data_7X89 # _entry.id 7X89 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7X89 pdb_00007x89 10.2210/pdb7x89/pdb WWPDB D_1300027321 ? ? BMRB 36474 ? 10.13018/BMR36474 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-22 2 'Structure model' 1 1 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7X89 _pdbx_database_status.recvd_initial_deposition_date 2022-03-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details Tid1 _pdbx_database_related.db_id 36474 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email nmrjhkim@chungbuk.ac.kr _pdbx_contact_author.name_first Ji-Hun _pdbx_contact_author.name_last Kim _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6732-9498 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jang, J.' 1 ? 'Lee, S.H.' 2 ? 'Kang, D.H.' 3 ? 'Sim, D.W.' 4 ? 'Jo, K.S.' 5 ? 'Ryu, H.' 6 ? 'Kim, E.H.' 7 ? 'Ryu, K.S.' 8 ? 'Lee, J.H.' 9 ? 'Kim, J.H.' 10 ? 'Won, H.S.' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural studies on the J-domain and GF-motif of the mitochondrial Hsp40, Tid1' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jang, J.' 1 ? primary 'Lee, S.H.' 2 ? primary 'Kang, D.H.' 3 ? primary 'Kim, J.H.' 4 ? primary 'Sim, D.W.' 5 ? primary 'Jo, K.S.' 6 ? primary 'Won, H.S.' 7 ? primary 'Ryu, K.S.' 8 ? primary 'Kim, E.H.' 9 ? primary 'Ryu, H.' 10 ? primary 'Lee, J.H.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DnaJ homolog subfamily A member 3, mitochondrial' _entity.formula_weight 8589.653 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DnaJ protein Tid-1,hTid-1,Hepatocellular carcinoma-associated antigen 57,Tumorous imaginal discs protein Tid56 homolog' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code HMLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGS _entity_poly.pdbx_seq_one_letter_code_can HMLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 LEU n 1 4 ALA n 1 5 LYS n 1 6 GLU n 1 7 ASP n 1 8 TYR n 1 9 TYR n 1 10 GLN n 1 11 ILE n 1 12 LEU n 1 13 GLY n 1 14 VAL n 1 15 PRO n 1 16 ARG n 1 17 ASN n 1 18 ALA n 1 19 SER n 1 20 GLN n 1 21 LYS n 1 22 GLU n 1 23 ILE n 1 24 LYS n 1 25 LYS n 1 26 ALA n 1 27 TYR n 1 28 TYR n 1 29 GLN n 1 30 LEU n 1 31 ALA n 1 32 LYS n 1 33 LYS n 1 34 TYR n 1 35 HIS n 1 36 PRO n 1 37 ASP n 1 38 THR n 1 39 ASN n 1 40 LYS n 1 41 ASP n 1 42 ASP n 1 43 PRO n 1 44 LYS n 1 45 ALA n 1 46 LYS n 1 47 GLU n 1 48 LYS n 1 49 PHE n 1 50 SER n 1 51 GLN n 1 52 LEU n 1 53 ALA n 1 54 GLU n 1 55 ALA n 1 56 TYR n 1 57 GLU n 1 58 VAL n 1 59 LEU n 1 60 SER n 1 61 ASP n 1 62 GLU n 1 63 VAL n 1 64 LYS n 1 65 ARG n 1 66 LYS n 1 67 GLN n 1 68 TYR n 1 69 ASP n 1 70 ALA n 1 71 TYR n 1 72 GLY n 1 73 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 73 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DNAJA3, HCA57, TID1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 1 HIS HIS A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 SER 73 73 73 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7X89 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7X89 _struct.title Tid1 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7X89 _struct_keywords.text 'Heat shock protein, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNJA3_HUMAN _struct_ref.pdbx_db_accession Q96EY1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGS _struct_ref.pdbx_align_begin 89 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7X89 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96EY1 _struct_ref_seq.db_align_beg 89 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 159 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7X89 HIS A 1 ? UNP Q96EY1 ? ? 'expression tag' 1 1 1 7X89 MET A 2 ? UNP Q96EY1 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 7 ? GLY A 13 ? ASP A 7 GLY A 13 1 ? 7 HELX_P HELX_P2 AA2 SER A 19 ? HIS A 35 ? SER A 19 HIS A 35 1 ? 17 HELX_P HELX_P3 AA3 ASP A 37 ? ASP A 41 ? ASP A 37 ASP A 41 5 ? 5 HELX_P HELX_P4 AA4 LYS A 44 ? SER A 60 ? LYS A 44 SER A 60 1 ? 17 HELX_P HELX_P5 AA5 ASP A 61 ? GLY A 72 ? ASP A 61 GLY A 72 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 1 18.78 2 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 2 20.31 3 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 3 18.11 4 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 4 22.35 5 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 5 19.00 6 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 6 21.50 7 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 7 22.01 8 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 8 20.54 9 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 9 19.18 10 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 10 21.13 11 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 11 14.39 12 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 12 23.76 13 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 13 18.78 14 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 14 16.00 15 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 15 24.21 16 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 16 17.84 17 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 17 16.45 18 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 18 19.97 19 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 19 20.92 20 PRO 36 A . ? PRO 36 A ASP 37 A ? ASP 37 A 20 18.50 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 95.78 110.60 -14.82 1.80 N 2 1 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.12 110.60 -13.48 1.80 N 3 1 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.01 110.60 -14.59 1.80 N 4 1 CA A LEU 52 ? ? CB A LEU 52 ? ? CG A LEU 52 ? ? 129.39 115.30 14.09 2.30 N 5 1 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.48 110.60 -16.12 1.80 N 6 2 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.13 110.60 -14.47 1.80 N 7 2 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.45 110.60 -13.15 1.80 N 8 2 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.07 110.60 -14.53 1.80 N 9 2 CA A LEU 52 ? ? CB A LEU 52 ? ? CG A LEU 52 ? ? 129.31 115.30 14.01 2.30 N 10 2 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.63 110.60 -15.97 1.80 N 11 3 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 95.59 110.60 -15.01 1.80 N 12 3 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 98.23 110.60 -12.37 1.80 N 13 3 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.35 110.60 -14.25 1.80 N 14 3 CA A LEU 52 ? ? CB A LEU 52 ? ? CG A LEU 52 ? ? 129.68 115.30 14.38 2.30 N 15 3 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.92 110.60 -15.68 1.80 N 16 4 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.23 110.60 -14.37 1.80 N 17 4 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.25 110.60 -13.35 1.80 N 18 4 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.67 110.60 -15.93 1.80 N 19 5 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.43 110.60 -14.17 1.80 N 20 5 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 98.56 110.60 -12.04 1.80 N 21 5 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.67 110.60 -13.93 1.80 N 22 5 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.92 110.60 -15.68 1.80 N 23 6 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 95.78 110.60 -14.82 1.80 N 24 6 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.89 110.60 -12.71 1.80 N 25 6 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.22 110.60 -14.38 1.80 N 26 6 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.33 110.60 -16.27 1.80 N 27 7 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 95.83 110.60 -14.77 1.80 N 28 7 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.12 110.60 -13.48 1.80 N 29 7 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.59 110.60 -14.01 1.80 N 30 7 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.04 110.60 -16.56 1.80 N 31 8 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 95.59 110.60 -15.01 1.80 N 32 8 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.33 110.60 -13.27 1.80 N 33 8 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.82 110.60 -13.78 1.80 N 34 8 CA A LEU 52 ? ? CB A LEU 52 ? ? CG A LEU 52 ? ? 129.46 115.30 14.16 2.30 N 35 8 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.75 110.60 -15.85 1.80 N 36 8 CB A TYR 71 ? ? CG A TYR 71 ? ? CD2 A TYR 71 ? ? 117.34 121.00 -3.66 0.60 N 37 9 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.21 110.60 -14.39 1.80 N 38 9 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 96.89 110.60 -13.71 1.80 N 39 9 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.58 110.60 -14.02 1.80 N 40 9 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.69 110.60 -15.91 1.80 N 41 10 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.08 110.60 -14.52 1.80 N 42 10 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 96.82 110.60 -13.78 1.80 N 43 10 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.74 110.60 -13.86 1.80 N 44 10 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.82 110.60 -15.78 1.80 N 45 11 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 95.61 110.60 -14.99 1.80 N 46 11 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 94.31 110.60 -16.29 1.80 N 47 11 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.08 110.60 -14.52 1.80 N 48 11 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.68 110.60 -15.92 1.80 N 49 12 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.67 110.60 -13.93 1.80 N 50 12 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.33 110.60 -13.27 1.80 N 51 12 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 97.33 110.60 -13.27 1.80 N 52 12 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.57 110.60 -16.03 1.80 N 53 13 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.01 110.60 -14.59 1.80 N 54 13 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.84 110.60 -12.76 1.80 N 55 13 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.46 110.60 -14.14 1.80 N 56 13 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.86 110.60 -15.74 1.80 N 57 14 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.16 110.60 -14.44 1.80 N 58 14 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.06 110.60 -13.54 1.80 N 59 14 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.63 110.60 -13.97 1.80 N 60 14 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.74 110.60 -15.86 1.80 N 61 15 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 95.48 110.60 -15.12 1.80 N 62 15 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 96.99 110.60 -13.61 1.80 N 63 15 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.35 110.60 -14.25 1.80 N 64 15 CA A LEU 52 ? ? CB A LEU 52 ? ? CG A LEU 52 ? ? 129.53 115.30 14.23 2.30 N 65 15 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.68 110.60 -15.92 1.80 N 66 16 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.96 110.60 -13.64 1.80 N 67 16 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 98.36 110.60 -12.24 1.80 N 68 16 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.31 110.60 -14.29 1.80 N 69 16 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.86 110.60 -15.74 1.80 N 70 17 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.36 110.60 -14.24 1.80 N 71 17 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.90 110.60 -12.70 1.80 N 72 17 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.46 110.60 -14.14 1.80 N 73 17 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.41 110.60 -16.19 1.80 N 74 17 CB A TYR 71 ? ? CG A TYR 71 ? ? CD2 A TYR 71 ? ? 116.86 121.00 -4.14 0.60 N 75 18 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.20 110.60 -14.40 1.80 N 76 18 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 98.38 110.60 -12.22 1.80 N 77 18 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.27 110.60 -14.33 1.80 N 78 18 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.29 110.60 -16.31 1.80 N 79 19 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 95.84 110.60 -14.76 1.80 N 80 19 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 97.18 110.60 -13.42 1.80 N 81 19 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.72 110.60 -13.88 1.80 N 82 19 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.79 110.60 -15.81 1.80 N 83 20 N A LYS 25 ? ? CA A LYS 25 ? ? CB A LYS 25 ? ? 96.21 110.60 -14.39 1.80 N 84 20 N A TYR 34 ? ? CA A TYR 34 ? ? CB A TYR 34 ? ? 98.19 110.60 -12.41 1.80 N 85 20 N A LYS 48 ? ? CA A LYS 48 ? ? CB A LYS 48 ? ? 96.77 110.60 -13.83 1.80 N 86 20 N A LYS 66 ? ? CA A LYS 66 ? ? CB A LYS 66 ? ? 94.71 110.60 -15.89 1.80 N # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 THR A 38 ? ? ASN A 39 ? ? -138.44 2 2 THR A 38 ? ? ASN A 39 ? ? -135.02 3 3 THR A 38 ? ? ASN A 39 ? ? -139.30 4 4 THR A 38 ? ? ASN A 39 ? ? -133.04 5 5 THR A 38 ? ? ASN A 39 ? ? -141.80 6 6 THR A 38 ? ? ASN A 39 ? ? -131.37 7 7 THR A 38 ? ? ASN A 39 ? ? -138.15 8 8 THR A 38 ? ? ASN A 39 ? ? -135.82 9 9 THR A 38 ? ? ASN A 39 ? ? -140.13 10 10 THR A 38 ? ? ASN A 39 ? ? -134.43 11 11 THR A 38 ? ? ASN A 39 ? ? -142.01 12 12 THR A 38 ? ? ASN A 39 ? ? -133.60 13 13 THR A 38 ? ? ASN A 39 ? ? -140.41 14 14 THR A 38 ? ? ASN A 39 ? ? -135.03 15 15 THR A 38 ? ? ASN A 39 ? ? -133.60 16 16 THR A 38 ? ? ASN A 39 ? ? -142.58 17 17 THR A 38 ? ? ASN A 39 ? ? -137.52 18 17 ALA A 70 ? ? TYR A 71 ? ? -148.09 19 18 THR A 38 ? ? ASN A 39 ? ? -142.28 20 19 THR A 38 ? ? ASN A 39 ? ? -137.39 21 20 THR A 38 ? ? ASN A 39 ? ? -136.93 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 28 ? ? 0.076 'SIDE CHAIN' 2 2 TYR A 28 ? ? 0.065 'SIDE CHAIN' 3 2 ARG A 65 ? ? 0.094 'SIDE CHAIN' 4 7 TYR A 56 ? ? 0.065 'SIDE CHAIN' 5 10 ARG A 65 ? ? 0.098 'SIDE CHAIN' 6 11 TYR A 28 ? ? 0.066 'SIDE CHAIN' 7 13 TYR A 56 ? ? 0.088 'SIDE CHAIN' 8 14 TYR A 28 ? ? 0.063 'SIDE CHAIN' 9 15 TYR A 28 ? ? 0.068 'SIDE CHAIN' 10 20 TYR A 56 ? ? 0.067 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 7X89 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7X89 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 2 _pdbx_nmr_sample_details.contents ;200 uM [U-13C; U-15N] DnaJ homolog subfamily A member 3, mitochondrial, 200 uM [U-15N] DnaJ homolog subfamily A member 3, mitochondrial, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label Tid1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 2 _pdbx_nmr_exptl_sample.component 'DnaJ homolog subfamily A member 3, mitochondrial' _pdbx_nmr_exptl_sample.concentration 200 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '3D 1H-15N NOESY' 1 isotropic 2 1 2 '3D 1H-13C NOESY' 1 isotropic 3 1 2 '3D HCCH-TOCSY' 2 isotropic 4 1 2 '3D CCH-TOCSY' 2 isotropic 5 1 2 '3D HNCACB' 1 isotropic 6 1 2 '3D HNCACO' 1 isotropic 7 1 2 '3D CBCA(CO)NH' 1 isotropic 8 1 2 '3D HNCO' 1 isotropic # _pdbx_nmr_refine.entry_id 7X89 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details '1365 NOE distances were used and 62 dihedral angles were used' _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 refinement CHARMM ? 'B. R. Brooks' 2 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 3 'peak picking' NMRView ? 'Johnson, One Moon Scientific' 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 800 ? 2 AVANCE ? Bruker 900 ? # _atom_sites.entry_id 7X89 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #