ? 74.99 101.50 31 15 HIS A 58 ? ? 67.79 -46.25 32 16 HIS A 58 ? ? 65.24 118.18 33 17 LYS A 52 ? ? -111.91 77.30 34 17 HIS A 58 ? ? 66.43 -84.72 35 17 HIS A 59 ? ? -162.57 -33.73 36 17 HIS A 60 ? ? 73.08 -60.89 37 17 HIS A 61 ? ? -168.82 86.55 38 18 HIS A 61 ? ? 172.39 -35.10 39 19 LYS A 53 ? ? -94.78 39.73 40 19 HIS A 58 ? ? 62.65 168.44 41 19 HIS A 59 ? ? -172.91 101.47 42 20 LYS A 53 ? ? 65.07 82.54 # _pdbx_nmr_ensemble.entry_id 7UWZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7UWZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.25 mM [U-13C; U-15N] 33_bp_sh3, 50 mM sodium phosphate, 50 mM sodium chloride, 0.02 % w/v sodium azide, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 33_bp_sh3 1.25 ? mM '[U-13C; U-15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 'sodium azide' 0.02 ? '% w/v' 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 132 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 3 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 7UWZ 'torsion angle dynamics' ? 7 7UWZ 'molecular dynamics' ? 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'data analysis' TopSpin 3.6 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'data analysis' XEASY ? 'Bartels et al.' 4 'chemical shift assignment' GARANT ? 'Bartels, Guntert, Billeter and Wuthrich' 7 refinement CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 6 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 5 'data analysis' TALOS ? 'Cornilescu, Delaglio and Bax' 8 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 9 'geometry optimization' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 LEU N N N N 127 LEU CA C N S 128 LEU C C N N 129 LEU O O N N 130 LEU CB C N N 131 LEU CG C N N 132 LEU CD1 C N N 133 LEU CD2 C N N 134 LEU OXT O N N 135 LEU H H N N 136 LEU H2 H N N 137 LEU HA H N N 138 LEU HB2 H N N 139 LEU HB3 H N N 140 LEU HG H N N 141 LEU HD11 H N N 142 LEU HD12 H N N 143 LEU HD13 H N N 144 LEU HD21 H N N 145 LEU HD22 H N N 146 LEU HD23 H N N 147 LEU HXT H N N 148 LYS N N N N 149 LYS CA C N S 150 LYS C C N N 151 LYS O O N N 152 LYS CB C N N 153 LYS CG C N N 154 LYS CD C N N 155 LYS CE C N N 156 LYS NZ N N N 157 LYS OXT O N N 158 LYS H H N N 159 LYS H2 H N N 160 LYS HA H N N 161 LYS HB2 H N N 162 LYS HB3 H N N 163 LYS HG2 H N N 164 LYS HG3 H N N 165 LYS HD2 H N N 166 LYS HD3 H N N 167 LYS HE2 H N N 168 LYS HE3 H N N 169 LYS HZ1 H N N 170 LYS HZ2 H N N 171 LYS HZ3 H N N 172 LYS HXT H N N 173 MET N N N N 174 MET CA C N S 175 MET C C N N 176 MET O O N N 177 MET CB C N N 178 MET CG C N N 179 MET SD S N N 180 MET CE C N N 181 MET OXT O N N 182 MET H H N N 183 MET H2 H N N 184 MET HA H N N 185 MET HB2 H N N 186 MET HB3 H N N 187 MET HG2 H N N 188 MET HG3 H N N 189 MET HE1 H N N 190 MET HE2 H N N 191 MET HE3 H N N 192 MET HXT H N N 193 PHE N N N N 194 PHE CA C N S 195 PHE C C N N 196 PHE O O N N 197 PHE CB C N N 198 PHE CG C Y N 199 PHE CD1 C Y N 200 PHE CD2 C Y N 201 PHE CE1 C Y N 202 PHE CE2 C Y N 203 PHE CZ C Y N 204 PHE OXT O N N 205 PHE H H N N 206 PHE H2 H N N 207 PHE HA H N N 208 PHE HB2 H N N 209 PHE HB3 H N N 210 PHE HD1 H N N 211 PHE HD2 H N N 212 PHE HE1 H N N 213 PHE HE2 H N N 214 PHE HZ H N N 215 PHE HXT H N N 216 SER N N N N 217 SER CA C N S 218 SER C C N N 219 SER O O N N 220 SER CB C N N 221 SER OG O N N 222 SER OXT O N N 223 SER H H N N 224 SER H2 H N N 225 SER HA H N N 226 SER HB2 H N N 227 SER HB3 H N N 228 SER HG H N N 229 SER HXT H N N 230 THR N N N N 231 THR CA C N S 232 THR C C N N 233 THR O O N N 234 THR CB C N R 235 THR OG1 O N N 236 THR CG2 C N N 237 THR OXT O N N 238 THR H H N N 239 THR H2 H N N 240 THR HA H N N 241 THR HB H N N 242 THR HG1 H N N 243 THR HG21 H N N 244 THR HG22 H N N 245 THR HG23 H N N 246 THR HXT H N N 247 TRP N N N N 248 TRP CA C N S 249 TRP C C N N 250 TRP O O N N 251 TRP CB C N N 252 TRP CG C Y N 253 TRP CD1 C Y N 254 TRP CD2 C Y N 255 TRP NE1 N Y N 256 TRP CE2 C Y N 257 TRP CE3 C Y N 258 TRP CZ2 C Y N 259 TRP CZ3 C Y N 260 TRP CH2 C Y N 261 TRP OXT O N N 262 TRP H H N N 263 TRP H2 H N N 264 TRP HA H N N 265 TRP HB2 H N N 266 TRP HB3 H N N 267 TRP HD1 H N N 268 TRP HE1 H N N 269 TRP HE3 H N N 270 TRP HZ2 H N N 271 TRP HZ3 H N N 272 TRP HH2 H N N 273 TRP HXT H N N 274 TYR N N N N 275 TYR CA C N S 276 TYR C C N N 277 TYR O O N N 278 TYR CB C N N 279 TYR CG C Y N 280 TYR CD1 C Y N 281 TYR CD2 C Y N 282 TYR CE1 C Y N 283 TYR CE2 C Y N 284 TYR CZ C Y N 285 TYR OH O N N 286 TYR OXT O N N 287 TYR H H N N 288 TYR H2 H N N 289 TYR HA H N N 290 TYR HB2 H N N 291 TYR HB3 H N N 292 TYR HD1 H N N 293 TYR HD2 H N N 294 TYR HE1 H N N 295 TYR HE2 H N N 296 TYR HH H N N 297 TYR HXT H N N 298 VAL N N N N 299 VAL CA C N S 300 VAL C C N N 301 VAL O O N N 302 VAL CB C N N 303 VAL CG1 C N N 304 VAL CG2 C N N 305 VAL OXT O N N 306 VAL H H N N 307 VAL H2 H N N 308 VAL HA H N N 309 VAL HB H N N 310 VAL HG11 H N N 311 VAL HG12 H N N 312 VAL HG13 H N N 313 VAL HG21 H N N 314 VAL HG22 H N N 315 VAL HG23 H N N 316 VAL HXT H N N 317 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 LEU N CA sing N N 121 LEU N H sing N N 122 LEU N H2 sing N N 123 LEU CA C sing N N 124 LEU CA CB sing N N 125 LEU CA HA sing N N 126 LEU C O doub N N 127 LEU C OXT sing N N 128 LEU CB CG sing N N 129 LEU CB HB2 sing N N 130 LEU CB HB3 sing N N 131 LEU CG CD1 sing N N 132 LEU CG CD2 sing N N 133 LEU CG HG sing N N 134 LEU CD1 HD11 sing N N 135 LEU CD1 HD12 sing N N 136 LEU CD1 HD13 sing N N 137 LEU CD2 HD21 sing N N 138 LEU CD2 HD22 sing N N 139 LEU CD2 HD23 sing N N 140 LEU OXT HXT sing N N 141 LYS N CA sing N N 142 LYS N H sing N N 143 LYS N H2 sing N N 144 LYS CA C sing N N 145 LYS CA CB sing N N 146 LYS CA HA sing N N 147 LYS C O doub N N 148 LYS C OXT sing N N 149 LYS CB CG sing N N 150 LYS CB HB2 sing N N 151 LYS CB HB3 sing N N 152 LYS CG CD sing N N 153 LYS CG HG2 sing N N 154 LYS CG HG3 sing N N 155 LYS CD CE sing N N 156 LYS CD HD2 sing N N 157 LYS CD HD3 sing N N 158 LYS CE NZ sing N N 159 LYS CE HE2 sing N N 160 LYS CE HE3 sing N N 161 LYS NZ HZ1 sing N N 162 LYS NZ HZ2 sing N N 163 LYS NZ HZ3 sing N N 164 LYS OXT HXT sing N N 165 MET N CA sing N N 166 MET N H sing N N 167 MET N H2 sing N N 168 MET CA C sing N N 169 MET CA CB sing N N 170 MET CA HA sing N N 171 MET C O doub N N 172 MET C OXT sing N N 173 MET CB CG sing N N 174 MET CB HB2 sing N N 175 MET CB HB3 sing N N 176 MET CG SD sing N N 177 MET CG HG2 sing N N 178 MET CG HG3 sing N N 179 MET SD CE sing N N 180 MET CE HE1 sing N N 181 MET CE HE2 sing N N 182 MET CE HE3 sing N N 183 MET OXT HXT sing N N 184 PHE N CA sing N N 185 PHE N H sing N N 186 PHE N H2 sing N N 187 PHE CA C sing N N 188 PHE CA CB sing N N 189 PHE CA HA sing N N 190 PHE C O doub N N 191 PHE C OXT sing N N 192 PHE CB CG sing N N 193 PHE CB HB2 sing N N 194 PHE CB HB3 sing N N 195 PHE CG CD1 doub Y N 196 PHE CG CD2 sing Y N 197 PHE CD1 CE1 sing Y N 198 PHE CD1 HD1 sing N N 199 PHE CD2 CE2 doub Y N 200 PHE CD2 HD2 sing N N 201 PHE CE1 CZ doub Y N 202 PHE CE1 HE1 sing N N 203 PHE CE2 CZ sing Y N 204 PHE CE2 HE2 sing N N 205 PHE CZ HZ sing N N 206 PHE OXT HXT sing N N 207 SER N CA sing N N 208 SER N H sing N N 209 SER N H2 sing N N 210 SER CA C sing N N 211 SER CA CB sing N N 212 SER CA HA sing N N 213 SER C O doub N N 214 SER C OXT sing N N 215 SER CB OG sing N N 216 SER CB HB2 sing N N 217 SER CB HB3 sing N N 218 SER OG HG sing N N 219 SER OXT HXT sing N N 220 THR N CA sing N N 221 THR N H sing N N 222 THR N H2 sing N N 223 THR CA C sing N N 224 THR CA CB sing N N 225 THR CA HA sing N N 226 THR C O doub N N 227 THR C OXT sing N N 228 THR CB OG1 sing N N 229 THR CB CG2 sing N N 230 THR CB HB sing N N 231 THR OG1 HG1 sing N N 232 THR CG2 HG21 sing N N 233 THR CG2 HG22 sing N N 234 THR CG2 HG23 sing N N 235 THR OXT HXT sing N N 236 TRP N CA sing N N 237 TRP N H sing N N 238 TRP N H2 sing N N 239 TRP CA C sing N N 240 TRP CA CB sing N N 241 TRP CA HA sing N N 242 TRP C O doub N N 243 TRP C OXT sing N N 244 TRP CB CG sing N N 245 TRP CB HB2 sing N N 246 TRP CB HB3 sing N N 247 TRP CG CD1 doub Y N 248 TRP CG CD2 sing Y N 249 TRP CD1 NE1 sing Y N 250 TRP CD1 HD1 sing N N 251 TRP CD2 CE2 doub Y N 252 TRP CD2 CE3 sing Y N 253 TRP NE1 CE2 sing Y N 254 TRP NE1 HE1 sing N N 255 TRP CE2 CZ2 sing Y N 256 TRP CE3 CZ3 doub Y N 257 TRP CE3 HE3 sing N N 258 TRP CZ2 CH2 doub Y N 259 TRP CZ2 HZ2 sing N N 260 TRP CZ3 CH2 sing Y N 261 TRP CZ3 HZ3 sing N N 262 TRP CH2 HH2 sing N N 263 TRP OXT HXT sing N N 264 TYR N CA sing N N 265 TYR N H sing N N 266 TYR N H2 sing N N 267 TYR CA C sing N N 268 TYR CA CB sing N N 269 TYR CA HA sing N N 270 TYR C O doub N N 271 TYR C OXT sing N N 272 TYR CB CG sing N N 273 TYR CB HB2 sing N N 274 TYR CB HB3 sing N N 275 TYR CG CD1 doub Y N 276 TYR CG CD2 sing Y N 277 TYR CD1 CE1 sing Y N 278 TYR CD1 HD1 sing N N 279 TYR CD2 CE2 doub Y N 280 TYR CD2 HD2 sing N N 281 TYR CE1 CZ doub Y N 282 TYR CE1 HE1 sing N N 283 TYR CE2 CZ sing Y N 284 TYR CE2 HE2 sing N N 285 TYR CZ OH sing N N 286 TYR OH HH sing N N 287 TYR OXT HXT sing N N 288 VAL N CA sing N N 289 VAL N H sing N N 290 VAL N H2 sing N N 291 VAL CA C sing N N 292 VAL CA CB sing N N 293 VAL CA HA sing N N 294 VAL C O doub N N 295 VAL C OXT sing N N 296 VAL CB CG1 sing N N 297 VAL CB CG2 sing N N 298 VAL CB HB sing N N 299 VAL CG1 HG11 sing N N 300 VAL CG1 HG12 sing N N 301 VAL CG1 HG13 sing N N 302 VAL CG2 HG21 sing N N 303 VAL CG2 HG22 sing N N 304 VAL CG2 HG23 sing N N 305 VAL OXT HXT sing N N 306 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'R37 AI058072' 1 'National Institutes of Health/National Center for Research Resources (NIH/NCRR)' 'United States' 'S10 OD020000' 2 'Department of Energy (DOE, United States)' 'United States' DE-SC0018940 3 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' R01CA240339 4 'National Institutes of Health/National Institute on Aging (NIH/NIA)' 'United States' 5U19AG065156 5 'National Institutes of Health/Office of the Director' 'United States' DP5OD026389 6 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7UWZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_