data_7WR2 # _entry.id 7WR2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7WR2 pdb_00007wr2 10.2210/pdb7wr2/pdb WWPDB D_1300027096 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7WR2 _pdbx_database_status.recvd_initial_deposition_date 2022-01-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hou, Y.J.' 1 0000-0002-5234-9277 'Zeng, H.' 2 ? 'Shao, F.' 3 0000-0002-9562-7791 'Ding, J.' 4 0000-0001-9941-7997 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 30 _citation.language ? _citation.page_first 261 _citation.page_last 272 _citation.title 'Structural mechanisms of calmodulin activation of Shigella effector OspC3 to ADP-riboxanate caspase-4/11 and block pyroptosis.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41594-022-00888-3 _citation.pdbx_database_id_PubMed 36624349 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hou, Y.' 1 0000-0002-5234-9277 primary 'Zeng, H.' 2 ? primary 'Li, Z.' 3 0000-0003-3410-8231 primary 'Feng, N.' 4 ? primary 'Meng, F.' 5 ? primary 'Xu, Y.' 6 ? primary 'Li, L.' 7 ? primary 'Shao, F.' 8 0000-0002-9562-7791 primary 'Ding, J.' 9 0000-0001-9941-7997 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7WR2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.215 _cell.length_a_esd ? _cell.length_b 53.943 _cell.length_b_esd ? _cell.length_c 59.932 _cell.length_c_esd ? _cell.volume 126778.639 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7WR2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man OspC3 18366.213 1 ? ? ? ? 2 water nat water 18.015 176 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSGRPMLSTDNFKKIKLRDISLEDAIKASNYEEINNKVTDKKMAHQALAYSLGNKKADIALYLLSKFNFTKQDVAEM EKMKNNRYCNLYDVEYLLSKDGANYKVLEYFINNGLVDVNKKFQKVNSGDTMLDNAMKSKDSKMIDFLLKNGAILGKRFE I ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSGRPMLSTDNFKKIKLRDISLEDAIKASNYEEINNKVTDKKMAHQALAYSLGNKKADIALYLLSKFNFTKQDVAEM EKMKNNRYCNLYDVEYLLSKDGANYKVLEYFINNGLVDVNKKFQKVNSGDTMLDNAMKSKDSKMIDFLLKNGAILGKRFE I ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 GLY n 1 7 ARG n 1 8 PRO n 1 9 MET n 1 10 LEU n 1 11 SER n 1 12 THR n 1 13 ASP n 1 14 ASN n 1 15 PHE n 1 16 LYS n 1 17 LYS n 1 18 ILE n 1 19 LYS n 1 20 LEU n 1 21 ARG n 1 22 ASP n 1 23 ILE n 1 24 SER n 1 25 LEU n 1 26 GLU n 1 27 ASP n 1 28 ALA n 1 29 ILE n 1 30 LYS n 1 31 ALA n 1 32 SER n 1 33 ASN n 1 34 TYR n 1 35 GLU n 1 36 GLU n 1 37 ILE n 1 38 ASN n 1 39 ASN n 1 40 LYS n 1 41 VAL n 1 42 THR n 1 43 ASP n 1 44 LYS n 1 45 LYS n 1 46 MET n 1 47 ALA n 1 48 HIS n 1 49 GLN n 1 50 ALA n 1 51 LEU n 1 52 ALA n 1 53 TYR n 1 54 SER n 1 55 LEU n 1 56 GLY n 1 57 ASN n 1 58 LYS n 1 59 LYS n 1 60 ALA n 1 61 ASP n 1 62 ILE n 1 63 ALA n 1 64 LEU n 1 65 TYR n 1 66 LEU n 1 67 LEU n 1 68 SER n 1 69 LYS n 1 70 PHE n 1 71 ASN n 1 72 PHE n 1 73 THR n 1 74 LYS n 1 75 GLN n 1 76 ASP n 1 77 VAL n 1 78 ALA n 1 79 GLU n 1 80 MET n 1 81 GLU n 1 82 LYS n 1 83 MET n 1 84 LYS n 1 85 ASN n 1 86 ASN n 1 87 ARG n 1 88 TYR n 1 89 CYS n 1 90 ASN n 1 91 LEU n 1 92 TYR n 1 93 ASP n 1 94 VAL n 1 95 GLU n 1 96 TYR n 1 97 LEU n 1 98 LEU n 1 99 SER n 1 100 LYS n 1 101 ASP n 1 102 GLY n 1 103 ALA n 1 104 ASN n 1 105 TYR n 1 106 LYS n 1 107 VAL n 1 108 LEU n 1 109 GLU n 1 110 TYR n 1 111 PHE n 1 112 ILE n 1 113 ASN n 1 114 ASN n 1 115 GLY n 1 116 LEU n 1 117 VAL n 1 118 ASP n 1 119 VAL n 1 120 ASN n 1 121 LYS n 1 122 LYS n 1 123 PHE n 1 124 GLN n 1 125 LYS n 1 126 VAL n 1 127 ASN n 1 128 SER n 1 129 GLY n 1 130 ASP n 1 131 THR n 1 132 MET n 1 133 LEU n 1 134 ASP n 1 135 ASN n 1 136 ALA n 1 137 MET n 1 138 LYS n 1 139 SER n 1 140 LYS n 1 141 ASP n 1 142 SER n 1 143 LYS n 1 144 MET n 1 145 ILE n 1 146 ASP n 1 147 PHE n 1 148 LEU n 1 149 LEU n 1 150 LYS n 1 151 ASN n 1 152 GLY n 1 153 ALA n 1 154 ILE n 1 155 LEU n 1 156 GLY n 1 157 LYS n 1 158 ARG n 1 159 PHE n 1 160 GLU n 1 161 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 161 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ospC3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shigella flexneri' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6p-2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R4X5L7_SHIFL _struct_ref.pdbx_db_accession R4X5L7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLSTDNFKKIKLRDISLEDAIKASNYEEINNKVTDKKMAHQALAYSLGNKKADIALYLLSKFNFTKQDVAEMEKMKNNRY CNLYDVEYLLSKDGANYKVLEYFINNGLVDVNKKFQKVNSGDTMLDNAMKSKDSKMIDFLLKNGAILGKRFEI ; _struct_ref.pdbx_align_begin 332 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7WR2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession R4X5L7 _struct_ref_seq.db_align_beg 332 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 484 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 332 _struct_ref_seq.pdbx_auth_seq_align_end 484 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7WR2 GLY A 1 ? UNP R4X5L7 ? ? 'expression tag' 324 1 1 7WR2 PRO A 2 ? UNP R4X5L7 ? ? 'expression tag' 325 2 1 7WR2 LEU A 3 ? UNP R4X5L7 ? ? 'expression tag' 326 3 1 7WR2 GLY A 4 ? UNP R4X5L7 ? ? 'expression tag' 327 4 1 7WR2 SER A 5 ? UNP R4X5L7 ? ? 'expression tag' 328 5 1 7WR2 GLY A 6 ? UNP R4X5L7 ? ? 'expression tag' 329 6 1 7WR2 ARG A 7 ? UNP R4X5L7 ? ? 'expression tag' 330 7 1 7WR2 PRO A 8 ? UNP R4X5L7 ? ? 'expression tag' 331 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7WR2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG monomethyl ether 550, 0.1 M Bis-Tris propane pH 9.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-31 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97892 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97892 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 17.32 _reflns.entry_id 7WR2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.54 _reflns.d_resolution_low 40.10 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19087 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.02 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.58 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.049 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.54 _reflns_shell.d_res_low 1.58 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 7.87 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1304 _reflns_shell.percent_possible_all 92.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.158 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.176 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.977 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 21.83 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7WR2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.54 _refine.ls_d_res_low 40.09 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19047 _refine.ls_number_reflns_R_free 1905 _refine.ls_number_reflns_R_work 17142 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.67 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1705 _refine.ls_R_factor_R_free 0.1903 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1683 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.40 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7WR1 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.0133 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1318 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.54 _refine_hist.d_res_low 40.09 _refine_hist.number_atoms_solvent 176 _refine_hist.number_atoms_total 1264 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1088 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0061 ? 1107 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8371 ? 1481 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0469 ? 163 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0039 ? 189 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.1985 ? 428 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.54 1.58 . . 125 1124 92.45 . . . 0.2282 . 0.1789 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.58 1.62 . . 134 1208 98.97 . . . 0.2248 . 0.1713 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.62 1.67 . . 132 1193 98.88 . . . 0.1851 . 0.1800 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.67 1.73 . . 135 1208 99.04 . . . 0.2280 . 0.1750 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.73 1.79 . . 136 1223 99.20 . . . 0.2287 . 0.1851 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.79 1.86 . . 134 1209 98.90 . . . 0.1997 . 0.1754 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.86 1.94 . . 135 1222 99.49 . . . 0.2376 . 0.1796 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.94 2.05 . . 136 1217 99.49 . . . 0.2114 . 0.1673 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.05 2.17 . . 136 1228 99.13 . . . 0.2028 . 0.1634 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.18 2.34 . . 137 1222 98.91 . . . 0.1918 . 0.1628 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.34 2.58 . . 137 1244 99.57 . . . 0.1811 . 0.1734 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.58 2.95 . . 138 1239 98.85 . . . 0.2168 . 0.1718 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.95 3.72 . . 141 1263 99.29 . . . 0.1608 . 0.1657 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.72 40.09 . . 149 1342 99.14 . . . 0.1667 . 0.1609 . . . . . . . . . . . # _struct.entry_id 7WR2 _struct.title 'Cryatal structure of OspC3 C-terminal ankyrin-repeat domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7WR2 _struct_keywords.text 'ADP-riboxanase, effector, ankyrin-repeat domain, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 24 ? ALA A 31 ? SER A 347 ALA A 354 1 ? 8 HELX_P HELX_P2 AA2 ASN A 33 ? VAL A 41 ? ASN A 356 VAL A 364 1 ? 9 HELX_P HELX_P3 AA3 ASP A 43 ? ASN A 57 ? ASP A 366 ASN A 380 1 ? 15 HELX_P HELX_P4 AA4 LYS A 59 ? PHE A 70 ? LYS A 382 PHE A 393 1 ? 12 HELX_P HELX_P5 AA5 THR A 73 ? GLU A 81 ? THR A 396 GLU A 404 1 ? 9 HELX_P HELX_P6 AA6 ASN A 86 ? TYR A 92 ? ASN A 409 TYR A 415 1 ? 7 HELX_P HELX_P7 AA7 ASP A 93 ? LYS A 100 ? ASP A 416 LYS A 423 1 ? 8 HELX_P HELX_P8 AA8 ASP A 101 ? ALA A 103 ? ASP A 424 ALA A 426 5 ? 3 HELX_P HELX_P9 AA9 ASN A 104 ? ASN A 114 ? ASN A 427 ASN A 437 1 ? 11 HELX_P HELX_P10 AB1 THR A 131 ? LYS A 140 ? THR A 454 LYS A 463 1 ? 10 HELX_P HELX_P11 AB2 ASP A 141 ? ASN A 151 ? ASP A 464 ASN A 474 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7WR2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025500 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018538 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016686 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 324 ? ? ? A . n A 1 2 PRO 2 325 ? ? ? A . n A 1 3 LEU 3 326 ? ? ? A . n A 1 4 GLY 4 327 ? ? ? A . n A 1 5 SER 5 328 ? ? ? A . n A 1 6 GLY 6 329 ? ? ? A . n A 1 7 ARG 7 330 ? ? ? A . n A 1 8 PRO 8 331 ? ? ? A . n A 1 9 MET 9 332 ? ? ? A . n A 1 10 LEU 10 333 ? ? ? A . n A 1 11 SER 11 334 ? ? ? A . n A 1 12 THR 12 335 ? ? ? A . n A 1 13 ASP 13 336 ? ? ? A . n A 1 14 ASN 14 337 ? ? ? A . n A 1 15 PHE 15 338 ? ? ? A . n A 1 16 LYS 16 339 ? ? ? A . n A 1 17 LYS 17 340 ? ? ? A . n A 1 18 ILE 18 341 ? ? ? A . n A 1 19 LYS 19 342 ? ? ? A . n A 1 20 LEU 20 343 ? ? ? A . n A 1 21 ARG 21 344 ? ? ? A . n A 1 22 ASP 22 345 ? ? ? A . n A 1 23 ILE 23 346 346 ILE ILE A . n A 1 24 SER 24 347 347 SER SER A . n A 1 25 LEU 25 348 348 LEU LEU A . n A 1 26 GLU 26 349 349 GLU GLU A . n A 1 27 ASP 27 350 350 ASP ASP A . n A 1 28 ALA 28 351 351 ALA ALA A . n A 1 29 ILE 29 352 352 ILE ILE A . n A 1 30 LYS 30 353 353 LYS LYS A . n A 1 31 ALA 31 354 354 ALA ALA A . n A 1 32 SER 32 355 355 SER SER A . n A 1 33 ASN 33 356 356 ASN ASN A . n A 1 34 TYR 34 357 357 TYR TYR A . n A 1 35 GLU 35 358 358 GLU GLU A . n A 1 36 GLU 36 359 359 GLU GLU A . n A 1 37 ILE 37 360 360 ILE ILE A . n A 1 38 ASN 38 361 361 ASN ASN A . n A 1 39 ASN 39 362 362 ASN ASN A . n A 1 40 LYS 40 363 363 LYS LYS A . n A 1 41 VAL 41 364 364 VAL VAL A . n A 1 42 THR 42 365 365 THR THR A . n A 1 43 ASP 43 366 366 ASP ASP A . n A 1 44 LYS 44 367 367 LYS LYS A . n A 1 45 LYS 45 368 368 LYS LYS A . n A 1 46 MET 46 369 369 MET MET A . n A 1 47 ALA 47 370 370 ALA ALA A . n A 1 48 HIS 48 371 371 HIS HIS A . n A 1 49 GLN 49 372 372 GLN GLN A . n A 1 50 ALA 50 373 373 ALA ALA A . n A 1 51 LEU 51 374 374 LEU LEU A . n A 1 52 ALA 52 375 375 ALA ALA A . n A 1 53 TYR 53 376 376 TYR TYR A . n A 1 54 SER 54 377 377 SER SER A . n A 1 55 LEU 55 378 378 LEU LEU A . n A 1 56 GLY 56 379 379 GLY GLY A . n A 1 57 ASN 57 380 380 ASN ASN A . n A 1 58 LYS 58 381 381 LYS LYS A . n A 1 59 LYS 59 382 382 LYS LYS A . n A 1 60 ALA 60 383 383 ALA ALA A . n A 1 61 ASP 61 384 384 ASP ASP A . n A 1 62 ILE 62 385 385 ILE ILE A . n A 1 63 ALA 63 386 386 ALA ALA A . n A 1 64 LEU 64 387 387 LEU LEU A . n A 1 65 TYR 65 388 388 TYR TYR A . n A 1 66 LEU 66 389 389 LEU LEU A . n A 1 67 LEU 67 390 390 LEU LEU A . n A 1 68 SER 68 391 391 SER SER A . n A 1 69 LYS 69 392 392 LYS LYS A . n A 1 70 PHE 70 393 393 PHE PHE A . n A 1 71 ASN 71 394 394 ASN ASN A . n A 1 72 PHE 72 395 395 PHE PHE A . n A 1 73 THR 73 396 396 THR THR A . n A 1 74 LYS 74 397 397 LYS LYS A . n A 1 75 GLN 75 398 398 GLN GLN A . n A 1 76 ASP 76 399 399 ASP ASP A . n A 1 77 VAL 77 400 400 VAL VAL A . n A 1 78 ALA 78 401 401 ALA ALA A . n A 1 79 GLU 79 402 402 GLU GLU A . n A 1 80 MET 80 403 403 MET MET A . n A 1 81 GLU 81 404 404 GLU GLU A . n A 1 82 LYS 82 405 405 LYS LYS A . n A 1 83 MET 83 406 406 MET MET A . n A 1 84 LYS 84 407 407 LYS LYS A . n A 1 85 ASN 85 408 408 ASN ASN A . n A 1 86 ASN 86 409 409 ASN ASN A . n A 1 87 ARG 87 410 410 ARG ARG A . n A 1 88 TYR 88 411 411 TYR TYR A . n A 1 89 CYS 89 412 412 CYS CYS A . n A 1 90 ASN 90 413 413 ASN ASN A . n A 1 91 LEU 91 414 414 LEU LEU A . n A 1 92 TYR 92 415 415 TYR TYR A . n A 1 93 ASP 93 416 416 ASP ASP A . n A 1 94 VAL 94 417 417 VAL VAL A . n A 1 95 GLU 95 418 418 GLU GLU A . n A 1 96 TYR 96 419 419 TYR TYR A . n A 1 97 LEU 97 420 420 LEU LEU A . n A 1 98 LEU 98 421 421 LEU LEU A . n A 1 99 SER 99 422 422 SER SER A . n A 1 100 LYS 100 423 423 LYS LYS A . n A 1 101 ASP 101 424 424 ASP ASP A . n A 1 102 GLY 102 425 425 GLY GLY A . n A 1 103 ALA 103 426 426 ALA ALA A . n A 1 104 ASN 104 427 427 ASN ASN A . n A 1 105 TYR 105 428 428 TYR TYR A . n A 1 106 LYS 106 429 429 LYS LYS A . n A 1 107 VAL 107 430 430 VAL VAL A . n A 1 108 LEU 108 431 431 LEU LEU A . n A 1 109 GLU 109 432 432 GLU GLU A . n A 1 110 TYR 110 433 433 TYR TYR A . n A 1 111 PHE 111 434 434 PHE PHE A . n A 1 112 ILE 112 435 435 ILE ILE A . n A 1 113 ASN 113 436 436 ASN ASN A . n A 1 114 ASN 114 437 437 ASN ASN A . n A 1 115 GLY 115 438 438 GLY GLY A . n A 1 116 LEU 116 439 439 LEU LEU A . n A 1 117 VAL 117 440 440 VAL VAL A . n A 1 118 ASP 118 441 441 ASP ASP A . n A 1 119 VAL 119 442 442 VAL VAL A . n A 1 120 ASN 120 443 443 ASN ASN A . n A 1 121 LYS 121 444 444 LYS LYS A . n A 1 122 LYS 122 445 445 LYS LYS A . n A 1 123 PHE 123 446 446 PHE PHE A . n A 1 124 GLN 124 447 447 GLN GLN A . n A 1 125 LYS 125 448 448 LYS LYS A . n A 1 126 VAL 126 449 449 VAL VAL A . n A 1 127 ASN 127 450 450 ASN ASN A . n A 1 128 SER 128 451 451 SER SER A . n A 1 129 GLY 129 452 452 GLY GLY A . n A 1 130 ASP 130 453 453 ASP ASP A . n A 1 131 THR 131 454 454 THR THR A . n A 1 132 MET 132 455 455 MET MET A . n A 1 133 LEU 133 456 456 LEU LEU A . n A 1 134 ASP 134 457 457 ASP ASP A . n A 1 135 ASN 135 458 458 ASN ASN A . n A 1 136 ALA 136 459 459 ALA ALA A . n A 1 137 MET 137 460 460 MET MET A . n A 1 138 LYS 138 461 461 LYS LYS A . n A 1 139 SER 139 462 462 SER SER A . n A 1 140 LYS 140 463 463 LYS LYS A . n A 1 141 ASP 141 464 464 ASP ASP A . n A 1 142 SER 142 465 465 SER SER A . n A 1 143 LYS 143 466 466 LYS LYS A . n A 1 144 MET 144 467 467 MET MET A . n A 1 145 ILE 145 468 468 ILE ILE A . n A 1 146 ASP 146 469 469 ASP ASP A . n A 1 147 PHE 147 470 470 PHE PHE A . n A 1 148 LEU 148 471 471 LEU LEU A . n A 1 149 LEU 149 472 472 LEU LEU A . n A 1 150 LYS 150 473 473 LYS LYS A . n A 1 151 ASN 151 474 474 ASN ASN A . n A 1 152 GLY 152 475 475 GLY GLY A . n A 1 153 ALA 153 476 476 ALA ALA A . n A 1 154 ILE 154 477 477 ILE ILE A . n A 1 155 LEU 155 478 478 LEU LEU A . n A 1 156 GLY 156 479 479 GLY GLY A . n A 1 157 LYS 157 480 480 LYS LYS A . n A 1 158 ARG 158 481 481 ARG ARG A . n A 1 159 PHE 159 482 ? ? ? A . n A 1 160 GLU 160 483 ? ? ? A . n A 1 161 ILE 161 484 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email jding@ibp.ac.cn _pdbx_contact_author.name_first Jingjin _pdbx_contact_author.name_last Ding _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9941-7997 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 501 145 HOH HOH A . B 2 HOH 2 502 159 HOH HOH A . B 2 HOH 3 503 146 HOH HOH A . B 2 HOH 4 504 36 HOH HOH A . B 2 HOH 5 505 100 HOH HOH A . B 2 HOH 6 506 158 HOH HOH A . B 2 HOH 7 507 176 HOH HOH A . B 2 HOH 8 508 122 HOH HOH A . B 2 HOH 9 509 139 HOH HOH A . B 2 HOH 10 510 54 HOH HOH A . B 2 HOH 11 511 94 HOH HOH A . B 2 HOH 12 512 59 HOH HOH A . B 2 HOH 13 513 51 HOH HOH A . B 2 HOH 14 514 30 HOH HOH A . B 2 HOH 15 515 89 HOH HOH A . B 2 HOH 16 516 150 HOH HOH A . B 2 HOH 17 517 123 HOH HOH A . B 2 HOH 18 518 84 HOH HOH A . B 2 HOH 19 519 73 HOH HOH A . B 2 HOH 20 520 74 HOH HOH A . B 2 HOH 21 521 7 HOH HOH A . B 2 HOH 22 522 64 HOH HOH A . B 2 HOH 23 523 63 HOH HOH A . B 2 HOH 24 524 69 HOH HOH A . B 2 HOH 25 525 148 HOH HOH A . B 2 HOH 26 526 115 HOH HOH A . B 2 HOH 27 527 22 HOH HOH A . B 2 HOH 28 528 88 HOH HOH A . B 2 HOH 29 529 149 HOH HOH A . B 2 HOH 30 530 60 HOH HOH A . B 2 HOH 31 531 108 HOH HOH A . B 2 HOH 32 532 16 HOH HOH A . B 2 HOH 33 533 97 HOH HOH A . B 2 HOH 34 534 1 HOH HOH A . B 2 HOH 35 535 34 HOH HOH A . B 2 HOH 36 536 33 HOH HOH A . B 2 HOH 37 537 18 HOH HOH A . B 2 HOH 38 538 92 HOH HOH A . B 2 HOH 39 539 130 HOH HOH A . B 2 HOH 40 540 44 HOH HOH A . B 2 HOH 41 541 76 HOH HOH A . B 2 HOH 42 542 107 HOH HOH A . B 2 HOH 43 543 77 HOH HOH A . B 2 HOH 44 544 40 HOH HOH A . B 2 HOH 45 545 165 HOH HOH A . B 2 HOH 46 546 106 HOH HOH A . B 2 HOH 47 547 105 HOH HOH A . B 2 HOH 48 548 9 HOH HOH A . B 2 HOH 49 549 111 HOH HOH A . B 2 HOH 50 550 37 HOH HOH A . B 2 HOH 51 551 48 HOH HOH A . B 2 HOH 52 552 49 HOH HOH A . B 2 HOH 53 553 58 HOH HOH A . B 2 HOH 54 554 10 HOH HOH A . B 2 HOH 55 555 50 HOH HOH A . B 2 HOH 56 556 3 HOH HOH A . B 2 HOH 57 557 28 HOH HOH A . B 2 HOH 58 558 71 HOH HOH A . B 2 HOH 59 559 66 HOH HOH A . B 2 HOH 60 560 8 HOH HOH A . B 2 HOH 61 561 109 HOH HOH A . B 2 HOH 62 562 141 HOH HOH A . B 2 HOH 63 563 29 HOH HOH A . B 2 HOH 64 564 6 HOH HOH A . B 2 HOH 65 565 83 HOH HOH A . B 2 HOH 66 566 20 HOH HOH A . B 2 HOH 67 567 135 HOH HOH A . B 2 HOH 68 568 124 HOH HOH A . B 2 HOH 69 569 80 HOH HOH A . B 2 HOH 70 570 113 HOH HOH A . B 2 HOH 71 571 2 HOH HOH A . B 2 HOH 72 572 78 HOH HOH A . B 2 HOH 73 573 134 HOH HOH A . B 2 HOH 74 574 5 HOH HOH A . B 2 HOH 75 575 138 HOH HOH A . B 2 HOH 76 576 15 HOH HOH A . B 2 HOH 77 577 147 HOH HOH A . B 2 HOH 78 578 56 HOH HOH A . B 2 HOH 79 579 38 HOH HOH A . B 2 HOH 80 580 43 HOH HOH A . B 2 HOH 81 581 129 HOH HOH A . B 2 HOH 82 582 25 HOH HOH A . B 2 HOH 83 583 12 HOH HOH A . B 2 HOH 84 584 32 HOH HOH A . B 2 HOH 85 585 96 HOH HOH A . B 2 HOH 86 586 120 HOH HOH A . B 2 HOH 87 587 31 HOH HOH A . B 2 HOH 88 588 172 HOH HOH A . B 2 HOH 89 589 19 HOH HOH A . B 2 HOH 90 590 24 HOH HOH A . B 2 HOH 91 591 85 HOH HOH A . B 2 HOH 92 592 47 HOH HOH A . B 2 HOH 93 593 41 HOH HOH A . B 2 HOH 94 594 67 HOH HOH A . B 2 HOH 95 595 61 HOH HOH A . B 2 HOH 96 596 153 HOH HOH A . B 2 HOH 97 597 62 HOH HOH A . B 2 HOH 98 598 27 HOH HOH A . B 2 HOH 99 599 21 HOH HOH A . B 2 HOH 100 600 136 HOH HOH A . B 2 HOH 101 601 14 HOH HOH A . B 2 HOH 102 602 4 HOH HOH A . B 2 HOH 103 603 90 HOH HOH A . B 2 HOH 104 604 174 HOH HOH A . B 2 HOH 105 605 53 HOH HOH A . B 2 HOH 106 606 95 HOH HOH A . B 2 HOH 107 607 55 HOH HOH A . B 2 HOH 108 608 65 HOH HOH A . B 2 HOH 109 609 17 HOH HOH A . B 2 HOH 110 610 57 HOH HOH A . B 2 HOH 111 611 144 HOH HOH A . B 2 HOH 112 612 70 HOH HOH A . B 2 HOH 113 613 98 HOH HOH A . B 2 HOH 114 614 26 HOH HOH A . B 2 HOH 115 615 23 HOH HOH A . B 2 HOH 116 616 125 HOH HOH A . B 2 HOH 117 617 11 HOH HOH A . B 2 HOH 118 618 13 HOH HOH A . B 2 HOH 119 619 104 HOH HOH A . B 2 HOH 120 620 46 HOH HOH A . B 2 HOH 121 621 161 HOH HOH A . B 2 HOH 122 622 93 HOH HOH A . B 2 HOH 123 623 103 HOH HOH A . B 2 HOH 124 624 164 HOH HOH A . B 2 HOH 125 625 35 HOH HOH A . B 2 HOH 126 626 39 HOH HOH A . B 2 HOH 127 627 133 HOH HOH A . B 2 HOH 128 628 175 HOH HOH A . B 2 HOH 129 629 99 HOH HOH A . B 2 HOH 130 630 140 HOH HOH A . B 2 HOH 131 631 101 HOH HOH A . B 2 HOH 132 632 166 HOH HOH A . B 2 HOH 133 633 163 HOH HOH A . B 2 HOH 134 634 79 HOH HOH A . B 2 HOH 135 635 155 HOH HOH A . B 2 HOH 136 636 173 HOH HOH A . B 2 HOH 137 637 81 HOH HOH A . B 2 HOH 138 638 121 HOH HOH A . B 2 HOH 139 639 162 HOH HOH A . B 2 HOH 140 640 102 HOH HOH A . B 2 HOH 141 641 112 HOH HOH A . B 2 HOH 142 642 151 HOH HOH A . B 2 HOH 143 643 68 HOH HOH A . B 2 HOH 144 644 127 HOH HOH A . B 2 HOH 145 645 110 HOH HOH A . B 2 HOH 146 646 45 HOH HOH A . B 2 HOH 147 647 91 HOH HOH A . B 2 HOH 148 648 72 HOH HOH A . B 2 HOH 149 649 154 HOH HOH A . B 2 HOH 150 650 86 HOH HOH A . B 2 HOH 151 651 142 HOH HOH A . B 2 HOH 152 652 137 HOH HOH A . B 2 HOH 153 653 126 HOH HOH A . B 2 HOH 154 654 82 HOH HOH A . B 2 HOH 155 655 131 HOH HOH A . B 2 HOH 156 656 42 HOH HOH A . B 2 HOH 157 657 128 HOH HOH A . B 2 HOH 158 658 132 HOH HOH A . B 2 HOH 159 659 143 HOH HOH A . B 2 HOH 160 660 160 HOH HOH A . B 2 HOH 161 661 114 HOH HOH A . B 2 HOH 162 662 87 HOH HOH A . B 2 HOH 163 663 119 HOH HOH A . B 2 HOH 164 664 167 HOH HOH A . B 2 HOH 165 665 117 HOH HOH A . B 2 HOH 166 666 156 HOH HOH A . B 2 HOH 167 667 75 HOH HOH A . B 2 HOH 168 668 168 HOH HOH A . B 2 HOH 169 669 52 HOH HOH A . B 2 HOH 170 670 118 HOH HOH A . B 2 HOH 171 671 169 HOH HOH A . B 2 HOH 172 672 157 HOH HOH A . B 2 HOH 173 673 171 HOH HOH A . B 2 HOH 174 674 116 HOH HOH A . B 2 HOH 175 675 152 HOH HOH A . B 2 HOH 176 676 170 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7120 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-25 2 'Structure model' 1 1 2023-02-01 3 'Structure model' 1 2 2023-03-29 4 'Structure model' 1 3 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 350 ? ? O A HOH 501 ? ? 1.82 2 1 O A HOH 621 ? ? O A HOH 633 ? ? 1.86 3 1 O A HOH 624 ? ? O A HOH 673 ? ? 1.93 4 1 NZ A LYS 473 ? ? O A HOH 502 ? ? 2.05 5 1 O A HOH 621 ? ? O A HOH 664 ? ? 2.06 6 1 O A HOH 506 ? ? O A HOH 649 ? ? 2.07 7 1 N A ILE 346 ? ? O A HOH 503 ? ? 2.08 8 1 O A HOH 586 ? ? O A HOH 652 ? ? 2.13 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 636 ? ? 1_555 O A HOH 664 ? ? 3_444 2.14 2 1 O A HOH 613 ? ? 1_555 O A HOH 638 ? ? 2_455 2.15 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 382 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -104.04 _pdbx_validate_torsion.psi 74.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 324 ? A GLY 1 2 1 Y 1 A PRO 325 ? A PRO 2 3 1 Y 1 A LEU 326 ? A LEU 3 4 1 Y 1 A GLY 327 ? A GLY 4 5 1 Y 1 A SER 328 ? A SER 5 6 1 Y 1 A GLY 329 ? A GLY 6 7 1 Y 1 A ARG 330 ? A ARG 7 8 1 Y 1 A PRO 331 ? A PRO 8 9 1 Y 1 A MET 332 ? A MET 9 10 1 Y 1 A LEU 333 ? A LEU 10 11 1 Y 1 A SER 334 ? A SER 11 12 1 Y 1 A THR 335 ? A THR 12 13 1 Y 1 A ASP 336 ? A ASP 13 14 1 Y 1 A ASN 337 ? A ASN 14 15 1 Y 1 A PHE 338 ? A PHE 15 16 1 Y 1 A LYS 339 ? A LYS 16 17 1 Y 1 A LYS 340 ? A LYS 17 18 1 Y 1 A ILE 341 ? A ILE 18 19 1 Y 1 A LYS 342 ? A LYS 19 20 1 Y 1 A LEU 343 ? A LEU 20 21 1 Y 1 A ARG 344 ? A ARG 21 22 1 Y 1 A ASP 345 ? A ASP 22 23 1 Y 1 A PHE 482 ? A PHE 159 24 1 Y 1 A GLU 483 ? A GLU 160 25 1 Y 1 A ILE 484 ? A ILE 161 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_audit_support.funding_organization 'Chinese Academy of Sciences' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7WR1 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 #