data_7V8X # _entry.id 7V8X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7V8X pdb_00007v8x 10.2210/pdb7v8x/pdb WWPDB D_1300024284 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-31 2 'Structure model' 1 1 2023-03-15 3 'Structure model' 1 2 2023-11-29 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7V8X _pdbx_database_status.recvd_initial_deposition_date 2021-08-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Son, J.' 1 0000-0002-4963-0447 'Kim, H.' 2 ? 'Kim, H.W.' 3 0000-0002-3074-0363 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iucrj _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2052-2525 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 220 _citation.page_last 232 _citation.title 'Structural and biochemical insights into PsEst3, a new GHSR-type esterase obtained from Paenibacillus sp. R4.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2052252523001562 _citation.pdbx_database_id_PubMed 36862488 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Son, J.' 1 ? primary 'Choi, W.' 2 ? primary 'Kim, H.' 3 ? primary 'Kim, M.' 4 ? primary 'Lee, J.H.' 5 0000-0002-4831-2228 primary 'Shin, S.C.' 6 ? primary 'Kim, H.W.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man esterase 29647.170 1 ? ? ? ? 2 non-polymer syn 'phenylmethanesulfonic acid' 172.202 1 ? ? ? ? 3 water nat water 18.015 55 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGNAVVVKKDFRIDLENELFIRGEVTLVEDQIKKPVLVISHGFRGYKDWGFWPYVAAWFAERGFYVVHFDFSRVGALNSG ADEASVQKLSTVSRELSDLDAILSNLREHRLPLAEQAETERISLLGHSRAGGSNIIFAAEHSYIGSVIAWNGGPPPKAAA GNPNPFINDDVEHNKQRFDTARLLASLTAPVLIIQGGKDREALLEGQQLLKEAAPNQTYISIPDADHSFGGEHPFHHTTP YLEEALEVTHSFITKHYLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGNAVVVKKDFRIDLENELFIRGEVTLVEDQIKKPVLVISHGFRGYKDWGFWPYVAAWFAERGFYVVHFDFSRVGALNSG ADEASVQKLSTVSRELSDLDAILSNLREHRLPLAEQAETERISLLGHSRAGGSNIIFAAEHSYIGSVIAWNGGPPPKAAA GNPNPFINDDVEHNKQRFDTARLLASLTAPVLIIQGGKDREALLEGQQLLKEAAPNQTYISIPDADHSFGGEHPFHHTTP YLEEALEVTHSFITKHYLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'phenylmethanesulfonic acid' PMS 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 ALA n 1 5 VAL n 1 6 VAL n 1 7 VAL n 1 8 LYS n 1 9 LYS n 1 10 ASP n 1 11 PHE n 1 12 ARG n 1 13 ILE n 1 14 ASP n 1 15 LEU n 1 16 GLU n 1 17 ASN n 1 18 GLU n 1 19 LEU n 1 20 PHE n 1 21 ILE n 1 22 ARG n 1 23 GLY n 1 24 GLU n 1 25 VAL n 1 26 THR n 1 27 LEU n 1 28 VAL n 1 29 GLU n 1 30 ASP n 1 31 GLN n 1 32 ILE n 1 33 LYS n 1 34 LYS n 1 35 PRO n 1 36 VAL n 1 37 LEU n 1 38 VAL n 1 39 ILE n 1 40 SER n 1 41 HIS n 1 42 GLY n 1 43 PHE n 1 44 ARG n 1 45 GLY n 1 46 TYR n 1 47 LYS n 1 48 ASP n 1 49 TRP n 1 50 GLY n 1 51 PHE n 1 52 TRP n 1 53 PRO n 1 54 TYR n 1 55 VAL n 1 56 ALA n 1 57 ALA n 1 58 TRP n 1 59 PHE n 1 60 ALA n 1 61 GLU n 1 62 ARG n 1 63 GLY n 1 64 PHE n 1 65 TYR n 1 66 VAL n 1 67 VAL n 1 68 HIS n 1 69 PHE n 1 70 ASP n 1 71 PHE n 1 72 SER n 1 73 ARG n 1 74 VAL n 1 75 GLY n 1 76 ALA n 1 77 LEU n 1 78 ASN n 1 79 SER n 1 80 GLY n 1 81 ALA n 1 82 ASP n 1 83 GLU n 1 84 ALA n 1 85 SER n 1 86 VAL n 1 87 GLN n 1 88 LYS n 1 89 LEU n 1 90 SER n 1 91 THR n 1 92 VAL n 1 93 SER n 1 94 ARG n 1 95 GLU n 1 96 LEU n 1 97 SER n 1 98 ASP n 1 99 LEU n 1 100 ASP n 1 101 ALA n 1 102 ILE n 1 103 LEU n 1 104 SER n 1 105 ASN n 1 106 LEU n 1 107 ARG n 1 108 GLU n 1 109 HIS n 1 110 ARG n 1 111 LEU n 1 112 PRO n 1 113 LEU n 1 114 ALA n 1 115 GLU n 1 116 GLN n 1 117 ALA n 1 118 GLU n 1 119 THR n 1 120 GLU n 1 121 ARG n 1 122 ILE n 1 123 SER n 1 124 LEU n 1 125 LEU n 1 126 GLY n 1 127 HIS n 1 128 SER n 1 129 ARG n 1 130 ALA n 1 131 GLY n 1 132 GLY n 1 133 SER n 1 134 ASN n 1 135 ILE n 1 136 ILE n 1 137 PHE n 1 138 ALA n 1 139 ALA n 1 140 GLU n 1 141 HIS n 1 142 SER n 1 143 TYR n 1 144 ILE n 1 145 GLY n 1 146 SER n 1 147 VAL n 1 148 ILE n 1 149 ALA n 1 150 TRP n 1 151 ASN n 1 152 GLY n 1 153 GLY n 1 154 PRO n 1 155 PRO n 1 156 PRO n 1 157 LYS n 1 158 ALA n 1 159 ALA n 1 160 ALA n 1 161 GLY n 1 162 ASN n 1 163 PRO n 1 164 ASN n 1 165 PRO n 1 166 PHE n 1 167 ILE n 1 168 ASN n 1 169 ASP n 1 170 ASP n 1 171 VAL n 1 172 GLU n 1 173 HIS n 1 174 ASN n 1 175 LYS n 1 176 GLN n 1 177 ARG n 1 178 PHE n 1 179 ASP n 1 180 THR n 1 181 ALA n 1 182 ARG n 1 183 LEU n 1 184 LEU n 1 185 ALA n 1 186 SER n 1 187 LEU n 1 188 THR n 1 189 ALA n 1 190 PRO n 1 191 VAL n 1 192 LEU n 1 193 ILE n 1 194 ILE n 1 195 GLN n 1 196 GLY n 1 197 GLY n 1 198 LYS n 1 199 ASP n 1 200 ARG n 1 201 GLU n 1 202 ALA n 1 203 LEU n 1 204 LEU n 1 205 GLU n 1 206 GLY n 1 207 GLN n 1 208 GLN n 1 209 LEU n 1 210 LEU n 1 211 LYS n 1 212 GLU n 1 213 ALA n 1 214 ALA n 1 215 PRO n 1 216 ASN n 1 217 GLN n 1 218 THR n 1 219 TYR n 1 220 ILE n 1 221 SER n 1 222 ILE n 1 223 PRO n 1 224 ASP n 1 225 ALA n 1 226 ASP n 1 227 HIS n 1 228 SER n 1 229 PHE n 1 230 GLY n 1 231 GLY n 1 232 GLU n 1 233 HIS n 1 234 PRO n 1 235 PHE n 1 236 HIS n 1 237 HIS n 1 238 THR n 1 239 THR n 1 240 PRO n 1 241 TYR n 1 242 LEU n 1 243 GLU n 1 244 GLU n 1 245 ALA n 1 246 LEU n 1 247 GLU n 1 248 VAL n 1 249 THR n 1 250 HIS n 1 251 SER n 1 252 PHE n 1 253 ILE n 1 254 THR n 1 255 LYS n 1 256 HIS n 1 257 TYR n 1 258 LEU n 1 259 GLU n 1 260 HIS n 1 261 HIS n 1 262 HIS n 1 263 HIS n 1 264 HIS n 1 265 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 265 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Paenibacillus sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 58172 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PMS non-polymer . 'phenylmethanesulfonic acid' ? 'C7 H8 O3 S' 172.202 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 TRP 150 150 150 TRP TRP A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 PRO 154 154 154 PRO PRO A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ALA 158 158 ? ? ? A . n A 1 159 ALA 159 159 ? ? ? A . n A 1 160 ALA 160 160 ? ? ? A . n A 1 161 GLY 161 161 ? ? ? A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 GLN 208 208 208 GLN GLN A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 TYR 219 219 219 TYR TYR A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 ASP 226 226 226 ASP ASP A . n A 1 227 HIS 227 227 227 HIS HIS A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 HIS 233 233 233 HIS HIS A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 PHE 235 235 235 PHE PHE A . n A 1 236 HIS 236 236 236 HIS HIS A . n A 1 237 HIS 237 237 237 HIS HIS A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 TYR 241 241 241 TYR TYR A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 GLU 244 244 244 GLU GLU A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 PHE 252 252 252 PHE PHE A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 HIS 256 256 256 HIS HIS A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 HIS 260 260 ? ? ? A . n A 1 261 HIS 261 261 ? ? ? A . n A 1 262 HIS 262 262 ? ? ? A . n A 1 263 HIS 263 263 ? ? ? A . n A 1 264 HIS 264 264 ? ? ? A . n A 1 265 HIS 265 265 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PMS _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PMS _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PMS 1 301 301 PMS PMS A . C 3 HOH 1 401 45 HOH HOH A . C 3 HOH 2 402 27 HOH HOH A . C 3 HOH 3 403 29 HOH HOH A . C 3 HOH 4 404 55 HOH HOH A . C 3 HOH 5 405 4 HOH HOH A . C 3 HOH 6 406 8 HOH HOH A . C 3 HOH 7 407 22 HOH HOH A . C 3 HOH 8 408 50 HOH HOH A . C 3 HOH 9 409 3 HOH HOH A . C 3 HOH 10 410 5 HOH HOH A . C 3 HOH 11 411 37 HOH HOH A . C 3 HOH 12 412 20 HOH HOH A . C 3 HOH 13 413 14 HOH HOH A . C 3 HOH 14 414 51 HOH HOH A . C 3 HOH 15 415 54 HOH HOH A . C 3 HOH 16 416 40 HOH HOH A . C 3 HOH 17 417 6 HOH HOH A . C 3 HOH 18 418 46 HOH HOH A . C 3 HOH 19 419 49 HOH HOH A . C 3 HOH 20 420 52 HOH HOH A . C 3 HOH 21 421 23 HOH HOH A . C 3 HOH 22 422 16 HOH HOH A . C 3 HOH 23 423 1 HOH HOH A . C 3 HOH 24 424 2 HOH HOH A . C 3 HOH 25 425 12 HOH HOH A . C 3 HOH 26 426 47 HOH HOH A . C 3 HOH 27 427 48 HOH HOH A . C 3 HOH 28 428 28 HOH HOH A . C 3 HOH 29 429 9 HOH HOH A . C 3 HOH 30 430 24 HOH HOH A . C 3 HOH 31 431 19 HOH HOH A . C 3 HOH 32 432 35 HOH HOH A . C 3 HOH 33 433 26 HOH HOH A . C 3 HOH 34 434 44 HOH HOH A . C 3 HOH 35 435 17 HOH HOH A . C 3 HOH 36 436 56 HOH HOH A . C 3 HOH 37 437 7 HOH HOH A . C 3 HOH 38 438 13 HOH HOH A . C 3 HOH 39 439 33 HOH HOH A . C 3 HOH 40 440 43 HOH HOH A . C 3 HOH 41 441 15 HOH HOH A . C 3 HOH 42 442 10 HOH HOH A . C 3 HOH 43 443 18 HOH HOH A . C 3 HOH 44 444 32 HOH HOH A . C 3 HOH 45 445 25 HOH HOH A . C 3 HOH 46 446 39 HOH HOH A . C 3 HOH 47 447 38 HOH HOH A . C 3 HOH 48 448 11 HOH HOH A . C 3 HOH 49 449 42 HOH HOH A . C 3 HOH 50 450 30 HOH HOH A . C 3 HOH 51 451 41 HOH HOH A . C 3 HOH 52 452 21 HOH HOH A . C 3 HOH 53 453 31 HOH HOH A . C 3 HOH 54 454 53 HOH HOH A . C 3 HOH 55 455 34 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7V8X _cell.details ? _cell.formula_units_Z ? _cell.length_a 144.773 _cell.length_a_esd ? _cell.length_b 144.773 _cell.length_b_esd ? _cell.length_c 144.773 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7V8X _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7V8X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M bis-tris pH 6.5, 2.0 M ammonium sulfate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-04-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97933 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 45.290 _reflns.entry_id 7V8X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.340 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22425 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 30.400 _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.687 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.076 _reflns.pdbx_Rpim_I_all 0.013 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 681426 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.340 2.380 ? ? ? ? ? ? 1095 99.800 ? ? ? ? 0.524 ? ? ? ? ? ? ? ? 14.000 ? 0.917 ? ? 0.543 0.137 ? 1 1 0.369 ? ? ? ? ? ? ? ? ? ? 2.380 2.420 ? ? ? ? ? ? 1091 100.000 ? ? ? ? 0.509 ? ? ? ? ? ? ? ? 17.900 ? 1.010 ? ? 0.524 0.118 ? 2 1 0.569 ? ? ? ? ? ? ? ? ? ? 2.420 2.470 ? ? ? ? ? ? 1084 99.900 ? ? ? ? 0.505 ? ? ? ? ? ? ? ? 19.800 ? 1.058 ? ? 0.518 0.112 ? 3 1 0.609 ? ? ? ? ? ? ? ? ? ? 2.470 2.520 ? ? ? ? ? ? 1101 99.900 ? ? ? ? 0.488 ? ? ? ? ? ? ? ? 21.000 ? 1.079 ? ? 0.500 0.105 ? 4 1 0.646 ? ? ? ? ? ? ? ? ? ? 2.520 2.580 ? ? ? ? ? ? 1099 100.000 ? ? ? ? 0.454 ? ? ? ? ? ? ? ? 22.400 ? 1.171 ? ? 0.464 0.094 ? 5 1 0.807 ? ? ? ? ? ? ? ? ? ? 2.580 2.640 ? ? ? ? ? ? 1108 100.000 ? ? ? ? 0.422 ? ? ? ? ? ? ? ? 23.300 ? 1.195 ? ? 0.431 0.086 ? 6 1 0.927 ? ? ? ? ? ? ? ? ? ? 2.640 2.700 ? ? ? ? ? ? 1097 100.000 ? ? ? ? 0.381 ? ? ? ? ? ? ? ? 25.300 ? 1.251 ? ? 0.389 0.074 ? 7 1 0.941 ? ? ? ? ? ? ? ? ? ? 2.700 2.770 ? ? ? ? ? ? 1104 100.000 ? ? ? ? 0.353 ? ? ? ? ? ? ? ? 26.400 ? 1.334 ? ? 0.360 0.067 ? 8 1 0.963 ? ? ? ? ? ? ? ? ? ? 2.770 2.860 ? ? ? ? ? ? 1097 100.000 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 28.100 ? 1.392 ? ? 0.308 0.056 ? 9 1 0.981 ? ? ? ? ? ? ? ? ? ? 2.860 2.950 ? ? ? ? ? ? 1117 100.000 ? ? ? ? 0.264 ? ? ? ? ? ? ? ? 29.900 ? 1.470 ? ? 0.268 0.047 ? 10 1 0.990 ? ? ? ? ? ? ? ? ? ? 2.950 3.050 ? ? ? ? ? ? 1114 99.900 ? ? ? ? 0.218 ? ? ? ? ? ? ? ? 31.700 ? 1.522 ? ? 0.222 0.038 ? 11 1 0.995 ? ? ? ? ? ? ? ? ? ? 3.050 3.180 ? ? ? ? ? ? 1102 99.900 ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 34.100 ? 1.663 ? ? 0.171 0.028 ? 12 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.180 3.320 ? ? ? ? ? ? 1111 99.900 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 36.000 ? 1.771 ? ? 0.128 0.021 ? 13 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.320 3.500 ? ? ? ? ? ? 1127 99.900 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 38.300 ? 1.874 ? ? 0.096 0.015 ? 14 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.500 3.710 ? ? ? ? ? ? 1128 99.900 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 39.400 ? 1.879 ? ? 0.077 0.012 ? 15 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.710 4.000 ? ? ? ? ? ? 1120 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 40.200 ? 2.009 ? ? 0.064 0.010 ? 16 1 1.000 ? ? ? ? ? ? ? ? ? ? 4.000 4.400 ? ? ? ? ? ? 1144 99.900 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 41.200 ? 2.049 ? ? 0.053 0.008 ? 17 1 1.000 ? ? ? ? ? ? ? ? ? ? 4.400 5.040 ? ? ? ? ? ? 1154 99.700 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 41.600 ? 2.072 ? ? 0.046 0.007 ? 18 1 1.000 ? ? ? ? ? ? ? ? ? ? 5.040 6.350 ? ? ? ? ? ? 1178 99.700 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 40.200 ? 2.063 ? ? 0.047 0.007 ? 19 1 1.000 ? ? ? ? ? ? ? ? ? ? 6.350 50.000 ? ? ? ? ? ? 1254 97.500 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 33.900 ? 2.463 ? ? 0.046 0.008 ? 20 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 115.020 _refine.B_iso_mean 54.5207 _refine.B_iso_min 23.980 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7V8X _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3400 _refine.ls_d_res_low 35.1100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22402 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work 20402 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 8.9300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2277 _refine.ls_R_factor_R_free 0.2576 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2247 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.480 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7V8U _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.4200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3400 _refine_hist.d_res_low 35.1100 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 2066 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 252 _refine_hist.pdbx_B_iso_mean_ligand 74.55 _refine_hist.pdbx_B_iso_mean_solvent 51.81 _refine_hist.pdbx_number_atoms_protein 2001 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3400 2.4000 1571 . 140 1431 100.0000 . . . 0.3930 0.0000 0.3639 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.4000 2.4700 1571 . 141 1430 100.0000 . . . 0.3705 0.0000 0.3372 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.4700 2.5400 1554 . 138 1416 100.0000 . . . 0.3395 0.0000 0.3229 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.5400 2.6200 1557 . 139 1418 100.0000 . . . 0.3571 0.0000 0.2945 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.6200 2.7100 1566 . 140 1426 100.0000 . . . 0.3400 0.0000 0.2742 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.7100 2.8200 1583 . 142 1441 100.0000 . . . 0.2967 0.0000 0.2705 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.8200 2.9500 1584 . 140 1444 100.0000 . . . 0.3016 0.0000 0.2679 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.9500 3.1100 1585 . 142 1443 100.0000 . . . 0.3069 0.0000 0.2534 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.1100 3.3000 1591 . 142 1449 100.0000 . . . 0.2582 0.0000 0.2292 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.3000 3.5500 1587 . 143 1444 100.0000 . . . 0.2520 0.0000 0.2163 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.5600 3.9100 1615 . 144 1471 100.0000 . . . 0.2217 0.0000 0.2150 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.9100 4.4800 1624 . 145 1479 100.0000 . . . 0.2067 0.0000 0.1886 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 4.4800 5.6400 1649 . 146 1503 100.0000 . . . 0.2315 0.0000 0.1762 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 5.6400 35.1100 1765 . 158 1607 99.0000 . . . 0.2271 0.0000 0.1978 . . . . . . . 14 . . . # _struct.entry_id 7V8X _struct.title 'Crystal structure of PsEst3 complexed with Phenylmethylsulfonyl fluoride (PMSF)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7V8X _struct_keywords.text 'esterases, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7V8X _struct_ref.pdbx_db_accession 7V8X _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7V8X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 265 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7V8X _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 265 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 265 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 340 ? 1 MORE 3 ? 1 'SSA (A^2)' 11930 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 51 ? ARG A 62 ? PHE A 51 ARG A 62 1 ? 12 HELX_P HELX_P2 AA2 PHE A 71 ? SER A 79 ? PHE A 71 SER A 79 1 ? 9 HELX_P HELX_P3 AA3 ASP A 82 ? LEU A 89 ? ASP A 82 LEU A 89 1 ? 8 HELX_P HELX_P4 AA4 THR A 91 ? GLU A 108 ? THR A 91 GLU A 108 1 ? 18 HELX_P HELX_P5 AA5 LEU A 113 ? GLU A 115 ? LEU A 113 GLU A 115 5 ? 3 HELX_P HELX_P6 AA6 ARG A 129 ? GLU A 140 ? ARG A 129 GLU A 140 1 ? 12 HELX_P HELX_P7 AA7 ASN A 164 ? ASN A 174 ? ASN A 164 ASN A 174 1 ? 11 HELX_P HELX_P8 AA8 ASP A 179 ? LEU A 187 ? ASP A 179 LEU A 187 1 ? 9 HELX_P HELX_P9 AA9 ARG A 200 ? ALA A 214 ? ARG A 200 ALA A 214 1 ? 15 HELX_P HELX_P10 AB1 THR A 239 ? HIS A 256 ? THR A 239 HIS A 256 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 128 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PMS _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id S _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 128 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PMS _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.473 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id PMS _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id SER _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 128 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id PMS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 301 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id SER _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 128 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom S _pdbx_modification_feature.modified_residue_id_linking_atom OG _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 2 _pdbx_modification_feature.ref_comp_id PMS _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 233 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 233 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 234 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 234 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.37 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 7 ? ASP A 14 ? VAL A 7 ASP A 14 AA1 2 PHE A 20 ? LEU A 27 ? PHE A 20 LEU A 27 AA1 3 TYR A 65 ? PHE A 69 ? TYR A 65 PHE A 69 AA1 4 LYS A 34 ? SER A 40 ? LYS A 34 SER A 40 AA1 5 ALA A 117 ? HIS A 127 ? ALA A 117 HIS A 127 AA1 6 ILE A 144 ? TRP A 150 ? ILE A 144 TRP A 150 AA1 7 VAL A 191 ? GLY A 196 ? VAL A 191 GLY A 196 AA1 8 THR A 218 ? ILE A 222 ? THR A 218 ILE A 222 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 7 ? N VAL A 7 O LEU A 27 ? O LEU A 27 AA1 2 3 N GLU A 24 ? N GLU A 24 O HIS A 68 ? O HIS A 68 AA1 3 4 O VAL A 67 ? O VAL A 67 N LEU A 37 ? N LEU A 37 AA1 4 5 N SER A 40 ? N SER A 40 O LEU A 125 ? O LEU A 125 AA1 5 6 N GLY A 126 ? N GLY A 126 O TRP A 150 ? O TRP A 150 AA1 6 7 N ALA A 149 ? N ALA A 149 O ILE A 194 ? O ILE A 194 AA1 7 8 N ILE A 193 ? N ILE A 193 O ILE A 220 ? O ILE A 220 # _pdbx_entry_details.entry_id 7V8X _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 N A LEU 103 ? ? O A HOH 401 ? ? 1.86 2 1 O A LEU 99 ? ? O A HOH 401 ? ? 1.93 3 1 O A HOH 448 ? ? O A HOH 454 ? ? 2.08 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 405 ? ? 1_555 O A HOH 445 ? ? 22_554 2.15 2 1 OH A TYR 257 ? ? 1_555 OH A TYR 257 ? ? 22_554 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 15 ? ? -111.06 -168.47 2 1 ASN A 17 ? ? 53.24 -118.40 3 1 SER A 128 ? ? 75.47 -53.51 4 1 ASP A 224 ? ? -96.21 32.37 5 1 LEU A 258 ? ? -92.69 56.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A ALA 158 ? A ALA 158 5 1 Y 1 A ALA 159 ? A ALA 159 6 1 Y 1 A ALA 160 ? A ALA 160 7 1 Y 1 A GLY 161 ? A GLY 161 8 1 Y 1 A HIS 260 ? A HIS 260 9 1 Y 1 A HIS 261 ? A HIS 261 10 1 Y 1 A HIS 262 ? A HIS 262 11 1 Y 1 A HIS 263 ? A HIS 263 12 1 Y 1 A HIS 264 ? A HIS 264 13 1 Y 1 A HIS 265 ? A HIS 265 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PMS C C N N 259 PMS S S N N 260 PMS C1 C Y N 261 PMS C2 C Y N 262 PMS C3 C Y N 263 PMS C4 C Y N 264 PMS C5 C Y N 265 PMS C6 C Y N 266 PMS O3S O N N 267 PMS O2S O N N 268 PMS O1S O N N 269 PMS H2A H N N 270 PMS H1 H N N 271 PMS H2 H N N 272 PMS H3 H N N 273 PMS H4 H N N 274 PMS H5 H N N 275 PMS H6 H N N 276 PMS HO3S H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PMS C C1 sing N N 247 PMS C S sing N N 248 PMS C H2A sing N N 249 PMS C H1 sing N N 250 PMS O2S S doub N N 251 PMS S O1S doub N N 252 PMS S O3S sing N N 253 PMS C6 C1 doub Y N 254 PMS C1 C2 sing Y N 255 PMS C2 C3 doub Y N 256 PMS C2 H2 sing N N 257 PMS C4 C3 sing Y N 258 PMS C3 H3 sing N N 259 PMS C5 C4 doub Y N 260 PMS C4 H4 sing N N 261 PMS C6 C5 sing Y N 262 PMS C5 H5 sing N N 263 PMS C6 H6 sing N N 264 PMS O3S HO3S sing N N 265 PRO N CA sing N N 266 PRO N CD sing N N 267 PRO N H sing N N 268 PRO CA C sing N N 269 PRO CA CB sing N N 270 PRO CA HA sing N N 271 PRO C O doub N N 272 PRO C OXT sing N N 273 PRO CB CG sing N N 274 PRO CB HB2 sing N N 275 PRO CB HB3 sing N N 276 PRO CG CD sing N N 277 PRO CG HG2 sing N N 278 PRO CG HG3 sing N N 279 PRO CD HD2 sing N N 280 PRO CD HD3 sing N N 281 PRO OXT HXT sing N N 282 SER N CA sing N N 283 SER N H sing N N 284 SER N H2 sing N N 285 SER CA C sing N N 286 SER CA CB sing N N 287 SER CA HA sing N N 288 SER C O doub N N 289 SER C OXT sing N N 290 SER CB OG sing N N 291 SER CB HB2 sing N N 292 SER CB HB3 sing N N 293 SER OG HG sing N N 294 SER OXT HXT sing N N 295 THR N CA sing N N 296 THR N H sing N N 297 THR N H2 sing N N 298 THR CA C sing N N 299 THR CA CB sing N N 300 THR CA HA sing N N 301 THR C O doub N N 302 THR C OXT sing N N 303 THR CB OG1 sing N N 304 THR CB CG2 sing N N 305 THR CB HB sing N N 306 THR OG1 HG1 sing N N 307 THR CG2 HG21 sing N N 308 THR CG2 HG22 sing N N 309 THR CG2 HG23 sing N N 310 THR OXT HXT sing N N 311 TRP N CA sing N N 312 TRP N H sing N N 313 TRP N H2 sing N N 314 TRP CA C sing N N 315 TRP CA CB sing N N 316 TRP CA HA sing N N 317 TRP C O doub N N 318 TRP C OXT sing N N 319 TRP CB CG sing N N 320 TRP CB HB2 sing N N 321 TRP CB HB3 sing N N 322 TRP CG CD1 doub Y N 323 TRP CG CD2 sing Y N 324 TRP CD1 NE1 sing Y N 325 TRP CD1 HD1 sing N N 326 TRP CD2 CE2 doub Y N 327 TRP CD2 CE3 sing Y N 328 TRP NE1 CE2 sing Y N 329 TRP NE1 HE1 sing N N 330 TRP CE2 CZ2 sing Y N 331 TRP CE3 CZ3 doub Y N 332 TRP CE3 HE3 sing N N 333 TRP CZ2 CH2 doub Y N 334 TRP CZ2 HZ2 sing N N 335 TRP CZ3 CH2 sing Y N 336 TRP CZ3 HZ3 sing N N 337 TRP CH2 HH2 sing N N 338 TRP OXT HXT sing N N 339 TYR N CA sing N N 340 TYR N H sing N N 341 TYR N H2 sing N N 342 TYR CA C sing N N 343 TYR CA CB sing N N 344 TYR CA HA sing N N 345 TYR C O doub N N 346 TYR C OXT sing N N 347 TYR CB CG sing N N 348 TYR CB HB2 sing N N 349 TYR CB HB3 sing N N 350 TYR CG CD1 doub Y N 351 TYR CG CD2 sing Y N 352 TYR CD1 CE1 sing Y N 353 TYR CD1 HD1 sing N N 354 TYR CD2 CE2 doub Y N 355 TYR CD2 HD2 sing N N 356 TYR CE1 CZ doub Y N 357 TYR CE1 HE1 sing N N 358 TYR CE2 CZ sing Y N 359 TYR CE2 HE2 sing N N 360 TYR CZ OH sing N N 361 TYR OH HH sing N N 362 TYR OXT HXT sing N N 363 VAL N CA sing N N 364 VAL N H sing N N 365 VAL N H2 sing N N 366 VAL CA C sing N N 367 VAL CA CB sing N N 368 VAL CA HA sing N N 369 VAL C O doub N N 370 VAL C OXT sing N N 371 VAL CB CG1 sing N N 372 VAL CB CG2 sing N N 373 VAL CB HB sing N N 374 VAL CG1 HG11 sing N N 375 VAL CG1 HG12 sing N N 376 VAL CG1 HG13 sing N N 377 VAL CG2 HG21 sing N N 378 VAL CG2 HG22 sing N N 379 VAL CG2 HG23 sing N N 380 VAL OXT HXT sing N N 381 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number 2021M1A5A1075524 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7V8U _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7V8X _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006907 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006907 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006907 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_