data_7XGC # _entry.id 7XGC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XGC pdb_00007xgc 10.2210/pdb7xgc/pdb WWPDB D_1300028756 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XGC _pdbx_database_status.recvd_initial_deposition_date 2022-04-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Guo, Y.' 1 ? 'Hoshino, T.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cryst.Growth Des.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1528-7505 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Influence of Glycan Agents on Protein Crystallization with Ammonium Sulfate' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.cgd.2c00901 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guo, Y.' 1 ? primary 'Hoshino, T.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7XGC _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.177 _cell.length_a_esd ? _cell.length_b 66.177 _cell.length_b_esd ? _cell.length_c 125.727 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7XGC _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 22300.494 1 3.1.-.-,3.1.-.- ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 4 water nat water 18.015 84 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ASP n 1 9 PHE n 1 10 VAL n 1 11 ARG n 1 12 GLN n 1 13 CYS n 1 14 PHE n 1 15 ASN n 1 16 PRO n 1 17 MET n 1 18 ILE n 1 19 VAL n 1 20 GLU n 1 21 LEU n 1 22 ALA n 1 23 GLU n 1 24 LYS n 1 25 THR n 1 26 MET n 1 27 LYS n 1 28 GLU n 1 29 TYR n 1 30 GLY n 1 31 GLU n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 ILE n 1 36 GLU n 1 37 THR n 1 38 ASN n 1 39 LYS n 1 40 PHE n 1 41 ALA n 1 42 ALA n 1 43 ILE n 1 44 CYS n 1 45 THR n 1 46 HIS n 1 47 LEU n 1 48 GLU n 1 49 VAL n 1 50 CYS n 1 51 PHE n 1 52 MET n 1 53 TYR n 1 54 SER n 1 55 ASP n 1 56 ALA n 1 57 SER n 1 58 LYS n 1 59 HIS n 1 60 ARG n 1 61 PHE n 1 62 GLU n 1 63 ILE n 1 64 ILE n 1 65 GLU n 1 66 GLY n 1 67 ARG n 1 68 ASP n 1 69 ARG n 1 70 THR n 1 71 MET n 1 72 ALA n 1 73 TRP n 1 74 THR n 1 75 VAL n 1 76 VAL n 1 77 ASN n 1 78 SER n 1 79 ILE n 1 80 CYS n 1 81 ASN n 1 82 THR n 1 83 THR n 1 84 GLY n 1 85 ALA n 1 86 GLU n 1 87 LYS n 1 88 PRO n 1 89 LYS n 1 90 PHE n 1 91 LEU n 1 92 PRO n 1 93 ASP n 1 94 LEU n 1 95 TYR n 1 96 ASP n 1 97 TYR n 1 98 LYS n 1 99 GLU n 1 100 ASN n 1 101 ARG n 1 102 PHE n 1 103 ILE n 1 104 GLU n 1 105 ILE n 1 106 GLY n 1 107 VAL n 1 108 THR n 1 109 ARG n 1 110 ARG n 1 111 GLU n 1 112 VAL n 1 113 HIS n 1 114 ILE n 1 115 TYR n 1 116 TYR n 1 117 LEU n 1 118 GLU n 1 119 LYS n 1 120 ALA n 1 121 ASN n 1 122 LYS n 1 123 ILE n 1 124 LYS n 1 125 SER n 1 126 GLU n 1 127 LYS n 1 128 THR n 1 129 HIS n 1 130 ILE n 1 131 HIS n 1 132 ILE n 1 133 PHE n 1 134 SER n 1 135 PHE n 1 136 THR n 1 137 GLY n 1 138 GLU n 1 139 GLU n 1 140 MET n 1 141 ALA n 1 142 THR n 1 143 LYS n 1 144 ALA n 1 145 ASP n 1 146 TYR n 1 147 THR n 1 148 LEU n 1 149 ASP n 1 150 GLU n 1 151 GLU n 1 152 SER n 1 153 ARG n 1 154 ALA n 1 155 ARG n 1 156 ILE n 1 157 LYS n 1 158 THR n 1 159 ARG n 1 160 LEU n 1 161 PHE n 1 162 THR n 1 163 ILE n 1 164 ARG n 1 165 GLN n 1 166 GLU n 1 167 MET n 1 168 ALA n 1 169 SER n 1 170 ARG n 1 171 GLY n 1 172 LEU n 1 173 TRP n 1 174 ASP n 1 175 SER n 1 176 PHE n 1 177 ARG n 1 178 GLN n 1 179 SER n 1 180 GLU n 1 181 ARG n 1 182 GLY n 1 183 ALA n 1 184 ALA n 1 185 GLU n 1 186 LEU n 1 187 ALA n 1 188 LEU n 1 189 VAL n 1 190 PRO n 1 191 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 55 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus (A/Puerto Rico/8/1934(H1N1))' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 'Rosetta(DE3)pLys' ? ? ? ? ? ? plasmid ? ? ? pET50b ? ? 1 2 sample 'Biological sequence' 56 191 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus (A/Puerto Rico/8/1934(H1N1))' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 'Rosetta(DE3)pLys' ? ? ? ? ? ? plasmid ? ? ? pET50b ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PA_I34A1 P03433 ? 1 MEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSD 1 2 UNP PA_I34A1 P03433 ? 1 ;KHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERG ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7XGC A 6 ? 55 ? P03433 1 ? 50 ? 6 55 2 2 7XGC A 58 ? 182 ? P03433 73 ? 197 ? 58 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XGC GLY A 1 ? UNP P03433 ? ? 'expression tag' 1 1 1 7XGC PRO A 2 ? UNP P03433 ? ? 'expression tag' 2 2 1 7XGC LEU A 3 ? UNP P03433 ? ? 'expression tag' 3 3 1 7XGC GLY A 4 ? UNP P03433 ? ? 'expression tag' 4 4 1 7XGC SER A 5 ? UNP P03433 ? ? 'expression tag' 5 5 1 7XGC ALA A 56 ? UNP P03433 ? ? linker 56 6 1 7XGC SER A 57 ? UNP P03433 ? ? linker 57 7 2 7XGC ALA A 183 ? UNP P03433 ? ? 'expression tag' 183 8 2 7XGC ALA A 184 ? UNP P03433 ? ? 'expression tag' 184 9 2 7XGC GLU A 185 ? UNP P03433 ? ? 'expression tag' 185 10 2 7XGC LEU A 186 ? UNP P03433 ? ? 'expression tag' 186 11 2 7XGC ALA A 187 ? UNP P03433 ? ? 'expression tag' 187 12 2 7XGC LEU A 188 ? UNP P03433 ? ? 'expression tag' 188 13 2 7XGC VAL A 189 ? UNP P03433 ? ? 'expression tag' 189 14 2 7XGC PRO A 190 ? UNP P03433 ? ? 'expression tag' 190 15 2 7XGC ARG A 191 ? UNP P03433 ? ? 'expression tag' 191 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XGC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.15 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.150 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M MES, 1.275M Ammonium Sulfate, 0.1M POTASSIUM CHLORIDE, 9%(v/v) TREHALOSE' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details mirrors _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-12-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 29.430 _reflns.entry_id 7XGC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.600 _reflns.d_resolution_low 46.790 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 37623 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.800 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.049 _reflns.pdbx_Rpim_I_all 0.014 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.600 _reflns_shell.d_res_low 1.630 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1755 _reflns_shell.percent_possible_all 96.400 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.174 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.200 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.282 _reflns_shell.pdbx_Rpim_I_all 0.495 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.522 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 114.140 _refine.B_iso_mean 34.8614 _refine.B_iso_min 19.860 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XGC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6000 _refine.ls_d_res_low 37.5360 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 37543 _refine.ls_number_reflns_R_free 1878 _refine.ls_number_reflns_R_work 66599 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5900 _refine.ls_percent_reflns_R_free 4.9800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2063 _refine.ls_R_factor_R_free 0.2279 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2051 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZQQ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.9700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.6000 _refine_hist.d_res_low 37.5360 _refine_hist.number_atoms_solvent 84 _refine_hist.number_atoms_total 1584 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 181 _refine_hist.pdbx_B_iso_mean_ligand 76.64 _refine_hist.pdbx_B_iso_mean_solvent 38.38 _refine_hist.pdbx_number_atoms_protein 1493 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6003 1.6222 . . 130 2528 94.0000 . . . 0.3721 0.0000 0.3458 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6222 1.6454 . . 137 2624 98.0000 . . . 0.3281 0.0000 0.3139 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6454 1.6699 . . 140 2640 99.0000 . . . 0.3323 0.0000 0.3177 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6699 1.6960 . . 143 2672 100.0000 . . . 0.3226 0.0000 0.2816 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6960 1.7238 . . 144 2644 100.0000 . . . 0.2942 0.0000 0.2684 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7238 1.7535 . . 138 2684 100.0000 . . . 0.2671 0.0000 0.2501 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7535 1.7854 . . 147 2673 100.0000 . . . 0.2685 0.0000 0.2416 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7854 1.8198 . . 142 2660 100.0000 . . . 0.2618 0.0000 0.2353 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8198 1.8569 . . 138 2649 100.0000 . . . 0.2912 0.0000 0.2355 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8569 1.8973 . . 138 2711 100.0000 . . . 0.2537 0.0000 0.2262 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8973 1.9414 . . 134 2700 100.0000 . . . 0.2941 0.0000 0.2284 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9414 1.9900 . . 144 2651 100.0000 . . . 0.2835 0.0000 0.2278 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9900 2.0438 . . 136 2661 100.0000 . . . 0.2542 0.0000 0.2262 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0438 2.1039 . . 141 2661 100.0000 . . . 0.2825 0.0000 0.2188 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1039 2.1718 . . 135 2697 100.0000 . . . 0.2653 0.0000 0.2205 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1718 2.2494 . . 142 2679 100.0000 . . . 0.2232 0.0000 0.2195 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2494 2.3395 . . 142 2690 100.0000 . . . 0.2650 0.0000 0.2214 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3395 2.4459 . . 140 2660 100.0000 . . . 0.2469 0.0000 0.2251 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4459 2.5748 . . 141 2652 100.0000 . . . 0.2479 0.0000 0.2311 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5748 2.7361 . . 139 2705 100.0000 . . . 0.2518 0.0000 0.2136 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7361 2.9473 . . 142 2673 100.0000 . . . 0.2509 0.0000 0.2122 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9473 3.2437 . . 138 2668 100.0000 . . . 0.2116 0.0000 0.2128 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2437 3.7128 . . 145 2674 100.0000 . . . 0.2168 0.0000 0.1917 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7128 4.6763 . . 138 2671 100.0000 . . . 0.1857 0.0000 0.1580 . . . . . . . . . . . # _struct.entry_id 7XGC _struct.title 'Crystal structure of influenza polymerase acidic subunit N-terminal domain crystallized by ammonium sulfate with glycan' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XGC _struct_keywords.text 'endo-nuclease, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? PHE A 14 ? SER A 5 PHE A 14 1 ? 10 HELX_P HELX_P2 AA2 ASN A 15 ? TYR A 29 ? ASN A 15 TYR A 29 1 ? 15 HELX_P HELX_P3 AA3 GLU A 36 ? ALA A 56 ? GLU A 36 ALA A 56 1 ? 21 HELX_P HELX_P4 AA4 ASP A 68 ? GLY A 84 ? ASP A 68 GLY A 84 1 ? 17 HELX_P HELX_P5 AA5 GLU A 111 ? LYS A 124 ? GLU A 111 LYS A 124 1 ? 14 HELX_P HELX_P6 AA6 LYS A 143 ? ASP A 145 ? LYS A 143 ASP A 145 5 ? 3 HELX_P HELX_P7 AA7 ASP A 149 ? ARG A 170 ? ASP A 149 ARG A 170 1 ? 22 HELX_P HELX_P8 AA8 LEU A 172 ? SER A 179 ? LEU A 172 SER A 179 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 65 OE1 ? ? ? 1_555 D MN . MN ? ? A GLU 65 A MN 203 1_555 ? ? ? ? ? ? ? 2.288 ? ? metalc2 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 202 A HOH 380 1_555 ? ? ? ? ? ? ? 2.798 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 61 ? ILE A 63 ? PHE A 61 ILE A 63 AA1 2 LEU A 94 ? ASP A 96 ? LEU A 94 ASP A 96 AA1 3 ARG A 101 ? THR A 108 ? ARG A 101 THR A 108 AA1 4 HIS A 129 ? SER A 134 ? HIS A 129 SER A 134 AA1 5 GLU A 139 ? ALA A 141 ? GLU A 139 ALA A 141 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 62 ? N GLU A 62 O TYR A 95 ? O TYR A 95 AA1 2 3 N ASP A 96 ? N ASP A 96 O ARG A 101 ? O ARG A 101 AA1 3 4 N GLY A 106 ? N GLY A 106 O PHE A 133 ? O PHE A 133 AA1 4 5 N ILE A 132 ? N ILE A 132 O MET A 140 ? O MET A 140 # _atom_sites.entry_id 7XGC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015111 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015111 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007954 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 TRP 173 173 173 TRP TRP A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 GLY 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 ALA 184 184 ? ? ? A . n A 1 185 GLU 185 185 ? ? ? A . n A 1 186 LEU 186 186 ? ? ? A . n A 1 187 ALA 187 187 ? ? ? A . n A 1 188 LEU 188 188 ? ? ? A . n A 1 189 VAL 189 189 ? ? ? A . n A 1 190 PRO 190 190 ? ? ? A . n A 1 191 ARG 191 191 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email hoshino@chiba-u.jp _pdbx_contact_author.name_first Tyuji _pdbx_contact_author.name_last Hoshino _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4705-4412 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 201 SO4 SO4 A . C 3 MN 1 202 1 MN MN A . D 3 MN 1 203 2 MN MN A . E 4 HOH 1 301 82 HOH HOH A . E 4 HOH 2 302 56 HOH HOH A . E 4 HOH 3 303 39 HOH HOH A . E 4 HOH 4 304 64 HOH HOH A . E 4 HOH 5 305 41 HOH HOH A . E 4 HOH 6 306 23 HOH HOH A . E 4 HOH 7 307 43 HOH HOH A . E 4 HOH 8 308 69 HOH HOH A . E 4 HOH 9 309 65 HOH HOH A . E 4 HOH 10 310 52 HOH HOH A . E 4 HOH 11 311 25 HOH HOH A . E 4 HOH 12 312 67 HOH HOH A . E 4 HOH 13 313 55 HOH HOH A . E 4 HOH 14 314 30 HOH HOH A . E 4 HOH 15 315 46 HOH HOH A . E 4 HOH 16 316 66 HOH HOH A . E 4 HOH 17 317 3 HOH HOH A . E 4 HOH 18 318 1 HOH HOH A . E 4 HOH 19 319 61 HOH HOH A . E 4 HOH 20 320 35 HOH HOH A . E 4 HOH 21 321 42 HOH HOH A . E 4 HOH 22 322 54 HOH HOH A . E 4 HOH 23 323 36 HOH HOH A . E 4 HOH 24 324 11 HOH HOH A . E 4 HOH 25 325 53 HOH HOH A . E 4 HOH 26 326 12 HOH HOH A . E 4 HOH 27 327 7 HOH HOH A . E 4 HOH 28 328 2 HOH HOH A . E 4 HOH 29 329 33 HOH HOH A . E 4 HOH 30 330 9 HOH HOH A . E 4 HOH 31 331 84 HOH HOH A . E 4 HOH 32 332 60 HOH HOH A . E 4 HOH 33 333 21 HOH HOH A . E 4 HOH 34 334 31 HOH HOH A . E 4 HOH 35 335 5 HOH HOH A . E 4 HOH 36 336 77 HOH HOH A . E 4 HOH 37 337 58 HOH HOH A . E 4 HOH 38 338 20 HOH HOH A . E 4 HOH 39 339 48 HOH HOH A . E 4 HOH 40 340 57 HOH HOH A . E 4 HOH 41 341 14 HOH HOH A . E 4 HOH 42 342 18 HOH HOH A . E 4 HOH 43 343 79 HOH HOH A . E 4 HOH 44 344 45 HOH HOH A . E 4 HOH 45 345 24 HOH HOH A . E 4 HOH 46 346 75 HOH HOH A . E 4 HOH 47 347 16 HOH HOH A . E 4 HOH 48 348 22 HOH HOH A . E 4 HOH 49 349 27 HOH HOH A . E 4 HOH 50 350 38 HOH HOH A . E 4 HOH 51 351 4 HOH HOH A . E 4 HOH 52 352 50 HOH HOH A . E 4 HOH 53 353 10 HOH HOH A . E 4 HOH 54 354 8 HOH HOH A . E 4 HOH 55 355 17 HOH HOH A . E 4 HOH 56 356 13 HOH HOH A . E 4 HOH 57 357 73 HOH HOH A . E 4 HOH 58 358 76 HOH HOH A . E 4 HOH 59 359 59 HOH HOH A . E 4 HOH 60 360 37 HOH HOH A . E 4 HOH 61 361 49 HOH HOH A . E 4 HOH 62 362 63 HOH HOH A . E 4 HOH 63 363 34 HOH HOH A . E 4 HOH 64 364 70 HOH HOH A . E 4 HOH 65 365 51 HOH HOH A . E 4 HOH 66 366 71 HOH HOH A . E 4 HOH 67 367 29 HOH HOH A . E 4 HOH 68 368 83 HOH HOH A . E 4 HOH 69 369 28 HOH HOH A . E 4 HOH 70 370 44 HOH HOH A . E 4 HOH 71 371 6 HOH HOH A . E 4 HOH 72 372 15 HOH HOH A . E 4 HOH 73 373 19 HOH HOH A . E 4 HOH 74 374 81 HOH HOH A . E 4 HOH 75 375 85 HOH HOH A . E 4 HOH 76 376 62 HOH HOH A . E 4 HOH 77 377 68 HOH HOH A . E 4 HOH 78 378 47 HOH HOH A . E 4 HOH 79 379 32 HOH HOH A . E 4 HOH 80 380 26 HOH HOH A . E 4 HOH 81 381 80 HOH HOH A . E 4 HOH 82 382 78 HOH HOH A . E 4 HOH 83 383 40 HOH HOH A . E 4 HOH 84 384 72 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -12 ? 1 'SSA (A^2)' 9840 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-20 2 'Structure model' 1 1 2022-11-02 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.1.27 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 7XGC _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 59 ? ? 80.72 -13.81 2 1 THR A 147 ? ? 66.51 -61.84 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 182 ? A GLY 182 2 1 Y 1 A ALA 183 ? A ALA 183 3 1 Y 1 A ALA 184 ? A ALA 184 4 1 Y 1 A GLU 185 ? A GLU 185 5 1 Y 1 A LEU 186 ? A LEU 186 6 1 Y 1 A ALA 187 ? A ALA 187 7 1 Y 1 A LEU 188 ? A LEU 188 8 1 Y 1 A VAL 189 ? A VAL 189 9 1 Y 1 A PRO 190 ? A PRO 190 10 1 Y 1 A ARG 191 ? A ARG 191 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MN MN MN N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TRP N N N N 327 TRP CA C N S 328 TRP C C N N 329 TRP O O N N 330 TRP CB C N N 331 TRP CG C Y N 332 TRP CD1 C Y N 333 TRP CD2 C Y N 334 TRP NE1 N Y N 335 TRP CE2 C Y N 336 TRP CE3 C Y N 337 TRP CZ2 C Y N 338 TRP CZ3 C Y N 339 TRP CH2 C Y N 340 TRP OXT O N N 341 TRP H H N N 342 TRP H2 H N N 343 TRP HA H N N 344 TRP HB2 H N N 345 TRP HB3 H N N 346 TRP HD1 H N N 347 TRP HE1 H N N 348 TRP HE3 H N N 349 TRP HZ2 H N N 350 TRP HZ3 H N N 351 TRP HH2 H N N 352 TRP HXT H N N 353 TYR N N N N 354 TYR CA C N S 355 TYR C C N N 356 TYR O O N N 357 TYR CB C N N 358 TYR CG C Y N 359 TYR CD1 C Y N 360 TYR CD2 C Y N 361 TYR CE1 C Y N 362 TYR CE2 C Y N 363 TYR CZ C Y N 364 TYR OH O N N 365 TYR OXT O N N 366 TYR H H N N 367 TYR H2 H N N 368 TYR HA H N N 369 TYR HB2 H N N 370 TYR HB3 H N N 371 TYR HD1 H N N 372 TYR HD2 H N N 373 TYR HE1 H N N 374 TYR HE2 H N N 375 TYR HH H N N 376 TYR HXT H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 21K07050 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'MANGANESE (II) ION' MN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ZQQ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #