data_7XFG # _entry.id 7XFG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XFG pdb_00007xfg 10.2210/pdb7xfg/pdb WWPDB D_1300028721 ? ? BMRB 36481 ? 10.13018/BMR36481 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-04-12 2 'Structure model' 1 1 2024-05-15 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 3 'Structure model' pdbx_entry_details # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' 13 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7XFG _pdbx_database_status.recvd_initial_deposition_date 2022-04-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '7XEZ contains the same protein domain' 7XEZ unspecified BMRB 'NMR solution structures of p300 TAZ2 domain in complex with BRD4-NUT F1c domain binding motif #1' 36481 unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 leizeng@jlu.edu.cn Lei Zeng ? 'principal investigator/group leader' 0000-0002-4236-6735 3 ming-ming.zhou@mssm.edu Ming-Ming Zhou ? 'principal investigator/group leader' 0000-0002-7049-0573 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yu, D.' 1 ? 'Zeng, L.' 2 ? 'Zhou, M.-M.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 378 _citation.page_last 378 _citation.title ;Structural mechanism of BRD4-NUT and p300 bipartite interaction in propagating aberrant gene transcription in chromatin in NUT carcinoma. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-36063-5 _citation.pdbx_database_id_PubMed 36690674 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, D.' 1 0000-0001-9947-0624 primary 'Liang, Y.' 2 ? primary 'Kim, C.' 3 ? primary 'Jaganathan, A.' 4 ? primary 'Ji, D.' 5 0000-0002-8192-2730 primary 'Han, X.' 6 ? primary 'Yang, X.' 7 ? primary 'Jia, Y.' 8 ? primary 'Gu, R.' 9 ? primary 'Wang, C.' 10 ? primary 'Zhang, Q.' 11 ? primary 'Cheung, K.L.' 12 ? primary 'Zhou, M.M.' 13 0000-0002-7049-0573 primary 'Zeng, L.' 14 0000-0002-4236-6735 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone acetyltransferase p300' 11081.926 1 2.3.1.48,2.3.1.- 'C1738A, C1746A, C1789A, C1790A' 'TAZ2 domain' ? 2 polymer syn 'NUT family member 1' 1785.048 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;p300 HAT,E1A-associated protein p300,Histone butyryltransferase p300,Histone crotonyltransferase p300,Protein 2-hydroxyisobutyryltransferase p300,Protein lactyltransferas p300,Protein propionyltransferase p300 ; 2 'Nuclear protein in testis' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SGGRATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQE NKCPVPFCLNIKQKGSEFPAGN ; ;SGGRATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQE NKCPVPFCLNIKQKGSEFPAGN ; A ? 2 'polypeptide(L)' no no GMYPDPGLLSYINELC GMYPDPGLLSYINELC B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 GLY n 1 4 ARG n 1 5 ALA n 1 6 THR n 1 7 GLN n 1 8 SER n 1 9 PRO n 1 10 GLY n 1 11 ASP n 1 12 SER n 1 13 ARG n 1 14 ARG n 1 15 LEU n 1 16 SER n 1 17 ILE n 1 18 GLN n 1 19 ARG n 1 20 ALA n 1 21 ILE n 1 22 GLN n 1 23 SER n 1 24 LEU n 1 25 VAL n 1 26 HIS n 1 27 ALA n 1 28 ALA n 1 29 GLN n 1 30 CYS n 1 31 ARG n 1 32 ASN n 1 33 ALA n 1 34 ASN n 1 35 CYS n 1 36 SER n 1 37 LEU n 1 38 PRO n 1 39 SER n 1 40 CYS n 1 41 GLN n 1 42 LYS n 1 43 MET n 1 44 LYS n 1 45 ARG n 1 46 VAL n 1 47 VAL n 1 48 GLN n 1 49 HIS n 1 50 THR n 1 51 LYS n 1 52 GLY n 1 53 CYS n 1 54 LYS n 1 55 ARG n 1 56 LYS n 1 57 THR n 1 58 ASN n 1 59 GLY n 1 60 GLY n 1 61 CYS n 1 62 PRO n 1 63 ILE n 1 64 CYS n 1 65 LYS n 1 66 GLN n 1 67 LEU n 1 68 ILE n 1 69 ALA n 1 70 LEU n 1 71 ALA n 1 72 ALA n 1 73 TYR n 1 74 HIS n 1 75 ALA n 1 76 LYS n 1 77 HIS n 1 78 CYS n 1 79 GLN n 1 80 GLU n 1 81 ASN n 1 82 LYS n 1 83 CYS n 1 84 PRO n 1 85 VAL n 1 86 PRO n 1 87 PHE n 1 88 CYS n 1 89 LEU n 1 90 ASN n 1 91 ILE n 1 92 LYS n 1 93 GLN n 1 94 LYS n 1 95 GLY n 1 96 SER n 1 97 GLU n 1 98 PHE n 1 99 PRO n 1 100 ALA n 1 101 GLY n 1 102 ASN n 2 1 GLY n 2 2 MET n 2 3 TYR n 2 4 PRO n 2 5 ASP n 2 6 PRO n 2 7 GLY n 2 8 LEU n 2 9 LEU n 2 10 SER n 2 11 TYR n 2 12 ILE n 2 13 ASN n 2 14 GLU n 2 15 LEU n 2 16 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 102 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EP300, P300' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 16 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ASN 102 102 102 ASN ASN A . n B 2 1 GLY 1 201 201 GLY GLY B . n B 2 2 MET 2 202 202 MET MET B . n B 2 3 TYR 3 203 203 TYR TYR B . n B 2 4 PRO 4 204 204 PRO PRO B . n B 2 5 ASP 5 205 205 ASP ASP B . n B 2 6 PRO 6 206 206 PRO PRO B . n B 2 7 GLY 7 207 207 GLY GLY B . n B 2 8 LEU 8 208 208 LEU LEU B . n B 2 9 LEU 9 209 209 LEU LEU B . n B 2 10 SER 10 210 210 SER SER B . n B 2 11 TYR 11 211 211 TYR TYR B . n B 2 12 ILE 12 212 212 ILE ILE B . n B 2 13 ASN 13 213 213 ASN ASN B . n B 2 14 GLU 14 214 214 GLU GLU B . n B 2 15 LEU 15 215 215 LEU LEU B . n B 2 16 CYS 16 216 216 CYS CYS B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 501 501 ZN ZN A . D 3 ZN 1 502 601 ZN ZN A . E 3 ZN 1 503 701 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XFG _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7XFG _struct.title 'NMR solution structures of p300 TAZ2 domain in complex with BRD4-NUT F1c domain binding motif #1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XFG _struct_keywords.text 'BRD4-NUT fusion protein, CBP/p300, TAZ2 domain, F1c domain, NUT carcinoma, PEPTIDE BINDING PROTEIN, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP EP300_HUMAN Q09472 ? 1 ;ATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCP VPFCLNIKQK ; 1723 2 UNP NUTM1_HUMAN Q86Y26 ? 2 GMYPDPGLLSYINELC 403 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7XFG A 5 ? 94 ? Q09472 1723 ? 1812 ? 5 94 2 2 7XFG B 1 ? 16 ? Q86Y26 403 ? 418 ? 201 216 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XFG SER A 1 ? UNP Q09472 ? ? 'expression tag' 1 1 1 7XFG GLY A 2 ? UNP Q09472 ? ? 'expression tag' 2 2 1 7XFG GLY A 3 ? UNP Q09472 ? ? 'expression tag' 3 3 1 7XFG ARG A 4 ? UNP Q09472 ? ? 'expression tag' 4 4 1 7XFG ALA A 20 ? UNP Q09472 CYS 1738 'engineered mutation' 20 5 1 7XFG ALA A 28 ? UNP Q09472 CYS 1746 'engineered mutation' 28 6 1 7XFG ALA A 71 ? UNP Q09472 CYS 1789 'engineered mutation' 71 7 1 7XFG ALA A 72 ? UNP Q09472 CYS 1790 'engineered mutation' 72 8 1 7XFG GLY A 95 ? UNP Q09472 ? ? 'expression tag' 95 9 1 7XFG SER A 96 ? UNP Q09472 ? ? 'expression tag' 96 10 1 7XFG GLU A 97 ? UNP Q09472 ? ? 'expression tag' 97 11 1 7XFG PHE A 98 ? UNP Q09472 ? ? 'expression tag' 98 12 1 7XFG PRO A 99 ? UNP Q09472 ? ? 'expression tag' 99 13 1 7XFG ALA A 100 ? UNP Q09472 ? ? 'expression tag' 100 14 1 7XFG GLY A 101 ? UNP Q09472 ? ? 'expression tag' 101 15 1 7XFG ASN A 102 ? UNP Q09472 ? ? 'expression tag' 102 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1550 ? 1 MORE -9 ? 1 'SSA (A^2)' 7790 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 8 ? CYS A 30 ? SER A 8 CYS A 30 1 ? 23 HELX_P HELX_P2 AA2 LEU A 37 ? GLY A 52 ? LEU A 37 GLY A 52 1 ? 16 HELX_P HELX_P3 AA3 PRO A 62 ? HIS A 77 ? PRO A 62 HIS A 77 1 ? 16 HELX_P HELX_P4 AA4 VAL A 85 ? GLY A 95 ? VAL A 85 GLY A 95 1 ? 11 HELX_P HELX_P5 AA5 GLY B 7 ? ILE B 12 ? GLY B 207 ILE B 212 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 26 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 26 A ZN 502 1_555 ? ? ? ? ? ? ? 2.136 ? ? metalc2 metalc ? ? A CYS 30 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 30 A ZN 502 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc3 metalc ? ? A CYS 35 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 35 A ZN 502 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc4 metalc ? ? A CYS 40 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 40 A ZN 502 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc5 metalc ? ? A HIS 49 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 49 A ZN 501 1_555 ? ? ? ? ? ? ? 2.136 ? ? metalc6 metalc ? ? A CYS 53 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 53 A ZN 501 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc7 metalc ? ? A CYS 61 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 61 A ZN 501 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc8 metalc ? ? A CYS 64 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 64 A ZN 501 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc9 metalc ? ? A HIS 74 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 74 A ZN 503 1_555 ? ? ? ? ? ? ? 2.121 ? ? metalc10 metalc ? ? A CYS 78 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 78 A ZN 503 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc11 metalc ? ? A CYS 83 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 83 A ZN 503 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc12 metalc ? ? A CYS 88 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 88 A ZN 503 1_555 ? ? ? ? ? ? ? 2.352 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 30 ? A CYS 30 ? 1_555 107.7 ? 2 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 35 ? A CYS 35 ? 1_555 107.1 ? 3 SG ? A CYS 30 ? A CYS 30 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 35 ? A CYS 35 ? 1_555 114.7 ? 4 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 102.4 ? 5 SG ? A CYS 30 ? A CYS 30 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 112.4 ? 6 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? D ZN . ? A ZN 502 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 111.6 ? 7 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 108.2 ? 8 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 61 ? A CYS 61 ? 1_555 107.5 ? 9 SG ? A CYS 53 ? A CYS 53 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 61 ? A CYS 61 ? 1_555 116.7 ? 10 NE2 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 104.4 ? 11 SG ? A CYS 53 ? A CYS 53 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 108.2 ? 12 SG ? A CYS 61 ? A CYS 61 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 111.1 ? 13 NE2 ? A HIS 74 ? A HIS 74 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 78 ? A CYS 78 ? 1_555 108.3 ? 14 NE2 ? A HIS 74 ? A HIS 74 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 106.9 ? 15 SG ? A CYS 78 ? A CYS 78 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 113.9 ? 16 NE2 ? A HIS 74 ? A HIS 74 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 88 ? A CYS 88 ? 1_555 104.7 ? 17 SG ? A CYS 78 ? A CYS 78 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 88 ? A CYS 88 ? 1_555 111.5 ? 18 SG ? A CYS 83 ? A CYS 83 ? 1_555 ZN ? E ZN . ? A ZN 503 ? 1_555 SG ? A CYS 88 ? A CYS 88 ? 1_555 111.1 ? # _pdbx_entry_details.entry_id 7XFG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG21 A VAL 46 ? ? HD11 B LEU 208 ? ? 1.28 2 2 HB2 A GLN 66 ? ? HD22 B LEU 208 ? ? 1.32 3 3 HD3 A LYS 42 ? ? HG12 B ILE 212 ? ? 1.28 4 3 HB2 A GLN 66 ? ? HD22 B LEU 208 ? ? 1.28 5 3 HB A VAL 46 ? ? HD23 A LEU 67 ? ? 1.33 6 4 O A ALA 20 ? ? HG A SER 23 ? ? 1.59 7 5 HB2 A GLN 66 ? ? HD22 B LEU 208 ? ? 1.23 8 6 HB2 A GLN 66 ? ? HD22 B LEU 208 ? ? 1.26 9 7 HD3 A LYS 56 ? ? H A THR 57 ? ? 1.34 10 8 HB2 A GLN 66 ? ? HD22 B LEU 208 ? ? 1.21 11 10 O A ALA 20 ? ? HG A SER 23 ? ? 1.58 12 11 HA A LYS 92 ? ? HB2 A SER 96 ? ? 1.13 13 14 HB2 B PRO 206 ? ? HD21 B LEU 209 ? ? 1.32 14 14 HD3 A LYS 56 ? ? H A THR 57 ? ? 1.33 15 15 HG13 A VAL 47 ? ? HG3 A PRO 86 ? ? 1.29 16 15 HB2 B PRO 206 ? ? HD21 B LEU 209 ? ? 1.35 17 16 HG11 A VAL 47 ? ? HE3 A LYS 51 ? ? 1.24 18 16 HA A GLN 48 ? ? HD3 A LYS 51 ? ? 1.34 19 17 O A ALA 5 ? ? HG1 A THR 6 ? ? 1.60 20 18 HB2 A GLN 66 ? ? HD22 B LEU 208 ? ? 1.26 21 18 HG13 A VAL 47 ? ? HG3 A PRO 86 ? ? 1.31 22 18 HG11 A VAL 46 ? ? HD11 B LEU 208 ? ? 1.33 23 19 HG11 A VAL 46 ? ? HD11 B LEU 208 ? ? 1.21 24 19 OE1 B GLU 214 ? ? HG B CYS 216 ? ? 1.58 25 20 HB2 A ALA 28 ? ? HB2 A PRO 84 ? ? 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 56 ? ? -44.40 -70.06 2 1 ASN A 58 ? ? -82.30 33.28 3 1 GLU A 97 ? ? -78.85 -92.38 4 1 PHE A 98 ? ? 145.60 -45.04 5 1 MET B 202 ? ? 59.87 76.48 6 1 TYR B 203 ? ? 67.00 114.98 7 1 ILE B 212 ? ? -118.99 70.82 8 2 ASN A 58 ? ? -81.85 32.52 9 2 HIS A 77 ? ? -98.59 37.42 10 2 GLU A 97 ? ? -59.11 -70.01 11 2 ASP B 205 ? ? 55.69 87.45 12 3 LYS A 56 ? ? -41.90 -70.59 13 3 ASN A 58 ? ? -75.52 22.14 14 4 ALA A 5 ? ? 62.78 -161.31 15 4 LYS A 54 ? ? -131.49 -34.94 16 4 ASN A 58 ? ? -83.53 36.55 17 4 HIS A 77 ? ? -97.46 37.63 18 4 GLU A 97 ? ? -65.38 -80.60 19 4 ALA A 100 ? ? -145.79 55.07 20 4 TYR B 203 ? ? 68.28 114.67 21 4 PRO B 206 ? ? -64.81 74.96 22 4 ILE B 212 ? ? -114.49 60.66 23 4 GLU B 214 ? ? -52.43 106.38 24 5 CYS A 35 ? ? -59.07 102.12 25 5 LYS A 56 ? ? -39.50 -70.46 26 5 ASN A 58 ? ? -83.67 33.30 27 5 HIS A 77 ? ? -95.34 37.39 28 6 ALA A 5 ? ? 54.23 75.12 29 6 ASN A 58 ? ? -81.41 31.53 30 6 LYS A 82 ? ? -109.48 43.83 31 6 GLU A 97 ? ? -66.25 -74.92 32 6 TYR B 203 ? ? 65.42 86.61 33 6 ASP B 205 ? ? 66.23 72.98 34 6 PRO B 206 ? ? -100.49 65.85 35 6 LEU B 215 ? ? 49.54 -171.10 36 7 CYS A 35 ? ? -56.05 99.36 37 7 ASN A 58 ? ? -81.03 34.33 38 7 HIS A 77 ? ? -95.91 37.13 39 7 LYS A 82 ? ? -108.75 42.27 40 7 PRO A 86 ? ? -50.18 -70.74 41 7 ALA A 100 ? ? -151.72 54.49 42 7 MET B 202 ? ? 63.59 -167.84 43 8 ARG A 4 ? ? -96.23 51.40 44 8 CYS A 35 ? ? -58.07 101.91 45 8 LYS A 82 ? ? -110.44 61.39 46 8 MET B 202 ? ? 65.49 -164.63 47 8 TYR B 203 ? ? 74.32 131.08 48 8 ASP B 205 ? ? 58.18 88.07 49 8 ILE B 212 ? ? -119.58 78.72 50 9 CYS A 35 ? ? -54.53 102.33 51 9 ASN A 58 ? ? -81.81 36.54 52 9 LYS A 82 ? ? -103.72 42.44 53 9 GLU A 97 ? ? -89.68 -89.92 54 9 PHE A 98 ? ? 33.69 66.32 55 9 PRO A 99 ? ? -68.31 62.21 56 9 ASP B 205 ? ? 60.42 67.35 57 9 PRO B 206 ? ? -100.26 74.47 58 10 ALA A 5 ? ? 63.93 -161.44 59 10 CYS A 35 ? ? -65.64 99.71 60 10 ASN A 58 ? ? -77.35 30.47 61 10 HIS A 77 ? ? -97.97 31.09 62 10 ILE B 212 ? ? -119.47 77.40 63 10 ASN B 213 ? ? -93.14 57.85 64 11 THR A 6 ? ? 52.23 111.16 65 11 CYS A 35 ? ? -58.28 102.86 66 11 ASN A 58 ? ? -84.84 33.96 67 11 LYS A 82 ? ? -113.37 53.97 68 11 PHE A 98 ? ? 81.11 44.20 69 11 TYR B 203 ? ? -116.25 78.16 70 11 ASP B 205 ? ? 57.83 84.42 71 11 PRO B 206 ? ? -100.24 71.05 72 12 ARG A 4 ? ? -135.38 -59.40 73 12 LYS A 56 ? ? -41.12 -70.96 74 12 ASN A 58 ? ? -75.19 28.74 75 12 LYS A 82 ? ? -107.82 42.35 76 12 GLU A 97 ? ? -66.43 -87.62 77 12 ASP B 205 ? ? 59.82 71.73 78 13 ARG A 4 ? ? -155.27 37.23 79 13 THR A 6 ? ? 56.16 123.83 80 13 CYS A 30 ? ? -61.94 87.38 81 13 CYS A 35 ? ? -52.04 101.88 82 13 LYS A 56 ? ? -37.45 -70.13 83 13 ASN A 58 ? ? -78.80 26.79 84 13 LYS A 82 ? ? -106.46 55.37 85 13 PRO A 99 ? ? -104.91 -164.35 86 13 GLU B 214 ? ? -115.30 56.37 87 14 ASN A 58 ? ? -80.82 31.28 88 14 GLU A 97 ? ? -68.67 -70.18 89 14 PRO A 99 ? ? -100.39 77.66 90 14 PRO B 206 ? ? -68.13 70.45 91 15 ARG A 4 ? ? 69.08 -69.79 92 15 CYS A 35 ? ? -64.79 98.66 93 15 ASN A 58 ? ? -78.20 30.11 94 15 LYS A 82 ? ? -117.07 55.77 95 15 ALA A 100 ? ? -104.83 51.48 96 15 MET B 202 ? ? 64.93 105.95 97 15 PRO B 206 ? ? -104.49 71.02 98 16 ARG A 4 ? ? -146.10 -67.37 99 16 CYS A 30 ? ? -57.19 85.49 100 16 CYS A 35 ? ? -59.40 105.52 101 16 ASN A 58 ? ? -76.19 30.95 102 16 GLU A 97 ? ? -57.06 -80.22 103 16 PRO A 99 ? ? -93.27 54.46 104 16 MET B 202 ? ? 64.22 -178.73 105 16 TYR B 203 ? ? 71.58 135.51 106 16 ASP B 205 ? ? 65.68 99.93 107 17 THR A 6 ? ? 62.04 163.09 108 17 LYS A 56 ? ? -36.90 -70.22 109 17 ASN A 58 ? ? -71.74 29.63 110 17 MET B 202 ? ? -150.90 83.11 111 17 ASN B 213 ? ? -103.17 43.23 112 18 LYS A 82 ? ? -108.12 42.66 113 18 PRO A 99 ? ? -73.45 39.64 114 18 TYR B 203 ? ? -94.70 -60.15 115 18 PRO B 204 ? ? -75.93 47.97 116 19 ASN A 58 ? ? -71.83 24.38 117 19 VAL A 85 ? ? -49.63 109.70 118 19 GLU A 97 ? ? -44.41 -70.26 119 19 PHE A 98 ? ? -125.21 -55.37 120 19 MET B 202 ? ? 62.10 84.38 121 19 ILE B 212 ? ? -113.27 76.85 122 20 CYS A 30 ? ? -55.56 88.70 123 20 CYS A 35 ? ? -40.97 100.68 124 20 ASN A 58 ? ? -84.76 35.96 125 20 LYS A 82 ? ? -105.69 48.12 126 20 PHE A 98 ? ? 104.78 -55.97 127 20 TYR B 203 ? ? -148.34 -55.44 # _pdbx_nmr_ensemble.entry_id 7XFG _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7XFG _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;0.5 mM [U-100% 13C; U-100% 15N] p300 TAZ2 domain, 1.5 mM BRD4-NUT fusion protein F1c domain binding motif #1, 200 mM sodium phosphate, 3.0 mM [U-100% 2H] DTT, 90% H2O/10% D2O ; '90% H2O/10% D2O' sample_1 solution ? 2 ;0.5 mM [U-100% 13C; U-100% 15N] p300 TAZ2 domain, 1.5 mM BRD4-NUT fusion protein F1c domain binding motif #1, 200 mM sodium phosphate, 3.0 mM [U-100% 2H] DTT, 100% D2O ; '100% D2O' sample_2 solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'p300 TAZ2 domain' 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 'BRD4-NUT fusion protein F1c domain binding motif #1' 1.5 ? mM 'natural abundance' 1 'sodium phosphate' 200 ? mM 'natural abundance' 1 DTT 3.0 ? mM '[U-100% 2H]' 2 'p300 TAZ2 domain' 0.5 ? mM '[U-100% 13C; U-100% 15N]' 2 'BRD4-NUT fusion protein F1c domain binding motif #1' 1.5 ? mM 'natural abundance' 2 'sodium phosphate' 200 ? mM 'natural abundance' 2 DTT 3.0 ? mM '[U-100% 2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength null _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCACB' 1 isotropic 2 1 1 '3D HN(COCA)CB' 1 isotropic 3 1 1 '3D 1H-15N NOESY' 2 isotropic 4 1 2 '3D 1H-13C NOESY aliphatic' 2 isotropic 5 1 2 '3D 1H-13C NOESY aromatic' 2 isotropic 6 1 2 '3D 13C-edited 13C/15N filtered NOESY aliphatic' 2 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 7XFG 'distance geometry' ? 2 7XFG 'simulated annealing' ? 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; 2 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 4 'peak picking' NMRView ? 'Johnson, One Moon Scientific' 5 collection TopSpin ? 'Bruker Biospin' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31770780 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 600 ? 2 'AVANCE NEO' ? Bruker 800 ? # _atom_sites.entry_id 7XFG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_