data_7W7O # _entry.id 7W7O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7W7O pdb_00007w7o 10.2210/pdb7w7o/pdb WWPDB D_1300025785 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7W7O _pdbx_database_status.recvd_initial_deposition_date 2021-12-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhao, Y.' 1 0000-0002-2932-2164 'Zhao, J.' 2 0000-0002-5119-359X 'Shao, M.' 3 0000-0002-9762-8608 'Yang, H.' 4 0000-0002-1875-3268 'Rao, Z.' 5 0000-0001-9866-2384 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The crystal structure of human Calpain-1 protease core in complex with 14a' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, Y.' 1 0000-0002-2932-2164 primary 'Zhao, J.' 2 0000-0002-5119-359X primary 'Shao, M.' 3 0000-0002-9762-8608 primary 'Yang, H.' 4 0000-0002-1875-3268 primary 'Rao, Z.' 5 0000-0001-9866-2384 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7W7O _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.126 _cell.length_a_esd ? _cell.length_b 63.980 _cell.length_b_esd ? _cell.length_c 99.754 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7W7O _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calpain-1 catalytic subunit' 37715.465 1 3.4.22.52 ? ? ? 2 non-polymer syn ;N-[(2S)-3-(4-fluorophenyl)-1-oxidanylidene-1-[[(2S,3S)-3-oxidanyl-4-oxidanylidene-1-[(3S)-2-oxidanylidenepiperidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]amino]propan-2-yl]-1-benzofuran-2-carboxamide ; 614.663 1 ? ? ? ? 3 non-polymer syn 'HYDROSULFURIC ACID' 34.081 1 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 5 water nat water 18.015 314 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Calcium-activated neutral proteinase 1,CANP 1,Calpain mu-type,Calpain-1 large subunit,Cell proliferation-inducing gene 30 protein,Micromolar-calpain,muCANP ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTD ICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEF WSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFK KLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFT RLEICNLTPDALKS ; _entity_poly.pdbx_seq_one_letter_code_can ;GLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTD ICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEF WSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFK KLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFT RLEICNLTPDALKS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 GLY n 1 4 ARG n 1 5 HIS n 1 6 GLU n 1 7 ASN n 1 8 ALA n 1 9 ILE n 1 10 LYS n 1 11 TYR n 1 12 LEU n 1 13 GLY n 1 14 GLN n 1 15 ASP n 1 16 TYR n 1 17 GLU n 1 18 GLN n 1 19 LEU n 1 20 ARG n 1 21 VAL n 1 22 ARG n 1 23 CYS n 1 24 LEU n 1 25 GLN n 1 26 SER n 1 27 GLY n 1 28 THR n 1 29 LEU n 1 30 PHE n 1 31 ARG n 1 32 ASP n 1 33 GLU n 1 34 ALA n 1 35 PHE n 1 36 PRO n 1 37 PRO n 1 38 VAL n 1 39 PRO n 1 40 GLN n 1 41 SER n 1 42 LEU n 1 43 GLY n 1 44 TYR n 1 45 LYS n 1 46 ASP n 1 47 LEU n 1 48 GLY n 1 49 PRO n 1 50 ASN n 1 51 SER n 1 52 SER n 1 53 LYS n 1 54 THR n 1 55 TYR n 1 56 GLY n 1 57 ILE n 1 58 LYS n 1 59 TRP n 1 60 LYS n 1 61 ARG n 1 62 PRO n 1 63 THR n 1 64 GLU n 1 65 LEU n 1 66 LEU n 1 67 SER n 1 68 ASN n 1 69 PRO n 1 70 GLN n 1 71 PHE n 1 72 ILE n 1 73 VAL n 1 74 ASP n 1 75 GLY n 1 76 ALA n 1 77 THR n 1 78 ARG n 1 79 THR n 1 80 ASP n 1 81 ILE n 1 82 CYS n 1 83 GLN n 1 84 GLY n 1 85 ALA n 1 86 LEU n 1 87 GLY n 1 88 ASP n 1 89 CYS n 1 90 TRP n 1 91 LEU n 1 92 LEU n 1 93 ALA n 1 94 ALA n 1 95 ILE n 1 96 ALA n 1 97 SER n 1 98 LEU n 1 99 THR n 1 100 LEU n 1 101 ASN n 1 102 ASP n 1 103 THR n 1 104 LEU n 1 105 LEU n 1 106 HIS n 1 107 ARG n 1 108 VAL n 1 109 VAL n 1 110 PRO n 1 111 HIS n 1 112 GLY n 1 113 GLN n 1 114 SER n 1 115 PHE n 1 116 GLN n 1 117 ASN n 1 118 GLY n 1 119 TYR n 1 120 ALA n 1 121 GLY n 1 122 ILE n 1 123 PHE n 1 124 HIS n 1 125 PHE n 1 126 GLN n 1 127 LEU n 1 128 TRP n 1 129 GLN n 1 130 PHE n 1 131 GLY n 1 132 GLU n 1 133 TRP n 1 134 VAL n 1 135 ASP n 1 136 VAL n 1 137 VAL n 1 138 VAL n 1 139 ASP n 1 140 ASP n 1 141 LEU n 1 142 LEU n 1 143 PRO n 1 144 ILE n 1 145 LYS n 1 146 ASP n 1 147 GLY n 1 148 LYS n 1 149 LEU n 1 150 VAL n 1 151 PHE n 1 152 VAL n 1 153 HIS n 1 154 SER n 1 155 ALA n 1 156 GLU n 1 157 GLY n 1 158 ASN n 1 159 GLU n 1 160 PHE n 1 161 TRP n 1 162 SER n 1 163 ALA n 1 164 LEU n 1 165 LEU n 1 166 GLU n 1 167 LYS n 1 168 ALA n 1 169 TYR n 1 170 ALA n 1 171 LYS n 1 172 VAL n 1 173 ASN n 1 174 GLY n 1 175 SER n 1 176 TYR n 1 177 GLU n 1 178 ALA n 1 179 LEU n 1 180 SER n 1 181 GLY n 1 182 GLY n 1 183 SER n 1 184 THR n 1 185 SER n 1 186 GLU n 1 187 GLY n 1 188 PHE n 1 189 GLU n 1 190 ASP n 1 191 PHE n 1 192 THR n 1 193 GLY n 1 194 GLY n 1 195 VAL n 1 196 THR n 1 197 GLU n 1 198 TRP n 1 199 TYR n 1 200 GLU n 1 201 LEU n 1 202 ARG n 1 203 LYS n 1 204 ALA n 1 205 PRO n 1 206 SER n 1 207 ASP n 1 208 LEU n 1 209 TYR n 1 210 GLN n 1 211 ILE n 1 212 ILE n 1 213 LEU n 1 214 LYS n 1 215 ALA n 1 216 LEU n 1 217 GLU n 1 218 ARG n 1 219 GLY n 1 220 SER n 1 221 LEU n 1 222 LEU n 1 223 GLY n 1 224 CYS n 1 225 SER n 1 226 ILE n 1 227 ASP n 1 228 ILE n 1 229 SER n 1 230 SER n 1 231 VAL n 1 232 LEU n 1 233 ASP n 1 234 MET n 1 235 GLU n 1 236 ALA n 1 237 ILE n 1 238 THR n 1 239 PHE n 1 240 LYS n 1 241 LYS n 1 242 LEU n 1 243 VAL n 1 244 LYS n 1 245 GLY n 1 246 HIS n 1 247 ALA n 1 248 TYR n 1 249 SER n 1 250 VAL n 1 251 THR n 1 252 GLY n 1 253 ALA n 1 254 LYS n 1 255 GLN n 1 256 VAL n 1 257 ASN n 1 258 TYR n 1 259 ARG n 1 260 GLY n 1 261 GLN n 1 262 VAL n 1 263 VAL n 1 264 SER n 1 265 LEU n 1 266 ILE n 1 267 ARG n 1 268 MET n 1 269 ARG n 1 270 ASN n 1 271 PRO n 1 272 TRP n 1 273 GLY n 1 274 GLU n 1 275 VAL n 1 276 GLU n 1 277 TRP n 1 278 THR n 1 279 GLY n 1 280 ALA n 1 281 TRP n 1 282 SER n 1 283 ASP n 1 284 SER n 1 285 SER n 1 286 SER n 1 287 GLU n 1 288 TRP n 1 289 ASN n 1 290 ASN n 1 291 VAL n 1 292 ASP n 1 293 PRO n 1 294 TYR n 1 295 GLU n 1 296 ARG n 1 297 ASP n 1 298 GLN n 1 299 LEU n 1 300 ARG n 1 301 VAL n 1 302 LYS n 1 303 MET n 1 304 GLU n 1 305 ASP n 1 306 GLY n 1 307 GLU n 1 308 PHE n 1 309 TRP n 1 310 MET n 1 311 SER n 1 312 PHE n 1 313 ARG n 1 314 ASP n 1 315 PHE n 1 316 MET n 1 317 ARG n 1 318 GLU n 1 319 PHE n 1 320 THR n 1 321 ARG n 1 322 LEU n 1 323 GLU n 1 324 ILE n 1 325 CYS n 1 326 ASN n 1 327 LEU n 1 328 THR n 1 329 PRO n 1 330 ASP n 1 331 ALA n 1 332 LEU n 1 333 LYS n 1 334 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 334 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CAPN1, CANPL1, PIG30' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAN1_HUMAN _struct_ref.pdbx_db_accession P07384 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTD ICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEF WSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFK KLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFT RLEICNLTPDALKS ; _struct_ref.pdbx_align_begin 27 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7W7O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 334 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07384 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 27 _struct_ref_seq.pdbx_auth_seq_align_end 360 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 06Q non-polymer . ;N-[(2S)-3-(4-fluorophenyl)-1-oxidanylidene-1-[[(2S,3S)-3-oxidanyl-4-oxidanylidene-1-[(3S)-2-oxidanylidenepiperidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]amino]propan-2-yl]-1-benzofuran-2-carboxamide ; ? 'C34 H35 F N4 O6' 614.663 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 H2S non-polymer . 'HYDROSULFURIC ACID' 'HYDROGEN SULFIDE' 'H2 S' 34.081 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7W7O _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M sodium acetate (pH 4.6), 8% (w/v) PEG 4000, protein concentration 13mg/ml' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-05-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978530 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978530 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 22.290 _reflns.entry_id 7W7O _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.590 _reflns.d_resolution_low 30.460 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 42389 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.067 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.250 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.876 _reflns.pdbx_scaling_rejects 197 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.077 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 553890 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.590 1.630 ? 2.130 ? 34252 3200 ? 2790 87.200 ? ? ? ? 1.198 ? ? ? ? ? ? ? ? 12.277 ? ? ? ? 1.251 ? ? 1 1 0.741 ? ? ? ? ? ? ? ? ? ? 1.630 1.680 ? 2.640 ? 40506 3094 ? 2982 96.400 ? ? ? ? 1.052 ? ? ? ? ? ? ? ? 13.584 ? ? ? ? 1.093 ? ? 2 1 0.842 ? ? ? ? ? ? ? ? ? ? 1.680 1.730 ? 3.650 ? 39377 3055 ? 2940 96.200 ? ? ? ? 0.766 ? ? ? ? ? ? ? ? 13.394 ? ? ? ? 0.796 ? ? 3 1 0.911 ? ? ? ? ? ? ? ? ? ? 1.730 1.780 ? 4.660 ? 38605 2925 ? 2825 96.600 ? ? ? ? 0.617 ? ? ? ? ? ? ? ? 13.665 ? ? ? ? 0.641 ? ? 4 1 0.947 ? ? ? ? ? ? ? ? ? ? 1.780 1.840 ? 6.260 ? 37837 2852 ? 2763 96.900 ? ? ? ? 0.453 ? ? ? ? ? ? ? ? 13.694 ? ? ? ? 0.470 ? ? 5 1 0.971 ? ? ? ? ? ? ? ? ? ? 1.840 1.900 ? 7.510 ? 35125 2751 ? 2672 97.100 ? ? ? ? 0.358 ? ? ? ? ? ? ? ? 13.146 ? ? ? ? 0.372 ? ? 6 1 0.982 ? ? ? ? ? ? ? ? ? ? 1.900 1.970 ? 11.080 ? 35518 2686 ? 2613 97.300 ? ? ? ? 0.255 ? ? ? ? ? ? ? ? 13.593 ? ? ? ? 0.265 ? ? 7 1 0.988 ? ? ? ? ? ? ? ? ? ? 1.970 2.050 ? 13.640 ? 33101 2571 ? 2501 97.300 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? 13.235 ? ? ? ? 0.199 ? ? 8 1 0.994 ? ? ? ? ? ? ? ? ? ? 2.050 2.150 ? 17.690 ? 33315 2496 ? 2440 97.800 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 13.654 ? ? ? ? 0.153 ? ? 9 1 0.996 ? ? ? ? ? ? ? ? ? ? 2.150 2.250 ? 20.640 ? 31062 2370 ? 2323 98.000 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 13.372 ? ? ? ? 0.131 ? ? 10 1 0.996 ? ? ? ? ? ? ? ? ? ? 2.250 2.370 ? 22.830 ? 28214 2261 ? 2199 97.300 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 12.830 ? ? ? ? 0.109 ? ? 11 1 0.997 ? ? ? ? ? ? ? ? ? ? 2.370 2.520 ? 28.010 ? 27897 2133 ? 2105 98.700 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 13.253 ? ? ? ? 0.088 ? ? 12 1 0.998 ? ? ? ? ? ? ? ? ? ? 2.520 2.690 ? 32.140 ? 25633 2019 ? 1979 98.000 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 12.953 ? ? ? ? 0.074 ? ? 13 1 0.998 ? ? ? ? ? ? ? ? ? ? 2.690 2.910 ? 36.750 ? 24531 1898 ? 1871 98.600 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 13.111 ? ? ? ? 0.063 ? ? 14 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.910 3.180 ? 40.660 ? 21088 1735 ? 1717 99.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 12.282 ? ? ? ? 0.054 ? ? 15 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.180 3.560 ? 45.810 ? 19381 1599 ? 1575 98.500 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 12.305 ? ? ? ? 0.046 ? ? 16 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.560 4.110 ? 49.450 ? 17425 1405 ? 1389 98.900 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 12.545 ? ? ? ? 0.044 ? ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.110 5.030 ? 50.940 ? 14200 1218 ? 1207 99.100 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 11.765 ? ? ? ? 0.042 ? ? 18 1 0.999 ? ? ? ? ? ? ? ? ? ? 5.030 7.120 ? 49.140 ? 10971 960 ? 951 99.100 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 11.536 ? ? ? ? 0.045 ? ? 19 1 0.998 ? ? ? ? ? ? ? ? ? ? 7.120 30.460 ? 48.210 ? 5852 566 ? 547 96.600 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 10.698 ? ? ? ? 0.052 ? ? 20 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 82.690 _refine.B_iso_mean 30.4564 _refine.B_iso_min 14.370 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7W7O _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5900 _refine.ls_d_res_low 30.4600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 42375 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work 40375 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.7800 _refine.ls_percent_reflns_R_free 4.7200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1649 _refine.ls_R_factor_R_free 0.1954 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1634 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1ZCM _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.6300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.5900 _refine_hist.d_res_low 30.4600 _refine_hist.number_atoms_solvent 315 _refine_hist.number_atoms_total 2971 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 327 _refine_hist.pdbx_B_iso_mean_ligand 30.61 _refine_hist.pdbx_B_iso_mean_solvent 41.38 _refine_hist.pdbx_number_atoms_protein 2608 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5900 1.6300 2683 . 126 2557 87.0000 . . . 0.2959 0.0000 0.2683 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.6300 1.6800 2972 . 140 2832 96.0000 . . . 0.2702 0.0000 0.2330 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.6800 1.7200 2974 . 141 2833 96.0000 . . . 0.2249 0.0000 0.2033 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.7200 1.7800 2964 . 140 2824 96.0000 . . . 0.2645 0.0000 0.1984 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.7800 1.8400 2984 . 141 2843 97.0000 . . . 0.2235 0.0000 0.1879 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.8400 1.9200 2999 . 141 2858 97.0000 . . . 0.2522 0.0000 0.1917 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.9200 2.0000 3043 . 144 2899 97.0000 . . . 0.2338 0.0000 0.1739 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.0000 2.1100 3011 . 142 2869 98.0000 . . . 0.1827 0.0000 0.1571 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.1100 2.2400 3048 . 143 2905 98.0000 . . . 0.2101 0.0000 0.1585 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.2400 2.4200 3062 . 145 2917 98.0000 . . . 0.1972 0.0000 0.1653 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.4200 2.6600 3081 . 146 2935 98.0000 . . . 0.2061 0.0000 0.1620 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.6600 3.0400 3111 . 147 2964 99.0000 . . . 0.2052 0.0000 0.1666 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.0400 3.8300 3157 . 148 3009 99.0000 . . . 0.1762 0.0000 0.1479 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.8300 30.4600 3286 . 156 3130 98.0000 . . . 0.1625 0.0000 0.1495 . . . . . . . 14 . . . # _struct.entry_id 7W7O _struct.title 'The crystal structure of human Calpain-1 protease core in complex with 14a' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7W7O _struct_keywords.text 'Human protease, Calpain-1, Antiviral inhibitor, 14a, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 12 ? GLN A 14 ? LEU A 38 GLN A 40 5 ? 3 HELX_P HELX_P2 AA2 ASP A 15 ? SER A 26 ? ASP A 41 SER A 52 1 ? 12 HELX_P HELX_P3 AA3 VAL A 38 ? GLY A 43 ? VAL A 64 GLY A 69 1 ? 6 HELX_P HELX_P4 AA4 SER A 51 ? TYR A 55 ? SER A 77 TYR A 81 5 ? 5 HELX_P HELX_P5 AA5 ARG A 61 ? LEU A 65 ? ARG A 87 LEU A 91 5 ? 5 HELX_P HELX_P6 AA6 THR A 77 ? ILE A 81 ? THR A 103 ILE A 107 5 ? 5 HELX_P HELX_P7 AA7 ASP A 88 ? THR A 99 ? ASP A 114 THR A 125 1 ? 12 HELX_P HELX_P8 AA8 ASN A 101 ? VAL A 109 ? ASN A 127 VAL A 135 1 ? 9 HELX_P HELX_P9 AA9 PHE A 160 ? GLY A 174 ? PHE A 186 GLY A 200 1 ? 15 HELX_P HELX_P10 AB1 TYR A 176 ? SER A 180 ? TYR A 202 SER A 206 5 ? 5 HELX_P HELX_P11 AB2 SER A 183 ? GLY A 193 ? SER A 209 GLY A 219 1 ? 11 HELX_P HELX_P12 AB3 ARG A 202 ? ALA A 204 ? ARG A 228 ALA A 230 5 ? 3 HELX_P HELX_P13 AB4 ASP A 207 ? GLY A 219 ? ASP A 233 GLY A 245 1 ? 13 HELX_P HELX_P14 AB5 SER A 230 ? MET A 234 ? SER A 256 MET A 260 5 ? 5 HELX_P HELX_P15 AB6 SER A 285 ? VAL A 291 ? SER A 311 VAL A 317 5 ? 7 HELX_P HELX_P16 AB7 ASP A 292 ? ARG A 300 ? ASP A 318 ARG A 326 1 ? 9 HELX_P HELX_P17 AB8 PHE A 312 ? PHE A 319 ? PHE A 338 PHE A 345 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 89 SG ? ? ? 1_555 B 06Q . C24 ? ? A CYS 115 A 06Q 801 1_555 ? ? ? ? ? ? ? 1.817 ? ? covale2 covale none ? A CYS 89 CB ? ? ? 1_555 C H2S . S ? ? A CYS 115 A H2S 802 1_555 ? ? ? ? ? ? ? 1.846 ? ? metalc1 metalc ? ? A VAL 73 O ? ? ? 1_555 D CA . CA ? ? A VAL 99 A CA 803 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc2 metalc ? ? A GLY 75 O ? ? ? 1_555 D CA . CA ? ? A GLY 101 A CA 803 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc3 metalc ? ? A ASP 80 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 106 A CA 803 1_555 ? ? ? ? ? ? ? 2.550 ? ? metalc4 metalc ? ? A ASP 80 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 106 A CA 803 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc5 metalc ? ? A GLU 159 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 185 A CA 803 1_555 ? ? ? ? ? ? ? 2.588 ? ? metalc6 metalc ? ? A GLU 159 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 185 A CA 803 1_555 ? ? ? ? ? ? ? 2.492 ? ? metalc7 metalc ? ? A GLU 276 OE1 ? ? ? 1_555 E CA . CA ? ? A GLU 302 A CA 804 1_555 ? ? ? ? ? ? ? 2.503 ? ? metalc8 metalc ? ? A GLU 276 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 302 A CA 804 1_555 ? ? ? ? ? ? ? 2.431 ? ? metalc9 metalc ? ? A ASP 283 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 309 A CA 804 1_555 ? ? ? ? ? ? ? 3.076 ? ? metalc10 metalc ? ? A ASP 283 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 309 A CA 804 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc11 metalc ? ? A MET 303 O ? ? ? 1_555 E CA . CA ? ? A MET 329 A CA 804 1_555 ? ? ? ? ? ? ? 2.377 ? ? metalc12 metalc ? ? A ASP 305 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 331 A CA 804 1_555 ? ? ? ? ? ? ? 2.489 ? ? metalc13 metalc ? ? A GLU 307 O ? ? ? 1_555 E CA . CA ? ? A GLU 333 A CA 804 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc14 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 803 A HOH 1043 1_555 ? ? ? ? ? ? ? 2.370 ? ? metalc15 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 803 A HOH 1051 1_555 ? ? ? ? ? ? ? 2.393 ? ? metalc16 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 804 A HOH 978 1_555 ? ? ? ? ? ? ? 2.347 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 9 ? LYS A 10 ? ILE A 35 LYS A 36 AA1 2 GLU A 132 ? ASP A 139 ? GLU A 158 ASP A 165 AA1 3 ILE A 122 ? GLN A 129 ? ILE A 148 GLN A 155 AA2 1 LYS A 58 ? LYS A 60 ? LYS A 84 LYS A 86 AA2 2 LEU A 142 ? LYS A 145 ? LEU A 168 LYS A 171 AA2 3 LYS A 148 ? LEU A 149 ? LYS A 174 LEU A 175 AA3 1 VAL A 195 ? GLU A 200 ? VAL A 221 GLU A 226 AA3 2 ARG A 321 ? ASN A 326 ? ARG A 347 ASN A 352 AA3 3 LEU A 221 ? SER A 225 ? LEU A 247 SER A 251 AA3 4 TYR A 248 ? TYR A 258 ? TYR A 274 TYR A 284 AA3 5 GLN A 261 ? ARG A 269 ? GLN A 287 ARG A 295 AA3 6 GLU A 307 ? SER A 311 ? GLU A 333 SER A 337 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 9 ? N ILE A 35 O ASP A 135 ? O ASP A 161 AA1 2 3 O GLU A 132 ? O GLU A 158 N GLN A 129 ? N GLN A 155 AA2 1 2 N LYS A 58 ? N LYS A 84 O ILE A 144 ? O ILE A 170 AA2 2 3 N LYS A 145 ? N LYS A 171 O LYS A 148 ? O LYS A 174 AA3 1 2 N GLU A 197 ? N GLU A 223 O ILE A 324 ? O ILE A 350 AA3 2 3 O CYS A 325 ? O CYS A 351 N LEU A 221 ? N LEU A 247 AA3 3 4 N CYS A 224 ? N CYS A 250 O TYR A 248 ? O TYR A 274 AA3 4 5 N VAL A 256 ? N VAL A 282 O VAL A 263 ? O VAL A 289 AA3 5 6 N ILE A 266 ? N ILE A 292 O MET A 310 ? O MET A 336 # _atom_sites.entry_id 7W7O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019950 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015630 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010025 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 27 ? ? ? A . n A 1 2 LEU 2 28 ? ? ? A . n A 1 3 GLY 3 29 ? ? ? A . n A 1 4 ARG 4 30 ? ? ? A . n A 1 5 HIS 5 31 ? ? ? A . n A 1 6 GLU 6 32 ? ? ? A . n A 1 7 ASN 7 33 33 ASN ASN A . n A 1 8 ALA 8 34 34 ALA ALA A . n A 1 9 ILE 9 35 35 ILE ILE A . n A 1 10 LYS 10 36 36 LYS LYS A . n A 1 11 TYR 11 37 37 TYR TYR A . n A 1 12 LEU 12 38 38 LEU LEU A . n A 1 13 GLY 13 39 39 GLY GLY A . n A 1 14 GLN 14 40 40 GLN GLN A . n A 1 15 ASP 15 41 41 ASP ASP A . n A 1 16 TYR 16 42 42 TYR TYR A . n A 1 17 GLU 17 43 43 GLU GLU A . n A 1 18 GLN 18 44 44 GLN GLN A . n A 1 19 LEU 19 45 45 LEU LEU A . n A 1 20 ARG 20 46 46 ARG ARG A . n A 1 21 VAL 21 47 47 VAL VAL A . n A 1 22 ARG 22 48 48 ARG ARG A . n A 1 23 CYS 23 49 49 CYS CYS A . n A 1 24 LEU 24 50 50 LEU LEU A . n A 1 25 GLN 25 51 51 GLN GLN A . n A 1 26 SER 26 52 52 SER SER A . n A 1 27 GLY 27 53 53 GLY GLY A . n A 1 28 THR 28 54 54 THR THR A . n A 1 29 LEU 29 55 55 LEU LEU A . n A 1 30 PHE 30 56 56 PHE PHE A . n A 1 31 ARG 31 57 57 ARG ARG A . n A 1 32 ASP 32 58 58 ASP ASP A . n A 1 33 GLU 33 59 59 GLU GLU A . n A 1 34 ALA 34 60 60 ALA ALA A . n A 1 35 PHE 35 61 61 PHE PHE A . n A 1 36 PRO 36 62 62 PRO PRO A . n A 1 37 PRO 37 63 63 PRO PRO A . n A 1 38 VAL 38 64 64 VAL VAL A . n A 1 39 PRO 39 65 65 PRO PRO A . n A 1 40 GLN 40 66 66 GLN GLN A . n A 1 41 SER 41 67 67 SER SER A . n A 1 42 LEU 42 68 68 LEU LEU A . n A 1 43 GLY 43 69 69 GLY GLY A . n A 1 44 TYR 44 70 70 TYR TYR A . n A 1 45 LYS 45 71 71 LYS LYS A . n A 1 46 ASP 46 72 72 ASP ASP A . n A 1 47 LEU 47 73 73 LEU LEU A . n A 1 48 GLY 48 74 74 GLY GLY A . n A 1 49 PRO 49 75 75 PRO PRO A . n A 1 50 ASN 50 76 76 ASN ASN A . n A 1 51 SER 51 77 77 SER SER A . n A 1 52 SER 52 78 78 SER SER A . n A 1 53 LYS 53 79 79 LYS LYS A . n A 1 54 THR 54 80 80 THR THR A . n A 1 55 TYR 55 81 81 TYR TYR A . n A 1 56 GLY 56 82 82 GLY GLY A . n A 1 57 ILE 57 83 83 ILE ILE A . n A 1 58 LYS 58 84 84 LYS LYS A . n A 1 59 TRP 59 85 85 TRP TRP A . n A 1 60 LYS 60 86 86 LYS LYS A . n A 1 61 ARG 61 87 87 ARG ARG A . n A 1 62 PRO 62 88 88 PRO PRO A . n A 1 63 THR 63 89 89 THR THR A . n A 1 64 GLU 64 90 90 GLU GLU A . n A 1 65 LEU 65 91 91 LEU LEU A . n A 1 66 LEU 66 92 92 LEU LEU A . n A 1 67 SER 67 93 93 SER SER A . n A 1 68 ASN 68 94 94 ASN ASN A . n A 1 69 PRO 69 95 95 PRO PRO A . n A 1 70 GLN 70 96 96 GLN GLN A . n A 1 71 PHE 71 97 97 PHE PHE A . n A 1 72 ILE 72 98 98 ILE ILE A . n A 1 73 VAL 73 99 99 VAL VAL A . n A 1 74 ASP 74 100 100 ASP ASP A . n A 1 75 GLY 75 101 101 GLY GLY A . n A 1 76 ALA 76 102 102 ALA ALA A . n A 1 77 THR 77 103 103 THR THR A . n A 1 78 ARG 78 104 104 ARG ARG A . n A 1 79 THR 79 105 105 THR THR A . n A 1 80 ASP 80 106 106 ASP ASP A . n A 1 81 ILE 81 107 107 ILE ILE A . n A 1 82 CYS 82 108 108 CYS CYS A . n A 1 83 GLN 83 109 109 GLN GLN A . n A 1 84 GLY 84 110 110 GLY GLY A . n A 1 85 ALA 85 111 111 ALA ALA A . n A 1 86 LEU 86 112 112 LEU LEU A . n A 1 87 GLY 87 113 113 GLY GLY A . n A 1 88 ASP 88 114 114 ASP ASP A . n A 1 89 CYS 89 115 115 CYS CYS A . n A 1 90 TRP 90 116 116 TRP TRP A . n A 1 91 LEU 91 117 117 LEU LEU A . n A 1 92 LEU 92 118 118 LEU LEU A . n A 1 93 ALA 93 119 119 ALA ALA A . n A 1 94 ALA 94 120 120 ALA ALA A . n A 1 95 ILE 95 121 121 ILE ILE A . n A 1 96 ALA 96 122 122 ALA ALA A . n A 1 97 SER 97 123 123 SER SER A . n A 1 98 LEU 98 124 124 LEU LEU A . n A 1 99 THR 99 125 125 THR THR A . n A 1 100 LEU 100 126 126 LEU LEU A . n A 1 101 ASN 101 127 127 ASN ASN A . n A 1 102 ASP 102 128 128 ASP ASP A . n A 1 103 THR 103 129 129 THR THR A . n A 1 104 LEU 104 130 130 LEU LEU A . n A 1 105 LEU 105 131 131 LEU LEU A . n A 1 106 HIS 106 132 132 HIS HIS A . n A 1 107 ARG 107 133 133 ARG ARG A . n A 1 108 VAL 108 134 134 VAL VAL A . n A 1 109 VAL 109 135 135 VAL VAL A . n A 1 110 PRO 110 136 136 PRO PRO A . n A 1 111 HIS 111 137 137 HIS HIS A . n A 1 112 GLY 112 138 138 GLY GLY A . n A 1 113 GLN 113 139 139 GLN GLN A . n A 1 114 SER 114 140 140 SER SER A . n A 1 115 PHE 115 141 141 PHE PHE A . n A 1 116 GLN 116 142 142 GLN GLN A . n A 1 117 ASN 117 143 143 ASN ASN A . n A 1 118 GLY 118 144 144 GLY GLY A . n A 1 119 TYR 119 145 145 TYR TYR A . n A 1 120 ALA 120 146 146 ALA ALA A . n A 1 121 GLY 121 147 147 GLY GLY A . n A 1 122 ILE 122 148 148 ILE ILE A . n A 1 123 PHE 123 149 149 PHE PHE A . n A 1 124 HIS 124 150 150 HIS HIS A . n A 1 125 PHE 125 151 151 PHE PHE A . n A 1 126 GLN 126 152 152 GLN GLN A . n A 1 127 LEU 127 153 153 LEU LEU A . n A 1 128 TRP 128 154 154 TRP TRP A . n A 1 129 GLN 129 155 155 GLN GLN A . n A 1 130 PHE 130 156 156 PHE PHE A . n A 1 131 GLY 131 157 157 GLY GLY A . n A 1 132 GLU 132 158 158 GLU GLU A . n A 1 133 TRP 133 159 159 TRP TRP A . n A 1 134 VAL 134 160 160 VAL VAL A . n A 1 135 ASP 135 161 161 ASP ASP A . n A 1 136 VAL 136 162 162 VAL VAL A . n A 1 137 VAL 137 163 163 VAL VAL A . n A 1 138 VAL 138 164 164 VAL VAL A . n A 1 139 ASP 139 165 165 ASP ASP A . n A 1 140 ASP 140 166 166 ASP ASP A . n A 1 141 LEU 141 167 167 LEU LEU A . n A 1 142 LEU 142 168 168 LEU LEU A . n A 1 143 PRO 143 169 169 PRO PRO A . n A 1 144 ILE 144 170 170 ILE ILE A . n A 1 145 LYS 145 171 171 LYS LYS A . n A 1 146 ASP 146 172 172 ASP ASP A . n A 1 147 GLY 147 173 173 GLY GLY A . n A 1 148 LYS 148 174 174 LYS LYS A . n A 1 149 LEU 149 175 175 LEU LEU A . n A 1 150 VAL 150 176 176 VAL VAL A . n A 1 151 PHE 151 177 177 PHE PHE A . n A 1 152 VAL 152 178 178 VAL VAL A . n A 1 153 HIS 153 179 179 HIS HIS A . n A 1 154 SER 154 180 180 SER SER A . n A 1 155 ALA 155 181 181 ALA ALA A . n A 1 156 GLU 156 182 182 GLU GLU A . n A 1 157 GLY 157 183 183 GLY GLY A . n A 1 158 ASN 158 184 184 ASN ASN A . n A 1 159 GLU 159 185 185 GLU GLU A . n A 1 160 PHE 160 186 186 PHE PHE A . n A 1 161 TRP 161 187 187 TRP TRP A . n A 1 162 SER 162 188 188 SER SER A . n A 1 163 ALA 163 189 189 ALA ALA A . n A 1 164 LEU 164 190 190 LEU LEU A . n A 1 165 LEU 165 191 191 LEU LEU A . n A 1 166 GLU 166 192 192 GLU GLU A . n A 1 167 LYS 167 193 193 LYS LYS A . n A 1 168 ALA 168 194 194 ALA ALA A . n A 1 169 TYR 169 195 195 TYR TYR A . n A 1 170 ALA 170 196 196 ALA ALA A . n A 1 171 LYS 171 197 197 LYS LYS A . n A 1 172 VAL 172 198 198 VAL VAL A . n A 1 173 ASN 173 199 199 ASN ASN A . n A 1 174 GLY 174 200 200 GLY GLY A . n A 1 175 SER 175 201 201 SER SER A . n A 1 176 TYR 176 202 202 TYR TYR A . n A 1 177 GLU 177 203 203 GLU GLU A . n A 1 178 ALA 178 204 204 ALA ALA A . n A 1 179 LEU 179 205 205 LEU LEU A . n A 1 180 SER 180 206 206 SER SER A . n A 1 181 GLY 181 207 207 GLY GLY A . n A 1 182 GLY 182 208 208 GLY GLY A . n A 1 183 SER 183 209 209 SER SER A . n A 1 184 THR 184 210 210 THR THR A . n A 1 185 SER 185 211 211 SER SER A . n A 1 186 GLU 186 212 212 GLU GLU A . n A 1 187 GLY 187 213 213 GLY GLY A . n A 1 188 PHE 188 214 214 PHE PHE A . n A 1 189 GLU 189 215 215 GLU GLU A . n A 1 190 ASP 190 216 216 ASP ASP A . n A 1 191 PHE 191 217 217 PHE PHE A . n A 1 192 THR 192 218 218 THR THR A . n A 1 193 GLY 193 219 219 GLY GLY A . n A 1 194 GLY 194 220 220 GLY GLY A . n A 1 195 VAL 195 221 221 VAL VAL A . n A 1 196 THR 196 222 222 THR THR A . n A 1 197 GLU 197 223 223 GLU GLU A . n A 1 198 TRP 198 224 224 TRP TRP A . n A 1 199 TYR 199 225 225 TYR TYR A . n A 1 200 GLU 200 226 226 GLU GLU A . n A 1 201 LEU 201 227 227 LEU LEU A . n A 1 202 ARG 202 228 228 ARG ARG A . n A 1 203 LYS 203 229 229 LYS LYS A . n A 1 204 ALA 204 230 230 ALA ALA A . n A 1 205 PRO 205 231 231 PRO PRO A . n A 1 206 SER 206 232 232 SER SER A . n A 1 207 ASP 207 233 233 ASP ASP A . n A 1 208 LEU 208 234 234 LEU LEU A . n A 1 209 TYR 209 235 235 TYR TYR A . n A 1 210 GLN 210 236 236 GLN GLN A . n A 1 211 ILE 211 237 237 ILE ILE A . n A 1 212 ILE 212 238 238 ILE ILE A . n A 1 213 LEU 213 239 239 LEU LEU A . n A 1 214 LYS 214 240 240 LYS LYS A . n A 1 215 ALA 215 241 241 ALA ALA A . n A 1 216 LEU 216 242 242 LEU LEU A . n A 1 217 GLU 217 243 243 GLU GLU A . n A 1 218 ARG 218 244 244 ARG ARG A . n A 1 219 GLY 219 245 245 GLY GLY A . n A 1 220 SER 220 246 246 SER SER A . n A 1 221 LEU 221 247 247 LEU LEU A . n A 1 222 LEU 222 248 248 LEU LEU A . n A 1 223 GLY 223 249 249 GLY GLY A . n A 1 224 CYS 224 250 250 CYS CYS A . n A 1 225 SER 225 251 251 SER SER A . n A 1 226 ILE 226 252 252 ILE ILE A . n A 1 227 ASP 227 253 253 ASP ASP A . n A 1 228 ILE 228 254 254 ILE ILE A . n A 1 229 SER 229 255 255 SER SER A . n A 1 230 SER 230 256 256 SER SER A . n A 1 231 VAL 231 257 257 VAL VAL A . n A 1 232 LEU 232 258 258 LEU LEU A . n A 1 233 ASP 233 259 259 ASP ASP A . n A 1 234 MET 234 260 260 MET MET A . n A 1 235 GLU 235 261 261 GLU GLU A . n A 1 236 ALA 236 262 262 ALA ALA A . n A 1 237 ILE 237 263 263 ILE ILE A . n A 1 238 THR 238 264 264 THR THR A . n A 1 239 PHE 239 265 265 PHE PHE A . n A 1 240 LYS 240 266 266 LYS LYS A . n A 1 241 LYS 241 267 267 LYS LYS A . n A 1 242 LEU 242 268 268 LEU LEU A . n A 1 243 VAL 243 269 269 VAL VAL A . n A 1 244 LYS 244 270 270 LYS LYS A . n A 1 245 GLY 245 271 271 GLY GLY A . n A 1 246 HIS 246 272 272 HIS HIS A . n A 1 247 ALA 247 273 273 ALA ALA A . n A 1 248 TYR 248 274 274 TYR TYR A . n A 1 249 SER 249 275 275 SER SER A . n A 1 250 VAL 250 276 276 VAL VAL A . n A 1 251 THR 251 277 277 THR THR A . n A 1 252 GLY 252 278 278 GLY GLY A . n A 1 253 ALA 253 279 279 ALA ALA A . n A 1 254 LYS 254 280 280 LYS LYS A . n A 1 255 GLN 255 281 281 GLN GLN A . n A 1 256 VAL 256 282 282 VAL VAL A . n A 1 257 ASN 257 283 283 ASN ASN A . n A 1 258 TYR 258 284 284 TYR TYR A . n A 1 259 ARG 259 285 285 ARG ARG A . n A 1 260 GLY 260 286 286 GLY GLY A . n A 1 261 GLN 261 287 287 GLN GLN A . n A 1 262 VAL 262 288 288 VAL VAL A . n A 1 263 VAL 263 289 289 VAL VAL A . n A 1 264 SER 264 290 290 SER SER A . n A 1 265 LEU 265 291 291 LEU LEU A . n A 1 266 ILE 266 292 292 ILE ILE A . n A 1 267 ARG 267 293 293 ARG ARG A . n A 1 268 MET 268 294 294 MET MET A . n A 1 269 ARG 269 295 295 ARG ARG A . n A 1 270 ASN 270 296 296 ASN ASN A . n A 1 271 PRO 271 297 297 PRO PRO A . n A 1 272 TRP 272 298 298 TRP TRP A . n A 1 273 GLY 273 299 299 GLY GLY A . n A 1 274 GLU 274 300 300 GLU GLU A . n A 1 275 VAL 275 301 301 VAL VAL A . n A 1 276 GLU 276 302 302 GLU GLU A . n A 1 277 TRP 277 303 303 TRP TRP A . n A 1 278 THR 278 304 304 THR THR A . n A 1 279 GLY 279 305 305 GLY GLY A . n A 1 280 ALA 280 306 306 ALA ALA A . n A 1 281 TRP 281 307 307 TRP TRP A . n A 1 282 SER 282 308 308 SER SER A . n A 1 283 ASP 283 309 309 ASP ASP A . n A 1 284 SER 284 310 310 SER SER A . n A 1 285 SER 285 311 311 SER SER A . n A 1 286 SER 286 312 312 SER SER A . n A 1 287 GLU 287 313 313 GLU GLU A . n A 1 288 TRP 288 314 314 TRP TRP A . n A 1 289 ASN 289 315 315 ASN ASN A . n A 1 290 ASN 290 316 316 ASN ASN A . n A 1 291 VAL 291 317 317 VAL VAL A . n A 1 292 ASP 292 318 318 ASP ASP A . n A 1 293 PRO 293 319 319 PRO PRO A . n A 1 294 TYR 294 320 320 TYR TYR A . n A 1 295 GLU 295 321 321 GLU GLU A . n A 1 296 ARG 296 322 322 ARG ARG A . n A 1 297 ASP 297 323 323 ASP ASP A . n A 1 298 GLN 298 324 324 GLN GLN A . n A 1 299 LEU 299 325 325 LEU LEU A . n A 1 300 ARG 300 326 326 ARG ARG A . n A 1 301 VAL 301 327 327 VAL VAL A . n A 1 302 LYS 302 328 328 LYS LYS A . n A 1 303 MET 303 329 329 MET MET A . n A 1 304 GLU 304 330 330 GLU GLU A . n A 1 305 ASP 305 331 331 ASP ASP A . n A 1 306 GLY 306 332 332 GLY GLY A . n A 1 307 GLU 307 333 333 GLU GLU A . n A 1 308 PHE 308 334 334 PHE PHE A . n A 1 309 TRP 309 335 335 TRP TRP A . n A 1 310 MET 310 336 336 MET MET A . n A 1 311 SER 311 337 337 SER SER A . n A 1 312 PHE 312 338 338 PHE PHE A . n A 1 313 ARG 313 339 339 ARG ARG A . n A 1 314 ASP 314 340 340 ASP ASP A . n A 1 315 PHE 315 341 341 PHE PHE A . n A 1 316 MET 316 342 342 MET MET A . n A 1 317 ARG 317 343 343 ARG ARG A . n A 1 318 GLU 318 344 344 GLU GLU A . n A 1 319 PHE 319 345 345 PHE PHE A . n A 1 320 THR 320 346 346 THR THR A . n A 1 321 ARG 321 347 347 ARG ARG A . n A 1 322 LEU 322 348 348 LEU LEU A . n A 1 323 GLU 323 349 349 GLU GLU A . n A 1 324 ILE 324 350 350 ILE ILE A . n A 1 325 CYS 325 351 351 CYS CYS A . n A 1 326 ASN 326 352 352 ASN ASN A . n A 1 327 LEU 327 353 353 LEU LEU A . n A 1 328 THR 328 354 354 THR THR A . n A 1 329 PRO 329 355 355 PRO PRO A . n A 1 330 ASP 330 356 356 ASP ASP A . n A 1 331 ALA 331 357 357 ALA ALA A . n A 1 332 LEU 332 358 358 LEU LEU A . n A 1 333 LYS 333 359 359 LYS LYS A . n A 1 334 SER 334 360 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email zhaoyao3@shanghaitech.edu.cn _pdbx_contact_author.name_first Zihe _pdbx_contact_author.name_last Rao _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9866-2384 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 06Q 1 801 401 06Q DC9 A . C 3 H2S 1 802 501 H2S S A . D 4 CA 1 803 1 CA CA A . E 4 CA 1 804 2 CA CA A . F 5 HOH 1 901 90 HOH HOH A . F 5 HOH 2 902 274 HOH HOH A . F 5 HOH 3 903 249 HOH HOH A . F 5 HOH 4 904 94 HOH HOH A . F 5 HOH 5 905 178 HOH HOH A . F 5 HOH 6 906 230 HOH HOH A . F 5 HOH 7 907 194 HOH HOH A . F 5 HOH 8 908 316 HOH HOH A . F 5 HOH 9 909 91 HOH HOH A . F 5 HOH 10 910 119 HOH HOH A . F 5 HOH 11 911 73 HOH HOH A . F 5 HOH 12 912 53 HOH HOH A . F 5 HOH 13 913 246 HOH HOH A . F 5 HOH 14 914 306 HOH HOH A . F 5 HOH 15 915 159 HOH HOH A . F 5 HOH 16 916 197 HOH HOH A . F 5 HOH 17 917 228 HOH HOH A . F 5 HOH 18 918 114 HOH HOH A . F 5 HOH 19 919 16 HOH HOH A . F 5 HOH 20 920 36 HOH HOH A . F 5 HOH 21 921 86 HOH HOH A . F 5 HOH 22 922 121 HOH HOH A . F 5 HOH 23 923 296 HOH HOH A . F 5 HOH 24 924 180 HOH HOH A . F 5 HOH 25 925 5 HOH HOH A . F 5 HOH 26 926 68 HOH HOH A . F 5 HOH 27 927 188 HOH HOH A . F 5 HOH 28 928 129 HOH HOH A . F 5 HOH 29 929 101 HOH HOH A . F 5 HOH 30 930 134 HOH HOH A . F 5 HOH 31 931 190 HOH HOH A . F 5 HOH 32 932 105 HOH HOH A . F 5 HOH 33 933 9 HOH HOH A . F 5 HOH 34 934 48 HOH HOH A . F 5 HOH 35 935 70 HOH HOH A . F 5 HOH 36 936 239 HOH HOH A . F 5 HOH 37 937 164 HOH HOH A . F 5 HOH 38 938 142 HOH HOH A . F 5 HOH 39 939 321 HOH HOH A . F 5 HOH 40 940 172 HOH HOH A . F 5 HOH 41 941 21 HOH HOH A . F 5 HOH 42 942 166 HOH HOH A . F 5 HOH 43 943 11 HOH HOH A . F 5 HOH 44 944 170 HOH HOH A . F 5 HOH 45 945 92 HOH HOH A . F 5 HOH 46 946 240 HOH HOH A . F 5 HOH 47 947 1 HOH HOH A . F 5 HOH 48 948 261 HOH HOH A . F 5 HOH 49 949 84 HOH HOH A . F 5 HOH 50 950 30 HOH HOH A . F 5 HOH 51 951 78 HOH HOH A . F 5 HOH 52 952 144 HOH HOH A . F 5 HOH 53 953 147 HOH HOH A . F 5 HOH 54 954 171 HOH HOH A . F 5 HOH 55 955 115 HOH HOH A . F 5 HOH 56 956 64 HOH HOH A . F 5 HOH 57 957 154 HOH HOH A . F 5 HOH 58 958 6 HOH HOH A . F 5 HOH 59 959 217 HOH HOH A . F 5 HOH 60 960 160 HOH HOH A . F 5 HOH 61 961 2 HOH HOH A . F 5 HOH 62 962 184 HOH HOH A . F 5 HOH 63 963 10 HOH HOH A . F 5 HOH 64 964 255 HOH HOH A . F 5 HOH 65 965 181 HOH HOH A . F 5 HOH 66 966 44 HOH HOH A . F 5 HOH 67 967 141 HOH HOH A . F 5 HOH 68 968 50 HOH HOH A . F 5 HOH 69 969 137 HOH HOH A . F 5 HOH 70 970 57 HOH HOH A . F 5 HOH 71 971 99 HOH HOH A . F 5 HOH 72 972 173 HOH HOH A . F 5 HOH 73 973 182 HOH HOH A . F 5 HOH 74 974 324 HOH HOH A . F 5 HOH 75 975 31 HOH HOH A . F 5 HOH 76 976 58 HOH HOH A . F 5 HOH 77 977 224 HOH HOH A . F 5 HOH 78 978 22 HOH HOH A . F 5 HOH 79 979 162 HOH HOH A . F 5 HOH 80 980 80 HOH HOH A . F 5 HOH 81 981 38 HOH HOH A . F 5 HOH 82 982 219 HOH HOH A . F 5 HOH 83 983 176 HOH HOH A . F 5 HOH 84 984 110 HOH HOH A . F 5 HOH 85 985 138 HOH HOH A . F 5 HOH 86 986 179 HOH HOH A . F 5 HOH 87 987 227 HOH HOH A . F 5 HOH 88 988 39 HOH HOH A . F 5 HOH 89 989 69 HOH HOH A . F 5 HOH 90 990 67 HOH HOH A . F 5 HOH 91 991 211 HOH HOH A . F 5 HOH 92 992 4 HOH HOH A . F 5 HOH 93 993 113 HOH HOH A . F 5 HOH 94 994 62 HOH HOH A . F 5 HOH 95 995 269 HOH HOH A . F 5 HOH 96 996 15 HOH HOH A . F 5 HOH 97 997 32 HOH HOH A . F 5 HOH 98 998 265 HOH HOH A . F 5 HOH 99 999 287 HOH HOH A . F 5 HOH 100 1000 18 HOH HOH A . F 5 HOH 101 1001 223 HOH HOH A . F 5 HOH 102 1002 8 HOH HOH A . F 5 HOH 103 1003 14 HOH HOH A . F 5 HOH 104 1004 118 HOH HOH A . F 5 HOH 105 1005 231 HOH HOH A . F 5 HOH 106 1006 63 HOH HOH A . F 5 HOH 107 1007 148 HOH HOH A . F 5 HOH 108 1008 167 HOH HOH A . F 5 HOH 109 1009 85 HOH HOH A . F 5 HOH 110 1010 96 HOH HOH A . F 5 HOH 111 1011 191 HOH HOH A . F 5 HOH 112 1012 270 HOH HOH A . F 5 HOH 113 1013 128 HOH HOH A . F 5 HOH 114 1014 174 HOH HOH A . F 5 HOH 115 1015 43 HOH HOH A . F 5 HOH 116 1016 220 HOH HOH A . F 5 HOH 117 1017 19 HOH HOH A . F 5 HOH 118 1018 52 HOH HOH A . F 5 HOH 119 1019 177 HOH HOH A . F 5 HOH 120 1020 34 HOH HOH A . F 5 HOH 121 1021 27 HOH HOH A . F 5 HOH 122 1022 76 HOH HOH A . F 5 HOH 123 1023 65 HOH HOH A . F 5 HOH 124 1024 186 HOH HOH A . F 5 HOH 125 1025 3 HOH HOH A . F 5 HOH 126 1026 23 HOH HOH A . F 5 HOH 127 1027 33 HOH HOH A . F 5 HOH 128 1028 104 HOH HOH A . F 5 HOH 129 1029 135 HOH HOH A . F 5 HOH 130 1030 243 HOH HOH A . F 5 HOH 131 1031 260 HOH HOH A . F 5 HOH 132 1032 74 HOH HOH A . F 5 HOH 133 1033 247 HOH HOH A . F 5 HOH 134 1034 106 HOH HOH A . F 5 HOH 135 1035 12 HOH HOH A . F 5 HOH 136 1036 81 HOH HOH A . F 5 HOH 137 1037 320 HOH HOH A . F 5 HOH 138 1038 61 HOH HOH A . F 5 HOH 139 1039 26 HOH HOH A . F 5 HOH 140 1040 153 HOH HOH A . F 5 HOH 141 1041 225 HOH HOH A . F 5 HOH 142 1042 282 HOH HOH A . F 5 HOH 143 1043 7 HOH HOH A . F 5 HOH 144 1044 241 HOH HOH A . F 5 HOH 145 1045 245 HOH HOH A . F 5 HOH 146 1046 102 HOH HOH A . F 5 HOH 147 1047 133 HOH HOH A . F 5 HOH 148 1048 117 HOH HOH A . F 5 HOH 149 1049 161 HOH HOH A . F 5 HOH 150 1050 55 HOH HOH A . F 5 HOH 151 1051 24 HOH HOH A . F 5 HOH 152 1052 203 HOH HOH A . F 5 HOH 153 1053 109 HOH HOH A . F 5 HOH 154 1054 42 HOH HOH A . F 5 HOH 155 1055 175 HOH HOH A . F 5 HOH 156 1056 124 HOH HOH A . F 5 HOH 157 1057 112 HOH HOH A . F 5 HOH 158 1058 238 HOH HOH A . F 5 HOH 159 1059 56 HOH HOH A . F 5 HOH 160 1060 205 HOH HOH A . F 5 HOH 161 1061 189 HOH HOH A . F 5 HOH 162 1062 193 HOH HOH A . F 5 HOH 163 1063 213 HOH HOH A . F 5 HOH 164 1064 111 HOH HOH A . F 5 HOH 165 1065 212 HOH HOH A . F 5 HOH 166 1066 279 HOH HOH A . F 5 HOH 167 1067 202 HOH HOH A . F 5 HOH 168 1068 150 HOH HOH A . F 5 HOH 169 1069 140 HOH HOH A . F 5 HOH 170 1070 71 HOH HOH A . F 5 HOH 171 1071 28 HOH HOH A . F 5 HOH 172 1072 77 HOH HOH A . F 5 HOH 173 1073 20 HOH HOH A . F 5 HOH 174 1074 125 HOH HOH A . F 5 HOH 175 1075 83 HOH HOH A . F 5 HOH 176 1076 35 HOH HOH A . F 5 HOH 177 1077 47 HOH HOH A . F 5 HOH 178 1078 199 HOH HOH A . F 5 HOH 179 1079 17 HOH HOH A . F 5 HOH 180 1080 185 HOH HOH A . F 5 HOH 181 1081 49 HOH HOH A . F 5 HOH 182 1082 79 HOH HOH A . F 5 HOH 183 1083 198 HOH HOH A . F 5 HOH 184 1084 41 HOH HOH A . F 5 HOH 185 1085 108 HOH HOH A . F 5 HOH 186 1086 156 HOH HOH A . F 5 HOH 187 1087 13 HOH HOH A . F 5 HOH 188 1088 163 HOH HOH A . F 5 HOH 189 1089 93 HOH HOH A . F 5 HOH 190 1090 155 HOH HOH A . F 5 HOH 191 1091 131 HOH HOH A . F 5 HOH 192 1092 272 HOH HOH A . F 5 HOH 193 1093 46 HOH HOH A . F 5 HOH 194 1094 218 HOH HOH A . F 5 HOH 195 1095 169 HOH HOH A . F 5 HOH 196 1096 37 HOH HOH A . F 5 HOH 197 1097 297 HOH HOH A . F 5 HOH 198 1098 97 HOH HOH A . F 5 HOH 199 1099 126 HOH HOH A . F 5 HOH 200 1100 116 HOH HOH A . F 5 HOH 201 1101 165 HOH HOH A . F 5 HOH 202 1102 216 HOH HOH A . F 5 HOH 203 1103 75 HOH HOH A . F 5 HOH 204 1104 29 HOH HOH A . F 5 HOH 205 1105 222 HOH HOH A . F 5 HOH 206 1106 195 HOH HOH A . F 5 HOH 207 1107 277 HOH HOH A . F 5 HOH 208 1108 232 HOH HOH A . F 5 HOH 209 1109 256 HOH HOH A . F 5 HOH 210 1110 132 HOH HOH A . F 5 HOH 211 1111 151 HOH HOH A . F 5 HOH 212 1112 146 HOH HOH A . F 5 HOH 213 1113 149 HOH HOH A . F 5 HOH 214 1114 208 HOH HOH A . F 5 HOH 215 1115 271 HOH HOH A . F 5 HOH 216 1116 291 HOH HOH A . F 5 HOH 217 1117 88 HOH HOH A . F 5 HOH 218 1118 59 HOH HOH A . F 5 HOH 219 1119 60 HOH HOH A . F 5 HOH 220 1120 268 HOH HOH A . F 5 HOH 221 1121 317 HOH HOH A . F 5 HOH 222 1122 82 HOH HOH A . F 5 HOH 223 1123 196 HOH HOH A . F 5 HOH 224 1124 289 HOH HOH A . F 5 HOH 225 1125 123 HOH HOH A . F 5 HOH 226 1126 168 HOH HOH A . F 5 HOH 227 1127 54 HOH HOH A . F 5 HOH 228 1128 313 HOH HOH A . F 5 HOH 229 1129 301 HOH HOH A . F 5 HOH 230 1130 267 HOH HOH A . F 5 HOH 231 1131 283 HOH HOH A . F 5 HOH 232 1132 201 HOH HOH A . F 5 HOH 233 1133 200 HOH HOH A . F 5 HOH 234 1134 229 HOH HOH A . F 5 HOH 235 1135 281 HOH HOH A . F 5 HOH 236 1136 295 HOH HOH A . F 5 HOH 237 1137 293 HOH HOH A . F 5 HOH 238 1138 107 HOH HOH A . F 5 HOH 239 1139 300 HOH HOH A . F 5 HOH 240 1140 262 HOH HOH A . F 5 HOH 241 1141 285 HOH HOH A . F 5 HOH 242 1142 127 HOH HOH A . F 5 HOH 243 1143 136 HOH HOH A . F 5 HOH 244 1144 25 HOH HOH A . F 5 HOH 245 1145 298 HOH HOH A . F 5 HOH 246 1146 250 HOH HOH A . F 5 HOH 247 1147 318 HOH HOH A . F 5 HOH 248 1148 257 HOH HOH A . F 5 HOH 249 1149 51 HOH HOH A . F 5 HOH 250 1150 254 HOH HOH A . F 5 HOH 251 1151 264 HOH HOH A . F 5 HOH 252 1152 214 HOH HOH A . F 5 HOH 253 1153 143 HOH HOH A . F 5 HOH 254 1154 89 HOH HOH A . F 5 HOH 255 1155 327 HOH HOH A . F 5 HOH 256 1156 275 HOH HOH A . F 5 HOH 257 1157 319 HOH HOH A . F 5 HOH 258 1158 120 HOH HOH A . F 5 HOH 259 1159 311 HOH HOH A . F 5 HOH 260 1160 263 HOH HOH A . F 5 HOH 261 1161 252 HOH HOH A . F 5 HOH 262 1162 323 HOH HOH A . F 5 HOH 263 1163 209 HOH HOH A . F 5 HOH 264 1164 237 HOH HOH A . F 5 HOH 265 1165 87 HOH HOH A . F 5 HOH 266 1166 292 HOH HOH A . F 5 HOH 267 1167 204 HOH HOH A . F 5 HOH 268 1168 98 HOH HOH A . F 5 HOH 269 1169 242 HOH HOH A . F 5 HOH 270 1170 248 HOH HOH A . F 5 HOH 271 1171 206 HOH HOH A . F 5 HOH 272 1172 40 HOH HOH A . F 5 HOH 273 1173 251 HOH HOH A . F 5 HOH 274 1174 235 HOH HOH A . F 5 HOH 275 1175 145 HOH HOH A . F 5 HOH 276 1176 312 HOH HOH A . F 5 HOH 277 1177 326 HOH HOH A . F 5 HOH 278 1178 157 HOH HOH A . F 5 HOH 279 1179 187 HOH HOH A . F 5 HOH 280 1180 253 HOH HOH A . F 5 HOH 281 1181 122 HOH HOH A . F 5 HOH 282 1182 280 HOH HOH A . F 5 HOH 283 1183 130 HOH HOH A . F 5 HOH 284 1184 305 HOH HOH A . F 5 HOH 285 1185 278 HOH HOH A . F 5 HOH 286 1186 259 HOH HOH A . F 5 HOH 287 1187 210 HOH HOH A . F 5 HOH 288 1188 103 HOH HOH A . F 5 HOH 289 1189 192 HOH HOH A . F 5 HOH 290 1190 315 HOH HOH A . F 5 HOH 291 1191 183 HOH HOH A . F 5 HOH 292 1192 45 HOH HOH A . F 5 HOH 293 1193 215 HOH HOH A . F 5 HOH 294 1194 226 HOH HOH A . F 5 HOH 295 1195 328 HOH HOH A . F 5 HOH 296 1196 207 HOH HOH A . F 5 HOH 297 1197 234 HOH HOH A . F 5 HOH 298 1198 244 HOH HOH A . F 5 HOH 299 1199 236 HOH HOH A . F 5 HOH 300 1200 304 HOH HOH A . F 5 HOH 301 1201 325 HOH HOH A . F 5 HOH 302 1202 95 HOH HOH A . F 5 HOH 303 1203 273 HOH HOH A . F 5 HOH 304 1204 276 HOH HOH A . F 5 HOH 305 1205 314 HOH HOH A . F 5 HOH 306 1206 66 HOH HOH A . F 5 HOH 307 1207 72 HOH HOH A . F 5 HOH 308 1208 258 HOH HOH A . F 5 HOH 309 1209 266 HOH HOH A . F 5 HOH 310 1210 288 HOH HOH A . F 5 HOH 311 1211 309 HOH HOH A . F 5 HOH 312 1212 286 HOH HOH A . F 5 HOH 313 1214 221 HOH HOH A . F 5 HOH 314 1215 158 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 170 ? 1 MORE -25 ? 1 'SSA (A^2)' 14890 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A VAL 73 ? A VAL 99 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? A GLY 75 ? A GLY 101 ? 1_555 78.4 ? 2 O ? A VAL 73 ? A VAL 99 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OD1 ? A ASP 80 ? A ASP 106 ? 1_555 155.6 ? 3 O ? A GLY 75 ? A GLY 101 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OD1 ? A ASP 80 ? A ASP 106 ? 1_555 122.6 ? 4 O ? A VAL 73 ? A VAL 99 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OD2 ? A ASP 80 ? A ASP 106 ? 1_555 151.4 ? 5 O ? A GLY 75 ? A GLY 101 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OD2 ? A ASP 80 ? A ASP 106 ? 1_555 78.2 ? 6 OD1 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OD2 ? A ASP 80 ? A ASP 106 ? 1_555 52.8 ? 7 O ? A VAL 73 ? A VAL 99 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE1 ? A GLU 159 ? A GLU 185 ? 1_555 107.1 ? 8 O ? A GLY 75 ? A GLY 101 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE1 ? A GLU 159 ? A GLU 185 ? 1_555 134.2 ? 9 OD1 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE1 ? A GLU 159 ? A GLU 185 ? 1_555 68.5 ? 10 OD2 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE1 ? A GLU 159 ? A GLU 185 ? 1_555 78.3 ? 11 O ? A VAL 73 ? A VAL 99 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE2 ? A GLU 159 ? A GLU 185 ? 1_555 82.9 ? 12 O ? A GLY 75 ? A GLY 101 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE2 ? A GLU 159 ? A GLU 185 ? 1_555 86.0 ? 13 OD1 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE2 ? A GLU 159 ? A GLU 185 ? 1_555 108.9 ? 14 OD2 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE2 ? A GLU 159 ? A GLU 185 ? 1_555 79.2 ? 15 OE1 ? A GLU 159 ? A GLU 185 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 OE2 ? A GLU 159 ? A GLU 185 ? 1_555 51.1 ? 16 O ? A VAL 73 ? A VAL 99 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1043 ? 1_555 91.2 ? 17 O ? A GLY 75 ? A GLY 101 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1043 ? 1_555 76.8 ? 18 OD1 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1043 ? 1_555 82.9 ? 19 OD2 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1043 ? 1_555 99.4 ? 20 OE1 ? A GLU 159 ? A GLU 185 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1043 ? 1_555 145.9 ? 21 OE2 ? A GLU 159 ? A GLU 185 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1043 ? 1_555 162.7 ? 22 O ? A VAL 73 ? A VAL 99 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1051 ? 1_555 75.0 ? 23 O ? A GLY 75 ? A GLY 101 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1051 ? 1_555 145.4 ? 24 OD1 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1051 ? 1_555 80.7 ? 25 OD2 ? A ASP 80 ? A ASP 106 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1051 ? 1_555 132.6 ? 26 OE1 ? A GLU 159 ? A GLU 185 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1051 ? 1_555 75.7 ? 27 OE2 ? A GLU 159 ? A GLU 185 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1051 ? 1_555 112.0 ? 28 O ? F HOH . ? A HOH 1043 ? 1_555 CA ? D CA . ? A CA 803 ? 1_555 O ? F HOH . ? A HOH 1051 ? 1_555 81.8 ? 29 OE1 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OE2 ? A GLU 276 ? A GLU 302 ? 1_555 51.1 ? 30 OE1 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD1 ? A ASP 283 ? A ASP 309 ? 1_555 78.7 ? 31 OE2 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD1 ? A ASP 283 ? A ASP 309 ? 1_555 129.7 ? 32 OE1 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD2 ? A ASP 283 ? A ASP 309 ? 1_555 81.2 ? 33 OE2 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD2 ? A ASP 283 ? A ASP 309 ? 1_555 113.5 ? 34 OD1 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD2 ? A ASP 283 ? A ASP 309 ? 1_555 45.6 ? 35 OE1 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A MET 303 ? A MET 329 ? 1_555 113.0 ? 36 OE2 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A MET 303 ? A MET 329 ? 1_555 82.0 ? 37 OD1 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A MET 303 ? A MET 329 ? 1_555 120.9 ? 38 OD2 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A MET 303 ? A MET 329 ? 1_555 77.8 ? 39 OE1 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD1 ? A ASP 305 ? A ASP 331 ? 1_555 122.0 ? 40 OE2 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD1 ? A ASP 305 ? A ASP 331 ? 1_555 74.2 ? 41 OD1 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD1 ? A ASP 305 ? A ASP 331 ? 1_555 152.3 ? 42 OD2 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD1 ? A ASP 305 ? A ASP 331 ? 1_555 146.3 ? 43 O ? A MET 303 ? A MET 329 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 OD1 ? A ASP 305 ? A ASP 331 ? 1_555 70.7 ? 44 OE1 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A GLU 307 ? A GLU 333 ? 1_555 79.3 ? 45 OE2 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A GLU 307 ? A GLU 333 ? 1_555 89.9 ? 46 OD1 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A GLU 307 ? A GLU 333 ? 1_555 83.1 ? 47 OD2 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A GLU 307 ? A GLU 333 ? 1_555 127.8 ? 48 O ? A MET 303 ? A MET 329 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A GLU 307 ? A GLU 333 ? 1_555 154.1 ? 49 OD1 ? A ASP 305 ? A ASP 331 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? A GLU 307 ? A GLU 333 ? 1_555 83.3 ? 50 OE1 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? F HOH . ? A HOH 978 ? 1_555 154.4 ? 51 OE2 ? A GLU 276 ? A GLU 302 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? F HOH . ? A HOH 978 ? 1_555 152.5 ? 52 OD1 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? F HOH . ? A HOH 978 ? 1_555 77.4 ? 53 OD2 ? A ASP 283 ? A ASP 309 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? F HOH . ? A HOH 978 ? 1_555 88.6 ? 54 O ? A MET 303 ? A MET 329 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? F HOH . ? A HOH 978 ? 1_555 87.4 ? 55 OD1 ? A ASP 305 ? A ASP 331 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? F HOH . ? A HOH 978 ? 1_555 78.3 ? 56 O ? A GLU 307 ? A GLU 333 ? 1_555 CA ? E CA . ? A CA 804 ? 1_555 O ? F HOH . ? A HOH 978 ? 1_555 88.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-07 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -36.5700 _pdbx_refine_tls.origin_y 10.0215 _pdbx_refine_tls.origin_z 34.9881 _pdbx_refine_tls.T[1][1] 0.1327 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0126 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0104 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1571 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0227 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.1635 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.9198 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.4532 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.2969 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.6354 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.3861 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.6282 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0856 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0085 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0495 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0044 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0092 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0846 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.1173 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0048 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0696 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 33 ? ? ? A 501 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 1 ? ? ? B 2 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? S 1 ? ? ? S 328 ? ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7W7O _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 71 ? ? -132.02 -77.70 2 1 GLN A 142 ? ? -110.26 -103.97 3 1 PHE A 177 ? ? -101.21 -135.20 4 1 VAL A 301 ? ? 74.26 101.63 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 1212 ? 6.84 . 2 1 O ? A HOH 1214 ? 7.50 . 3 1 O ? A HOH 1215 ? 7.56 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 27 ? A GLY 1 2 1 Y 1 A LEU 28 ? A LEU 2 3 1 Y 1 A GLY 29 ? A GLY 3 4 1 Y 1 A ARG 30 ? A ARG 4 5 1 Y 1 A HIS 31 ? A HIS 5 6 1 Y 1 A GLU 32 ? A GLU 6 7 1 Y 1 A SER 360 ? A SER 334 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 06Q C02 C N N 1 06Q C04 C N S 2 06Q C05 C N N 3 06Q C06 C Y N 4 06Q C07 C Y N 5 06Q C08 C Y N 6 06Q C09 C Y N 7 06Q C11 C Y N 8 06Q C12 C Y N 9 06Q C13 C N N 10 06Q C15 C N S 11 06Q C16 C N N 12 06Q C17 C N S 13 06Q C18 C N N 14 06Q C19 C N N 15 06Q C20 C N N 16 06Q C22 C N N 17 06Q C24 C N S 18 06Q C26 C N N 19 06Q C28 C N N 20 06Q C29 C Y N 21 06Q C30 C Y N 22 06Q C31 C Y N 23 06Q C32 C Y N 24 06Q C33 C Y N 25 06Q C34 C Y N 26 06Q C37 C Y N 27 06Q C38 C Y N 28 06Q C39 C Y N 29 06Q C40 C Y N 30 06Q C41 C Y N 31 06Q C42 C Y N 32 06Q C43 C Y N 33 06Q C44 C Y N 34 06Q F10 F N N 35 06Q N03 N N N 36 06Q N14 N N N 37 06Q N21 N N N 38 06Q N27 N N N 39 06Q O01 O N N 40 06Q O23 O N N 41 06Q O25 O N N 42 06Q O35 O N N 43 06Q O36 O N N 44 06Q O45 O Y N 45 06Q H1 H N N 46 06Q H2 H N N 47 06Q H3 H N N 48 06Q H4 H N N 49 06Q H5 H N N 50 06Q H6 H N N 51 06Q H7 H N N 52 06Q H8 H N N 53 06Q H9 H N N 54 06Q H10 H N N 55 06Q H11 H N N 56 06Q H12 H N N 57 06Q H13 H N N 58 06Q H14 H N N 59 06Q H15 H N N 60 06Q H16 H N N 61 06Q H17 H N N 62 06Q H18 H N N 63 06Q H19 H N N 64 06Q H20 H N N 65 06Q H21 H N N 66 06Q H22 H N N 67 06Q H23 H N N 68 06Q H24 H N N 69 06Q H25 H N N 70 06Q H26 H N N 71 06Q H27 H N N 72 06Q H28 H N N 73 06Q H29 H N N 74 06Q H30 H N N 75 06Q H31 H N N 76 06Q H32 H N N 77 06Q H33 H N N 78 06Q H34 H N N 79 06Q H35 H N N 80 ALA N N N N 81 ALA CA C N S 82 ALA C C N N 83 ALA O O N N 84 ALA CB C N N 85 ALA OXT O N N 86 ALA H H N N 87 ALA H2 H N N 88 ALA HA H N N 89 ALA HB1 H N N 90 ALA HB2 H N N 91 ALA HB3 H N N 92 ALA HXT H N N 93 ARG N N N N 94 ARG CA C N S 95 ARG C C N N 96 ARG O O N N 97 ARG CB C N N 98 ARG CG C N N 99 ARG CD C N N 100 ARG NE N N N 101 ARG CZ C N N 102 ARG NH1 N N N 103 ARG NH2 N N N 104 ARG OXT O N N 105 ARG H H N N 106 ARG H2 H N N 107 ARG HA H N N 108 ARG HB2 H N N 109 ARG HB3 H N N 110 ARG HG2 H N N 111 ARG HG3 H N N 112 ARG HD2 H N N 113 ARG HD3 H N N 114 ARG HE H N N 115 ARG HH11 H N N 116 ARG HH12 H N N 117 ARG HH21 H N N 118 ARG HH22 H N N 119 ARG HXT H N N 120 ASN N N N N 121 ASN CA C N S 122 ASN C C N N 123 ASN O O N N 124 ASN CB C N N 125 ASN CG C N N 126 ASN OD1 O N N 127 ASN ND2 N N N 128 ASN OXT O N N 129 ASN H H N N 130 ASN H2 H N N 131 ASN HA H N N 132 ASN HB2 H N N 133 ASN HB3 H N N 134 ASN HD21 H N N 135 ASN HD22 H N N 136 ASN HXT H N N 137 ASP N N N N 138 ASP CA C N S 139 ASP C C N N 140 ASP O O N N 141 ASP CB C N N 142 ASP CG C N N 143 ASP OD1 O N N 144 ASP OD2 O N N 145 ASP OXT O N N 146 ASP H H N N 147 ASP H2 H N N 148 ASP HA H N N 149 ASP HB2 H N N 150 ASP HB3 H N N 151 ASP HD2 H N N 152 ASP HXT H N N 153 CA CA CA N N 154 CYS N N N N 155 CYS CA C N R 156 CYS C C N N 157 CYS O O N N 158 CYS CB C N N 159 CYS SG S N N 160 CYS OXT O N N 161 CYS H H N N 162 CYS H2 H N N 163 CYS HA H N N 164 CYS HB2 H N N 165 CYS HB3 H N N 166 CYS HG H N N 167 CYS HXT H N N 168 GLN N N N N 169 GLN CA C N S 170 GLN C C N N 171 GLN O O N N 172 GLN CB C N N 173 GLN CG C N N 174 GLN CD C N N 175 GLN OE1 O N N 176 GLN NE2 N N N 177 GLN OXT O N N 178 GLN H H N N 179 GLN H2 H N N 180 GLN HA H N N 181 GLN HB2 H N N 182 GLN HB3 H N N 183 GLN HG2 H N N 184 GLN HG3 H N N 185 GLN HE21 H N N 186 GLN HE22 H N N 187 GLN HXT H N N 188 GLU N N N N 189 GLU CA C N S 190 GLU C C N N 191 GLU O O N N 192 GLU CB C N N 193 GLU CG C N N 194 GLU CD C N N 195 GLU OE1 O N N 196 GLU OE2 O N N 197 GLU OXT O N N 198 GLU H H N N 199 GLU H2 H N N 200 GLU HA H N N 201 GLU HB2 H N N 202 GLU HB3 H N N 203 GLU HG2 H N N 204 GLU HG3 H N N 205 GLU HE2 H N N 206 GLU HXT H N N 207 GLY N N N N 208 GLY CA C N N 209 GLY C C N N 210 GLY O O N N 211 GLY OXT O N N 212 GLY H H N N 213 GLY H2 H N N 214 GLY HA2 H N N 215 GLY HA3 H N N 216 GLY HXT H N N 217 H2S S S N N 218 H2S HS1 H N N 219 H2S HS2 H N N 220 HIS N N N N 221 HIS CA C N S 222 HIS C C N N 223 HIS O O N N 224 HIS CB C N N 225 HIS CG C Y N 226 HIS ND1 N Y N 227 HIS CD2 C Y N 228 HIS CE1 C Y N 229 HIS NE2 N Y N 230 HIS OXT O N N 231 HIS H H N N 232 HIS H2 H N N 233 HIS HA H N N 234 HIS HB2 H N N 235 HIS HB3 H N N 236 HIS HD1 H N N 237 HIS HD2 H N N 238 HIS HE1 H N N 239 HIS HE2 H N N 240 HIS HXT H N N 241 HOH O O N N 242 HOH H1 H N N 243 HOH H2 H N N 244 ILE N N N N 245 ILE CA C N S 246 ILE C C N N 247 ILE O O N N 248 ILE CB C N S 249 ILE CG1 C N N 250 ILE CG2 C N N 251 ILE CD1 C N N 252 ILE OXT O N N 253 ILE H H N N 254 ILE H2 H N N 255 ILE HA H N N 256 ILE HB H N N 257 ILE HG12 H N N 258 ILE HG13 H N N 259 ILE HG21 H N N 260 ILE HG22 H N N 261 ILE HG23 H N N 262 ILE HD11 H N N 263 ILE HD12 H N N 264 ILE HD13 H N N 265 ILE HXT H N N 266 LEU N N N N 267 LEU CA C N S 268 LEU C C N N 269 LEU O O N N 270 LEU CB C N N 271 LEU CG C N N 272 LEU CD1 C N N 273 LEU CD2 C N N 274 LEU OXT O N N 275 LEU H H N N 276 LEU H2 H N N 277 LEU HA H N N 278 LEU HB2 H N N 279 LEU HB3 H N N 280 LEU HG H N N 281 LEU HD11 H N N 282 LEU HD12 H N N 283 LEU HD13 H N N 284 LEU HD21 H N N 285 LEU HD22 H N N 286 LEU HD23 H N N 287 LEU HXT H N N 288 LYS N N N N 289 LYS CA C N S 290 LYS C C N N 291 LYS O O N N 292 LYS CB C N N 293 LYS CG C N N 294 LYS CD C N N 295 LYS CE C N N 296 LYS NZ N N N 297 LYS OXT O N N 298 LYS H H N N 299 LYS H2 H N N 300 LYS HA H N N 301 LYS HB2 H N N 302 LYS HB3 H N N 303 LYS HG2 H N N 304 LYS HG3 H N N 305 LYS HD2 H N N 306 LYS HD3 H N N 307 LYS HE2 H N N 308 LYS HE3 H N N 309 LYS HZ1 H N N 310 LYS HZ2 H N N 311 LYS HZ3 H N N 312 LYS HXT H N N 313 MET N N N N 314 MET CA C N S 315 MET C C N N 316 MET O O N N 317 MET CB C N N 318 MET CG C N N 319 MET SD S N N 320 MET CE C N N 321 MET OXT O N N 322 MET H H N N 323 MET H2 H N N 324 MET HA H N N 325 MET HB2 H N N 326 MET HB3 H N N 327 MET HG2 H N N 328 MET HG3 H N N 329 MET HE1 H N N 330 MET HE2 H N N 331 MET HE3 H N N 332 MET HXT H N N 333 PHE N N N N 334 PHE CA C N S 335 PHE C C N N 336 PHE O O N N 337 PHE CB C N N 338 PHE CG C Y N 339 PHE CD1 C Y N 340 PHE CD2 C Y N 341 PHE CE1 C Y N 342 PHE CE2 C Y N 343 PHE CZ C Y N 344 PHE OXT O N N 345 PHE H H N N 346 PHE H2 H N N 347 PHE HA H N N 348 PHE HB2 H N N 349 PHE HB3 H N N 350 PHE HD1 H N N 351 PHE HD2 H N N 352 PHE HE1 H N N 353 PHE HE2 H N N 354 PHE HZ H N N 355 PHE HXT H N N 356 PRO N N N N 357 PRO CA C N S 358 PRO C C N N 359 PRO O O N N 360 PRO CB C N N 361 PRO CG C N N 362 PRO CD C N N 363 PRO OXT O N N 364 PRO H H N N 365 PRO HA H N N 366 PRO HB2 H N N 367 PRO HB3 H N N 368 PRO HG2 H N N 369 PRO HG3 H N N 370 PRO HD2 H N N 371 PRO HD3 H N N 372 PRO HXT H N N 373 SER N N N N 374 SER CA C N S 375 SER C C N N 376 SER O O N N 377 SER CB C N N 378 SER OG O N N 379 SER OXT O N N 380 SER H H N N 381 SER H2 H N N 382 SER HA H N N 383 SER HB2 H N N 384 SER HB3 H N N 385 SER HG H N N 386 SER HXT H N N 387 THR N N N N 388 THR CA C N S 389 THR C C N N 390 THR O O N N 391 THR CB C N R 392 THR OG1 O N N 393 THR CG2 C N N 394 THR OXT O N N 395 THR H H N N 396 THR H2 H N N 397 THR HA H N N 398 THR HB H N N 399 THR HG1 H N N 400 THR HG21 H N N 401 THR HG22 H N N 402 THR HG23 H N N 403 THR HXT H N N 404 TRP N N N N 405 TRP CA C N S 406 TRP C C N N 407 TRP O O N N 408 TRP CB C N N 409 TRP CG C Y N 410 TRP CD1 C Y N 411 TRP CD2 C Y N 412 TRP NE1 N Y N 413 TRP CE2 C Y N 414 TRP CE3 C Y N 415 TRP CZ2 C Y N 416 TRP CZ3 C Y N 417 TRP CH2 C Y N 418 TRP OXT O N N 419 TRP H H N N 420 TRP H2 H N N 421 TRP HA H N N 422 TRP HB2 H N N 423 TRP HB3 H N N 424 TRP HD1 H N N 425 TRP HE1 H N N 426 TRP HE3 H N N 427 TRP HZ2 H N N 428 TRP HZ3 H N N 429 TRP HH2 H N N 430 TRP HXT H N N 431 TYR N N N N 432 TYR CA C N S 433 TYR C C N N 434 TYR O O N N 435 TYR CB C N N 436 TYR CG C Y N 437 TYR CD1 C Y N 438 TYR CD2 C Y N 439 TYR CE1 C Y N 440 TYR CE2 C Y N 441 TYR CZ C Y N 442 TYR OH O N N 443 TYR OXT O N N 444 TYR H H N N 445 TYR H2 H N N 446 TYR HA H N N 447 TYR HB2 H N N 448 TYR HB3 H N N 449 TYR HD1 H N N 450 TYR HD2 H N N 451 TYR HE1 H N N 452 TYR HE2 H N N 453 TYR HH H N N 454 TYR HXT H N N 455 VAL N N N N 456 VAL CA C N S 457 VAL C C N N 458 VAL O O N N 459 VAL CB C N N 460 VAL CG1 C N N 461 VAL CG2 C N N 462 VAL OXT O N N 463 VAL H H N N 464 VAL H2 H N N 465 VAL HA H N N 466 VAL HB H N N 467 VAL HG11 H N N 468 VAL HG12 H N N 469 VAL HG13 H N N 470 VAL HG21 H N N 471 VAL HG22 H N N 472 VAL HG23 H N N 473 VAL HXT H N N 474 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 06Q N21 C20 sing N N 1 06Q N21 C22 sing N N 2 06Q O23 C22 doub N N 3 06Q C20 C19 sing N N 4 06Q C22 C17 sing N N 5 06Q C16 C17 sing N N 6 06Q C16 C15 sing N N 7 06Q O25 C24 sing N N 8 06Q C19 C18 sing N N 9 06Q C17 C18 sing N N 10 06Q C24 C15 sing N N 11 06Q C24 C26 sing N N 12 06Q C15 N14 sing N N 13 06Q N14 C13 sing N N 14 06Q C26 N27 sing N N 15 06Q C26 O35 doub N N 16 06Q N27 C28 sing N N 17 06Q O01 C02 doub N N 18 06Q O36 C13 doub N N 19 06Q C13 C04 sing N N 20 06Q C38 C37 doub Y N 21 06Q C38 C39 sing Y N 22 06Q C28 C29 sing N N 23 06Q C02 C37 sing N N 24 06Q C02 N03 sing N N 25 06Q C37 O45 sing Y N 26 06Q C40 C39 doub Y N 27 06Q C40 C41 sing Y N 28 06Q C39 C44 sing Y N 29 06Q C04 N03 sing N N 30 06Q C04 C05 sing N N 31 06Q C29 C30 doub Y N 32 06Q C29 C34 sing Y N 33 06Q C41 C42 doub Y N 34 06Q O45 C44 sing Y N 35 06Q C30 C31 sing Y N 36 06Q C44 C43 doub Y N 37 06Q C05 C06 sing N N 38 06Q C34 C33 doub Y N 39 06Q C42 C43 sing Y N 40 06Q C07 C06 doub Y N 41 06Q C07 C08 sing Y N 42 06Q C31 C32 doub Y N 43 06Q C06 C12 sing Y N 44 06Q C08 C09 doub Y N 45 06Q C33 C32 sing Y N 46 06Q C12 C11 doub Y N 47 06Q C09 C11 sing Y N 48 06Q C09 F10 sing N N 49 06Q C04 H1 sing N N 50 06Q C05 H2 sing N N 51 06Q C05 H3 sing N N 52 06Q C07 H4 sing N N 53 06Q C08 H5 sing N N 54 06Q C11 H6 sing N N 55 06Q C12 H7 sing N N 56 06Q C15 H8 sing N N 57 06Q C16 H9 sing N N 58 06Q C16 H10 sing N N 59 06Q C17 H11 sing N N 60 06Q C18 H12 sing N N 61 06Q C18 H13 sing N N 62 06Q C19 H14 sing N N 63 06Q C19 H15 sing N N 64 06Q C20 H16 sing N N 65 06Q C20 H17 sing N N 66 06Q C24 H18 sing N N 67 06Q C28 H19 sing N N 68 06Q C28 H20 sing N N 69 06Q C30 H21 sing N N 70 06Q C31 H22 sing N N 71 06Q C32 H23 sing N N 72 06Q C33 H24 sing N N 73 06Q C34 H25 sing N N 74 06Q C38 H26 sing N N 75 06Q C40 H27 sing N N 76 06Q C41 H28 sing N N 77 06Q C42 H29 sing N N 78 06Q C43 H30 sing N N 79 06Q N03 H31 sing N N 80 06Q N14 H32 sing N N 81 06Q N21 H33 sing N N 82 06Q N27 H34 sing N N 83 06Q O25 H35 sing N N 84 ALA N CA sing N N 85 ALA N H sing N N 86 ALA N H2 sing N N 87 ALA CA C sing N N 88 ALA CA CB sing N N 89 ALA CA HA sing N N 90 ALA C O doub N N 91 ALA C OXT sing N N 92 ALA CB HB1 sing N N 93 ALA CB HB2 sing N N 94 ALA CB HB3 sing N N 95 ALA OXT HXT sing N N 96 ARG N CA sing N N 97 ARG N H sing N N 98 ARG N H2 sing N N 99 ARG CA C sing N N 100 ARG CA CB sing N N 101 ARG CA HA sing N N 102 ARG C O doub N N 103 ARG C OXT sing N N 104 ARG CB CG sing N N 105 ARG CB HB2 sing N N 106 ARG CB HB3 sing N N 107 ARG CG CD sing N N 108 ARG CG HG2 sing N N 109 ARG CG HG3 sing N N 110 ARG CD NE sing N N 111 ARG CD HD2 sing N N 112 ARG CD HD3 sing N N 113 ARG NE CZ sing N N 114 ARG NE HE sing N N 115 ARG CZ NH1 sing N N 116 ARG CZ NH2 doub N N 117 ARG NH1 HH11 sing N N 118 ARG NH1 HH12 sing N N 119 ARG NH2 HH21 sing N N 120 ARG NH2 HH22 sing N N 121 ARG OXT HXT sing N N 122 ASN N CA sing N N 123 ASN N H sing N N 124 ASN N H2 sing N N 125 ASN CA C sing N N 126 ASN CA CB sing N N 127 ASN CA HA sing N N 128 ASN C O doub N N 129 ASN C OXT sing N N 130 ASN CB CG sing N N 131 ASN CB HB2 sing N N 132 ASN CB HB3 sing N N 133 ASN CG OD1 doub N N 134 ASN CG ND2 sing N N 135 ASN ND2 HD21 sing N N 136 ASN ND2 HD22 sing N N 137 ASN OXT HXT sing N N 138 ASP N CA sing N N 139 ASP N H sing N N 140 ASP N H2 sing N N 141 ASP CA C sing N N 142 ASP CA CB sing N N 143 ASP CA HA sing N N 144 ASP C O doub N N 145 ASP C OXT sing N N 146 ASP CB CG sing N N 147 ASP CB HB2 sing N N 148 ASP CB HB3 sing N N 149 ASP CG OD1 doub N N 150 ASP CG OD2 sing N N 151 ASP OD2 HD2 sing N N 152 ASP OXT HXT sing N N 153 CYS N CA sing N N 154 CYS N H sing N N 155 CYS N H2 sing N N 156 CYS CA C sing N N 157 CYS CA CB sing N N 158 CYS CA HA sing N N 159 CYS C O doub N N 160 CYS C OXT sing N N 161 CYS CB SG sing N N 162 CYS CB HB2 sing N N 163 CYS CB HB3 sing N N 164 CYS SG HG sing N N 165 CYS OXT HXT sing N N 166 GLN N CA sing N N 167 GLN N H sing N N 168 GLN N H2 sing N N 169 GLN CA C sing N N 170 GLN CA CB sing N N 171 GLN CA HA sing N N 172 GLN C O doub N N 173 GLN C OXT sing N N 174 GLN CB CG sing N N 175 GLN CB HB2 sing N N 176 GLN CB HB3 sing N N 177 GLN CG CD sing N N 178 GLN CG HG2 sing N N 179 GLN CG HG3 sing N N 180 GLN CD OE1 doub N N 181 GLN CD NE2 sing N N 182 GLN NE2 HE21 sing N N 183 GLN NE2 HE22 sing N N 184 GLN OXT HXT sing N N 185 GLU N CA sing N N 186 GLU N H sing N N 187 GLU N H2 sing N N 188 GLU CA C sing N N 189 GLU CA CB sing N N 190 GLU CA HA sing N N 191 GLU C O doub N N 192 GLU C OXT sing N N 193 GLU CB CG sing N N 194 GLU CB HB2 sing N N 195 GLU CB HB3 sing N N 196 GLU CG CD sing N N 197 GLU CG HG2 sing N N 198 GLU CG HG3 sing N N 199 GLU CD OE1 doub N N 200 GLU CD OE2 sing N N 201 GLU OE2 HE2 sing N N 202 GLU OXT HXT sing N N 203 GLY N CA sing N N 204 GLY N H sing N N 205 GLY N H2 sing N N 206 GLY CA C sing N N 207 GLY CA HA2 sing N N 208 GLY CA HA3 sing N N 209 GLY C O doub N N 210 GLY C OXT sing N N 211 GLY OXT HXT sing N N 212 H2S S HS1 sing N N 213 H2S S HS2 sing N N 214 HIS N CA sing N N 215 HIS N H sing N N 216 HIS N H2 sing N N 217 HIS CA C sing N N 218 HIS CA CB sing N N 219 HIS CA HA sing N N 220 HIS C O doub N N 221 HIS C OXT sing N N 222 HIS CB CG sing N N 223 HIS CB HB2 sing N N 224 HIS CB HB3 sing N N 225 HIS CG ND1 sing Y N 226 HIS CG CD2 doub Y N 227 HIS ND1 CE1 doub Y N 228 HIS ND1 HD1 sing N N 229 HIS CD2 NE2 sing Y N 230 HIS CD2 HD2 sing N N 231 HIS CE1 NE2 sing Y N 232 HIS CE1 HE1 sing N N 233 HIS NE2 HE2 sing N N 234 HIS OXT HXT sing N N 235 HOH O H1 sing N N 236 HOH O H2 sing N N 237 ILE N CA sing N N 238 ILE N H sing N N 239 ILE N H2 sing N N 240 ILE CA C sing N N 241 ILE CA CB sing N N 242 ILE CA HA sing N N 243 ILE C O doub N N 244 ILE C OXT sing N N 245 ILE CB CG1 sing N N 246 ILE CB CG2 sing N N 247 ILE CB HB sing N N 248 ILE CG1 CD1 sing N N 249 ILE CG1 HG12 sing N N 250 ILE CG1 HG13 sing N N 251 ILE CG2 HG21 sing N N 252 ILE CG2 HG22 sing N N 253 ILE CG2 HG23 sing N N 254 ILE CD1 HD11 sing N N 255 ILE CD1 HD12 sing N N 256 ILE CD1 HD13 sing N N 257 ILE OXT HXT sing N N 258 LEU N CA sing N N 259 LEU N H sing N N 260 LEU N H2 sing N N 261 LEU CA C sing N N 262 LEU CA CB sing N N 263 LEU CA HA sing N N 264 LEU C O doub N N 265 LEU C OXT sing N N 266 LEU CB CG sing N N 267 LEU CB HB2 sing N N 268 LEU CB HB3 sing N N 269 LEU CG CD1 sing N N 270 LEU CG CD2 sing N N 271 LEU CG HG sing N N 272 LEU CD1 HD11 sing N N 273 LEU CD1 HD12 sing N N 274 LEU CD1 HD13 sing N N 275 LEU CD2 HD21 sing N N 276 LEU CD2 HD22 sing N N 277 LEU CD2 HD23 sing N N 278 LEU OXT HXT sing N N 279 LYS N CA sing N N 280 LYS N H sing N N 281 LYS N H2 sing N N 282 LYS CA C sing N N 283 LYS CA CB sing N N 284 LYS CA HA sing N N 285 LYS C O doub N N 286 LYS C OXT sing N N 287 LYS CB CG sing N N 288 LYS CB HB2 sing N N 289 LYS CB HB3 sing N N 290 LYS CG CD sing N N 291 LYS CG HG2 sing N N 292 LYS CG HG3 sing N N 293 LYS CD CE sing N N 294 LYS CD HD2 sing N N 295 LYS CD HD3 sing N N 296 LYS CE NZ sing N N 297 LYS CE HE2 sing N N 298 LYS CE HE3 sing N N 299 LYS NZ HZ1 sing N N 300 LYS NZ HZ2 sing N N 301 LYS NZ HZ3 sing N N 302 LYS OXT HXT sing N N 303 MET N CA sing N N 304 MET N H sing N N 305 MET N H2 sing N N 306 MET CA C sing N N 307 MET CA CB sing N N 308 MET CA HA sing N N 309 MET C O doub N N 310 MET C OXT sing N N 311 MET CB CG sing N N 312 MET CB HB2 sing N N 313 MET CB HB3 sing N N 314 MET CG SD sing N N 315 MET CG HG2 sing N N 316 MET CG HG3 sing N N 317 MET SD CE sing N N 318 MET CE HE1 sing N N 319 MET CE HE2 sing N N 320 MET CE HE3 sing N N 321 MET OXT HXT sing N N 322 PHE N CA sing N N 323 PHE N H sing N N 324 PHE N H2 sing N N 325 PHE CA C sing N N 326 PHE CA CB sing N N 327 PHE CA HA sing N N 328 PHE C O doub N N 329 PHE C OXT sing N N 330 PHE CB CG sing N N 331 PHE CB HB2 sing N N 332 PHE CB HB3 sing N N 333 PHE CG CD1 doub Y N 334 PHE CG CD2 sing Y N 335 PHE CD1 CE1 sing Y N 336 PHE CD1 HD1 sing N N 337 PHE CD2 CE2 doub Y N 338 PHE CD2 HD2 sing N N 339 PHE CE1 CZ doub Y N 340 PHE CE1 HE1 sing N N 341 PHE CE2 CZ sing Y N 342 PHE CE2 HE2 sing N N 343 PHE CZ HZ sing N N 344 PHE OXT HXT sing N N 345 PRO N CA sing N N 346 PRO N CD sing N N 347 PRO N H sing N N 348 PRO CA C sing N N 349 PRO CA CB sing N N 350 PRO CA HA sing N N 351 PRO C O doub N N 352 PRO C OXT sing N N 353 PRO CB CG sing N N 354 PRO CB HB2 sing N N 355 PRO CB HB3 sing N N 356 PRO CG CD sing N N 357 PRO CG HG2 sing N N 358 PRO CG HG3 sing N N 359 PRO CD HD2 sing N N 360 PRO CD HD3 sing N N 361 PRO OXT HXT sing N N 362 SER N CA sing N N 363 SER N H sing N N 364 SER N H2 sing N N 365 SER CA C sing N N 366 SER CA CB sing N N 367 SER CA HA sing N N 368 SER C O doub N N 369 SER C OXT sing N N 370 SER CB OG sing N N 371 SER CB HB2 sing N N 372 SER CB HB3 sing N N 373 SER OG HG sing N N 374 SER OXT HXT sing N N 375 THR N CA sing N N 376 THR N H sing N N 377 THR N H2 sing N N 378 THR CA C sing N N 379 THR CA CB sing N N 380 THR CA HA sing N N 381 THR C O doub N N 382 THR C OXT sing N N 383 THR CB OG1 sing N N 384 THR CB CG2 sing N N 385 THR CB HB sing N N 386 THR OG1 HG1 sing N N 387 THR CG2 HG21 sing N N 388 THR CG2 HG22 sing N N 389 THR CG2 HG23 sing N N 390 THR OXT HXT sing N N 391 TRP N CA sing N N 392 TRP N H sing N N 393 TRP N H2 sing N N 394 TRP CA C sing N N 395 TRP CA CB sing N N 396 TRP CA HA sing N N 397 TRP C O doub N N 398 TRP C OXT sing N N 399 TRP CB CG sing N N 400 TRP CB HB2 sing N N 401 TRP CB HB3 sing N N 402 TRP CG CD1 doub Y N 403 TRP CG CD2 sing Y N 404 TRP CD1 NE1 sing Y N 405 TRP CD1 HD1 sing N N 406 TRP CD2 CE2 doub Y N 407 TRP CD2 CE3 sing Y N 408 TRP NE1 CE2 sing Y N 409 TRP NE1 HE1 sing N N 410 TRP CE2 CZ2 sing Y N 411 TRP CE3 CZ3 doub Y N 412 TRP CE3 HE3 sing N N 413 TRP CZ2 CH2 doub Y N 414 TRP CZ2 HZ2 sing N N 415 TRP CZ3 CH2 sing Y N 416 TRP CZ3 HZ3 sing N N 417 TRP CH2 HH2 sing N N 418 TRP OXT HXT sing N N 419 TYR N CA sing N N 420 TYR N H sing N N 421 TYR N H2 sing N N 422 TYR CA C sing N N 423 TYR CA CB sing N N 424 TYR CA HA sing N N 425 TYR C O doub N N 426 TYR C OXT sing N N 427 TYR CB CG sing N N 428 TYR CB HB2 sing N N 429 TYR CB HB3 sing N N 430 TYR CG CD1 doub Y N 431 TYR CG CD2 sing Y N 432 TYR CD1 CE1 sing Y N 433 TYR CD1 HD1 sing N N 434 TYR CD2 CE2 doub Y N 435 TYR CD2 HD2 sing N N 436 TYR CE1 CZ doub Y N 437 TYR CE1 HE1 sing N N 438 TYR CE2 CZ sing Y N 439 TYR CE2 HE2 sing N N 440 TYR CZ OH sing N N 441 TYR OH HH sing N N 442 TYR OXT HXT sing N N 443 VAL N CA sing N N 444 VAL N H sing N N 445 VAL N H2 sing N N 446 VAL CA C sing N N 447 VAL CA CB sing N N 448 VAL CA HA sing N N 449 VAL C O doub N N 450 VAL C OXT sing N N 451 VAL CB CG1 sing N N 452 VAL CB CG2 sing N N 453 VAL CB HB sing N N 454 VAL CG1 HG11 sing N N 455 VAL CG1 HG12 sing N N 456 VAL CG1 HG13 sing N N 457 VAL CG2 HG21 sing N N 458 VAL CG2 HG22 sing N N 459 VAL CG2 HG23 sing N N 460 VAL OXT HXT sing N N 461 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 813300237 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 06Q _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 06Q _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N-[(2S)-3-(4-fluorophenyl)-1-oxidanylidene-1-[[(2S,3S)-3-oxidanyl-4-oxidanylidene-1-[(3S)-2-oxidanylidenepiperidin-3-yl]-4-[(phenylmethyl)amino]butan-2-yl]amino]propan-2-yl]-1-benzofuran-2-carboxamide ; 06Q 3 'HYDROSULFURIC ACID' H2S 4 'CALCIUM ION' CA 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ZCM _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #