data_7XIT # _entry.id 7XIT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XIT pdb_00007xit 10.2210/pdb7xit/pdb WWPDB D_1300028911 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XIT _pdbx_database_status.recvd_initial_deposition_date 2022-04-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lu, H.' 1 ? 'Komukai, Y.' 2 ? 'Usami, K.' 3 ? 'Guo, Y.' 4 ? 'Qiao, X.' 5 ? 'Nukaga, M.' 6 ? 'Hoshino, T.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Chem.Inf.Model. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1549-960X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 6762 _citation.page_last 6774 _citation.title 'Computational and Crystallographic Analysis of Binding Structures of Inhibitory Compounds for HIV-1 RNase H Activity.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jcim.2c00537 _citation.pdbx_database_id_PubMed 36184946 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lu, H.' 1 ? primary 'Komukai, Y.' 2 ? primary 'Usami, K.' 3 ? primary 'Guo, Y.' 4 ? primary 'Qiao, X.' 5 ? primary 'Nukaga, M.' 6 ? primary 'Hoshino, T.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7XIT _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.551 _cell.length_a_esd ? _cell.length_b 61.551 _cell.length_b_esd ? _cell.length_c 82.196 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7XIT _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Reverse Transcriptase RNase H domain' 16832.285 1 3.1.26.13 ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn 'ethyl 4-bromanyl-5-nitro-furan-2-carboxylate' 264.030 1 ? ? ? ? 5 water nat water 18.015 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGGSMYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQ YALGIITQWIHNWKKRGWKTPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLF ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGGSMYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQ YALGIITQWIHNWKKRGWKTPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 TYR n 1 8 GLN n 1 9 LEU n 1 10 GLU n 1 11 LYS n 1 12 GLU n 1 13 PRO n 1 14 ILE n 1 15 VAL n 1 16 GLY n 1 17 ALA n 1 18 GLU n 1 19 THR n 1 20 PHE n 1 21 TYR n 1 22 VAL n 1 23 ASP n 1 24 GLY n 1 25 ALA n 1 26 ALA n 1 27 ASN n 1 28 ARG n 1 29 GLU n 1 30 THR n 1 31 LYS n 1 32 LEU n 1 33 GLY n 1 34 LYS n 1 35 ALA n 1 36 GLY n 1 37 TYR n 1 38 VAL n 1 39 THR n 1 40 ASN n 1 41 ARG n 1 42 GLY n 1 43 ARG n 1 44 GLN n 1 45 LYS n 1 46 VAL n 1 47 VAL n 1 48 THR n 1 49 LEU n 1 50 THR n 1 51 ASP n 1 52 THR n 1 53 THR n 1 54 ASN n 1 55 GLN n 1 56 LYS n 1 57 THR n 1 58 GLU n 1 59 LEU n 1 60 GLN n 1 61 ALA n 1 62 ILE n 1 63 TYR n 1 64 LEU n 1 65 ALA n 1 66 LEU n 1 67 GLN n 1 68 ASP n 1 69 SER n 1 70 GLY n 1 71 LEU n 1 72 GLU n 1 73 VAL n 1 74 ASN n 1 75 ILE n 1 76 VAL n 1 77 THR n 1 78 ASP n 1 79 SER n 1 80 GLN n 1 81 TYR n 1 82 ALA n 1 83 LEU n 1 84 GLY n 1 85 ILE n 1 86 ILE n 1 87 THR n 1 88 GLN n 1 89 TRP n 1 90 ILE n 1 91 HIS n 1 92 ASN n 1 93 TRP n 1 94 LYS n 1 95 LYS n 1 96 ARG n 1 97 GLY n 1 98 TRP n 1 99 LYS n 1 100 THR n 1 101 PRO n 1 102 VAL n 1 103 LYS n 1 104 ASN n 1 105 VAL n 1 106 ASP n 1 107 LEU n 1 108 VAL n 1 109 ASN n 1 110 GLN n 1 111 ILE n 1 112 ILE n 1 113 GLU n 1 114 GLN n 1 115 LEU n 1 116 ILE n 1 117 LYS n 1 118 LYS n 1 119 GLU n 1 120 LYS n 1 121 VAL n 1 122 TYR n 1 123 LEU n 1 124 ALA n 1 125 TRP n 1 126 VAL n 1 127 PRO n 1 128 ALA n 1 129 HIS n 1 130 LYS n 1 131 GLY n 1 132 ILE n 1 133 GLY n 1 134 GLY n 1 135 ASN n 1 136 GLU n 1 137 GLN n 1 138 VAL n 1 139 ASP n 1 140 LYS n 1 141 LEU n 1 142 VAL n 1 143 SER n 1 144 ALA n 1 145 GLY n 1 146 ILE n 1 147 ARG n 1 148 LYS n 1 149 VAL n 1 150 LEU n 1 151 PHE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 86 ? ? ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta(DE3)pLys' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50(b)' ? ? 1 2 sample 'Biological sequence' 87 151 ? ? ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta(DE3)pLys' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50(b)' ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A059PIR4_9HIV1 A0A059PIR4 ? 1 ;YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGII ; 167 2 UNP A0A7L9QW77_9HIV1 A0A7L9QW77 ? 1 DLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLF 671 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7XIT A 7 ? 86 ? A0A059PIR4 167 ? 246 ? 7 86 2 2 7XIT A 106 ? 151 ? A0A7L9QW77 671 ? 716 ? 106 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XIT GLY A 1 ? UNP A0A059PIR4 ? ? 'expression tag' 1 1 1 7XIT PRO A 2 ? UNP A0A059PIR4 ? ? 'expression tag' 2 2 1 7XIT GLY A 3 ? UNP A0A059PIR4 ? ? 'expression tag' 3 3 1 7XIT GLY A 4 ? UNP A0A059PIR4 ? ? 'expression tag' 4 4 1 7XIT SER A 5 ? UNP A0A059PIR4 ? ? 'expression tag' 5 5 1 7XIT MET A 6 ? UNP A0A059PIR4 ? ? 'expression tag' 6 6 1 7XIT THR A 87 ? UNP A0A059PIR4 ? ? linker 87 7 1 7XIT GLN A 88 ? UNP A0A059PIR4 ? ? linker 88 8 1 7XIT TRP A 89 ? UNP A0A059PIR4 ? ? linker 89 9 1 7XIT ILE A 90 ? UNP A0A059PIR4 ? ? linker 90 10 1 7XIT HIS A 91 ? UNP A0A059PIR4 ? ? linker 91 11 1 7XIT ASN A 92 ? UNP A0A059PIR4 ? ? linker 92 12 1 7XIT TRP A 93 ? UNP A0A059PIR4 ? ? linker 93 13 1 7XIT LYS A 94 ? UNP A0A059PIR4 ? ? linker 94 14 1 7XIT LYS A 95 ? UNP A0A059PIR4 ? ? linker 95 15 1 7XIT ARG A 96 ? UNP A0A059PIR4 ? ? linker 96 16 1 7XIT GLY A 97 ? UNP A0A059PIR4 ? ? linker 97 17 1 7XIT TRP A 98 ? UNP A0A059PIR4 ? ? linker 98 18 1 7XIT LYS A 99 ? UNP A0A059PIR4 ? ? linker 99 19 1 7XIT THR A 100 ? UNP A0A059PIR4 ? ? linker 100 20 1 7XIT PRO A 101 ? UNP A0A059PIR4 ? ? linker 101 21 1 7XIT VAL A 102 ? UNP A0A059PIR4 ? ? linker 102 22 1 7XIT LYS A 103 ? UNP A0A059PIR4 ? ? linker 103 23 1 7XIT ASN A 104 ? UNP A0A059PIR4 ? ? linker 104 24 1 7XIT VAL A 105 ? UNP A0A059PIR4 ? ? linker 105 25 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 E6I non-polymer . 'ethyl 4-bromanyl-5-nitro-furan-2-carboxylate' ? 'C7 H6 Br N O5' 264.030 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XIT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.590 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M MES, 26% (v/v) PEG 6000, 0.01M Zinc Sulfate, 0.001M MANGANESE CHLORIDE' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details mirrors _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-04-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 44.790 _reflns.entry_id 7XIT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.160 _reflns.d_resolution_low 48.890 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15758 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 27.300 _reflns.pdbx_Rmerge_I_obs 0.166 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.169 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.160 2.230 ? ? 19292 ? ? ? 714 96.300 ? ? ? ? 0.797 ? ? ? ? ? ? ? ? 27.000 ? ? ? 3.900 0.813 0.155 ? 1 1 0.952 ? ? ? ? ? ? ? ? ? ? 8.910 48.890 ? ? 3293 ? ? ? 164 99.100 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 20.100 ? ? ? 26.400 0.113 0.025 ? 2 1 0.995 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 140.550 _refine.B_iso_mean 50.1959 _refine.B_iso_min 23.050 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XIT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1800 _refine.ls_d_res_low 29.8800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15758 _refine.ls_number_reflns_R_free 809 _refine.ls_number_reflns_R_work 14949 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7800 _refine.ls_percent_reflns_R_free 5.1300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2275 _refine.ls_R_factor_R_free 0.2741 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2249 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.930 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3QIN _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.9400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1800 _refine_hist.d_res_low 29.8800 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 1179 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 147 _refine_hist.pdbx_B_iso_mean_ligand 66.09 _refine_hist.pdbx_B_iso_mean_solvent 35.59 _refine_hist.pdbx_number_atoms_protein 1158 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1800 2.3100 2579 . 131 2448 99.0000 . . . 0.3242 0.0000 0.2873 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.3100 2.4900 2667 . 138 2529 100.0000 . . . 0.3250 0.0000 0.2334 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.4900 2.7400 2619 . 138 2481 100.0000 . . . 0.2677 0.0000 0.2892 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.7400 3.1400 2626 . 136 2490 100.0000 . . . 0.3572 0.0000 0.2703 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.1400 3.9500 2631 . 131 2500 100.0000 . . . 0.3206 0.0000 0.2349 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.9500 29.8800 2636 . 135 2501 100.0000 . . . 0.2116 0.0000 0.1812 . . . . . . . 6 . . . # _struct.entry_id 7XIT _struct.title ;Crystal structure of engineered HIV-1 Reverse Transcriptase RNase H domain complexed with nitrofuran methoxy(methoxycarbonyl)phenyl ester ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XIT _struct_keywords.text 'ribonuclease, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 53 ? ASP A 68 ? THR A 53 ASP A 68 1 ? 16 HELX_P HELX_P2 AA2 SER A 79 ? ASN A 92 ? SER A 79 ASN A 92 1 ? 14 HELX_P HELX_P3 AA3 ASN A 104 ? LYS A 117 ? ASN A 104 LYS A 117 1 ? 14 HELX_P HELX_P4 AA4 GLY A 133 ? ALA A 144 ? GLY A 133 ALA A 144 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 23 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 23 A MN 201 1_555 ? ? ? ? ? ? ? 1.944 ? ? metalc2 metalc ? ? A ASP 23 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 23 A MN 202 1_555 ? ? ? ? ? ? ? 1.953 ? ? metalc3 metalc ? ? A ASP 51 OD1 ? ? ? 1_555 D ZN . ZN ? ? A ASP 51 A ZN 203 6_444 ? ? ? ? ? ? ? 2.065 ? ? metalc4 metalc ? ? A GLU 58 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 58 A MN 201 1_555 ? ? ? ? ? ? ? 1.799 ? ? metalc5 metalc ? ? A GLU 72 OE2 ? ? ? 1_555 E ZN . ZN ? ? A GLU 72 A ZN 204 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc6 metalc ? ? A ASP 78 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 78 A MN 201 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc7 metalc ? ? A ASP 78 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 78 A MN 201 1_555 ? ? ? ? ? ? ? 2.718 ? ? metalc8 metalc ? ? A ASP 78 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 78 A MN 202 1_555 ? ? ? ? ? ? ? 2.615 ? ? metalc9 metalc ? ? A HIS 91 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 91 A ZN 204 4_554 ? ? ? ? ? ? ? 2.275 ? ? metalc10 metalc ? ? A GLU 119 OE1 ? ? ? 1_555 E ZN . ZN ? ? A GLU 119 A ZN 204 1_555 ? ? ? ? ? ? ? 1.894 ? ? metalc11 metalc ? ? A HIS 129 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 129 A ZN 203 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc12 metalc ? ? A GLU 136 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 136 A ZN 203 1_555 ? ? ? ? ? ? ? 2.156 ? ? metalc13 metalc ? ? A ASP 139 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 139 A MN 202 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc14 metalc ? ? B MN . MN ? ? ? 1_555 F E6I . OAA ? ? A MN 201 A E6I 205 1_555 ? ? ? ? ? ? ? 1.746 ? ? metalc15 metalc ? ? C MN . MN ? ? ? 1_555 F E6I . OAK ? ? A MN 202 A E6I 205 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc16 metalc ? ? D ZN . ZN ? ? ? 1_555 G HOH . O ? ? A ZN 203 A HOH 301 6_544 ? ? ? ? ? ? ? 2.069 ? ? metalc17 metalc ? ? E ZN . ZN ? ? ? 1_555 G HOH . O ? ? A ZN 204 A HOH 302 1_555 ? ? ? ? ? ? ? 2.308 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 44 ? LEU A 49 ? GLN A 44 LEU A 49 AA1 2 LEU A 32 ? THR A 39 ? LEU A 32 THR A 39 AA1 3 THR A 19 ? ASN A 27 ? THR A 19 ASN A 27 AA1 4 GLU A 72 ? THR A 77 ? GLU A 72 THR A 77 AA1 5 LYS A 120 ? TRP A 125 ? LYS A 120 TRP A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 47 ? O VAL A 47 N ALA A 35 ? N ALA A 35 AA1 2 3 O VAL A 38 ? O VAL A 38 N TYR A 21 ? N TYR A 21 AA1 3 4 N PHE A 20 ? N PHE A 20 O ASN A 74 ? O ASN A 74 AA1 4 5 N ILE A 75 ? N ILE A 75 O TYR A 122 ? O TYR A 122 # _atom_sites.entry_id 7XIT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016247 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016247 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012166 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol BR C MN N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 LEU 150 150 ? ? ? A . n A 1 151 PHE 151 151 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email hoshino@chiba-u.jp _pdbx_contact_author.name_first Tyuji _pdbx_contact_author.name_last Hoshino _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4705-4412 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 201 150 MN MN A . C 2 MN 1 202 151 MN MN A . D 3 ZN 1 203 152 ZN ZN A . E 3 ZN 1 204 153 ZN ZN A . F 4 E6I 1 205 1 E6I DRG A . G 5 HOH 1 301 1 HOH HOH A . G 5 HOH 2 302 3 HOH HOH A . G 5 HOH 3 303 9 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 94.0 ? 2 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 119.2 ? 3 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 106.0 ? 4 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 83.6 ? 5 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 149.9 ? 6 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 51.7 ? 7 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OAA ? F E6I . ? A E6I 205 ? 1_555 134.5 ? 8 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OAA ? F E6I . ? A E6I 205 ? 1_555 95.5 ? 9 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OAA ? F E6I . ? A E6I 205 ? 1_555 100.6 ? 10 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OAA ? F E6I . ? A E6I 205 ? 1_555 107.6 ? 11 OD2 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 86.1 ? 12 OD2 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OD2 ? A ASP 139 ? A ASP 139 ? 1_555 86.3 ? 13 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OD2 ? A ASP 139 ? A ASP 139 ? 1_555 159.6 ? 14 OD2 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OAK ? F E6I . ? A E6I 205 ? 1_555 74.6 ? 15 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OAK ? F E6I . ? A E6I 205 ? 1_555 124.5 ? 16 OD2 ? A ASP 139 ? A ASP 139 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OAK ? F E6I . ? A E6I 205 ? 1_555 71.2 ? 17 OD1 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 6_444 NE2 ? A HIS 129 ? A HIS 129 ? 1_555 54.7 ? 18 OD1 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 6_444 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 60.8 ? 19 NE2 ? A HIS 129 ? A HIS 129 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 6_444 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 6.1 ? 20 OD1 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 6_444 O ? G HOH . ? A HOH 301 ? 6_544 57.2 ? 21 NE2 ? A HIS 129 ? A HIS 129 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 6_444 O ? G HOH . ? A HOH 301 ? 6_544 5.9 ? 22 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 6_444 O ? G HOH . ? A HOH 301 ? 6_544 6.0 ? 23 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 ND1 ? A HIS 91 ? A HIS 91 ? 1_555 103.0 ? 24 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OE1 ? A GLU 119 ? A GLU 119 ? 1_555 111.4 ? 25 ND1 ? A HIS 91 ? A HIS 91 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OE1 ? A GLU 119 ? A GLU 119 ? 1_555 52.0 ? 26 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 98.2 ? 27 ND1 ? A HIS 91 ? A HIS 91 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 78.7 ? 28 OE1 ? A GLU 119 ? A GLU 119 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 126.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-27 2 'Structure model' 1 1 2022-10-19 3 'Structure model' 1 2 2023-01-11 4 'Structure model' 1 3 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.1.27 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 7XIT _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 96 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -55.45 _pdbx_validate_torsion.psi -71.60 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A LEU 150 ? A LEU 150 6 1 Y 1 A PHE 151 ? A PHE 151 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 E6I CAB C Y N 74 E6I CAC C Y N 75 E6I CAD C Y N 76 E6I CAE C Y N 77 E6I CAJ C N N 78 E6I CAM C N N 79 E6I CAN C N N 80 E6I NAF N N N 81 E6I OAA O Y N 82 E6I OAG O N N 83 E6I OAH O N N 84 E6I OAK O N N 85 E6I OAL O N N 86 E6I BRAI BR N N 87 E6I H1 H N N 88 E6I H2 H N N 89 E6I H3 H N N 90 E6I H4 H N N 91 E6I H5 H N N 92 E6I H6 H N N 93 GLN N N N N 94 GLN CA C N S 95 GLN C C N N 96 GLN O O N N 97 GLN CB C N N 98 GLN CG C N N 99 GLN CD C N N 100 GLN OE1 O N N 101 GLN NE2 N N N 102 GLN OXT O N N 103 GLN H H N N 104 GLN H2 H N N 105 GLN HA H N N 106 GLN HB2 H N N 107 GLN HB3 H N N 108 GLN HG2 H N N 109 GLN HG3 H N N 110 GLN HE21 H N N 111 GLN HE22 H N N 112 GLN HXT H N N 113 GLU N N N N 114 GLU CA C N S 115 GLU C C N N 116 GLU O O N N 117 GLU CB C N N 118 GLU CG C N N 119 GLU CD C N N 120 GLU OE1 O N N 121 GLU OE2 O N N 122 GLU OXT O N N 123 GLU H H N N 124 GLU H2 H N N 125 GLU HA H N N 126 GLU HB2 H N N 127 GLU HB3 H N N 128 GLU HG2 H N N 129 GLU HG3 H N N 130 GLU HE2 H N N 131 GLU HXT H N N 132 GLY N N N N 133 GLY CA C N N 134 GLY C C N N 135 GLY O O N N 136 GLY OXT O N N 137 GLY H H N N 138 GLY H2 H N N 139 GLY HA2 H N N 140 GLY HA3 H N N 141 GLY HXT H N N 142 HIS N N N N 143 HIS CA C N S 144 HIS C C N N 145 HIS O O N N 146 HIS CB C N N 147 HIS CG C Y N 148 HIS ND1 N Y N 149 HIS CD2 C Y N 150 HIS CE1 C Y N 151 HIS NE2 N Y N 152 HIS OXT O N N 153 HIS H H N N 154 HIS H2 H N N 155 HIS HA H N N 156 HIS HB2 H N N 157 HIS HB3 H N N 158 HIS HD1 H N N 159 HIS HD2 H N N 160 HIS HE1 H N N 161 HIS HE2 H N N 162 HIS HXT H N N 163 HOH O O N N 164 HOH H1 H N N 165 HOH H2 H N N 166 ILE N N N N 167 ILE CA C N S 168 ILE C C N N 169 ILE O O N N 170 ILE CB C N S 171 ILE CG1 C N N 172 ILE CG2 C N N 173 ILE CD1 C N N 174 ILE OXT O N N 175 ILE H H N N 176 ILE H2 H N N 177 ILE HA H N N 178 ILE HB H N N 179 ILE HG12 H N N 180 ILE HG13 H N N 181 ILE HG21 H N N 182 ILE HG22 H N N 183 ILE HG23 H N N 184 ILE HD11 H N N 185 ILE HD12 H N N 186 ILE HD13 H N N 187 ILE HXT H N N 188 LEU N N N N 189 LEU CA C N S 190 LEU C C N N 191 LEU O O N N 192 LEU CB C N N 193 LEU CG C N N 194 LEU CD1 C N N 195 LEU CD2 C N N 196 LEU OXT O N N 197 LEU H H N N 198 LEU H2 H N N 199 LEU HA H N N 200 LEU HB2 H N N 201 LEU HB3 H N N 202 LEU HG H N N 203 LEU HD11 H N N 204 LEU HD12 H N N 205 LEU HD13 H N N 206 LEU HD21 H N N 207 LEU HD22 H N N 208 LEU HD23 H N N 209 LEU HXT H N N 210 LYS N N N N 211 LYS CA C N S 212 LYS C C N N 213 LYS O O N N 214 LYS CB C N N 215 LYS CG C N N 216 LYS CD C N N 217 LYS CE C N N 218 LYS NZ N N N 219 LYS OXT O N N 220 LYS H H N N 221 LYS H2 H N N 222 LYS HA H N N 223 LYS HB2 H N N 224 LYS HB3 H N N 225 LYS HG2 H N N 226 LYS HG3 H N N 227 LYS HD2 H N N 228 LYS HD3 H N N 229 LYS HE2 H N N 230 LYS HE3 H N N 231 LYS HZ1 H N N 232 LYS HZ2 H N N 233 LYS HZ3 H N N 234 LYS HXT H N N 235 MET N N N N 236 MET CA C N S 237 MET C C N N 238 MET O O N N 239 MET CB C N N 240 MET CG C N N 241 MET SD S N N 242 MET CE C N N 243 MET OXT O N N 244 MET H H N N 245 MET H2 H N N 246 MET HA H N N 247 MET HB2 H N N 248 MET HB3 H N N 249 MET HG2 H N N 250 MET HG3 H N N 251 MET HE1 H N N 252 MET HE2 H N N 253 MET HE3 H N N 254 MET HXT H N N 255 MN MN MN N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TRP N N N N 328 TRP CA C N S 329 TRP C C N N 330 TRP O O N N 331 TRP CB C N N 332 TRP CG C Y N 333 TRP CD1 C Y N 334 TRP CD2 C Y N 335 TRP NE1 N Y N 336 TRP CE2 C Y N 337 TRP CE3 C Y N 338 TRP CZ2 C Y N 339 TRP CZ3 C Y N 340 TRP CH2 C Y N 341 TRP OXT O N N 342 TRP H H N N 343 TRP H2 H N N 344 TRP HA H N N 345 TRP HB2 H N N 346 TRP HB3 H N N 347 TRP HD1 H N N 348 TRP HE1 H N N 349 TRP HE3 H N N 350 TRP HZ2 H N N 351 TRP HZ3 H N N 352 TRP HH2 H N N 353 TRP HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 ZN ZN ZN N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 E6I BRAI CAC sing N N 70 E6I CAC CAD sing Y N 71 E6I CAC CAB doub Y N 72 E6I CAM CAN sing N N 73 E6I CAM OAL sing N N 74 E6I CAD CAE doub Y N 75 E6I OAH NAF sing N N 76 E6I OAL CAJ sing N N 77 E6I CAB NAF sing N N 78 E6I CAB OAA sing Y N 79 E6I NAF OAG doub N N 80 E6I CAE CAJ sing N N 81 E6I CAE OAA sing Y N 82 E6I CAJ OAK doub N N 83 E6I CAD H1 sing N N 84 E6I CAM H2 sing N N 85 E6I CAM H3 sing N N 86 E6I CAN H4 sing N N 87 E6I CAN H5 sing N N 88 E6I CAN H6 sing N N 89 GLN N CA sing N N 90 GLN N H sing N N 91 GLN N H2 sing N N 92 GLN CA C sing N N 93 GLN CA CB sing N N 94 GLN CA HA sing N N 95 GLN C O doub N N 96 GLN C OXT sing N N 97 GLN CB CG sing N N 98 GLN CB HB2 sing N N 99 GLN CB HB3 sing N N 100 GLN CG CD sing N N 101 GLN CG HG2 sing N N 102 GLN CG HG3 sing N N 103 GLN CD OE1 doub N N 104 GLN CD NE2 sing N N 105 GLN NE2 HE21 sing N N 106 GLN NE2 HE22 sing N N 107 GLN OXT HXT sing N N 108 GLU N CA sing N N 109 GLU N H sing N N 110 GLU N H2 sing N N 111 GLU CA C sing N N 112 GLU CA CB sing N N 113 GLU CA HA sing N N 114 GLU C O doub N N 115 GLU C OXT sing N N 116 GLU CB CG sing N N 117 GLU CB HB2 sing N N 118 GLU CB HB3 sing N N 119 GLU CG CD sing N N 120 GLU CG HG2 sing N N 121 GLU CG HG3 sing N N 122 GLU CD OE1 doub N N 123 GLU CD OE2 sing N N 124 GLU OE2 HE2 sing N N 125 GLU OXT HXT sing N N 126 GLY N CA sing N N 127 GLY N H sing N N 128 GLY N H2 sing N N 129 GLY CA C sing N N 130 GLY CA HA2 sing N N 131 GLY CA HA3 sing N N 132 GLY C O doub N N 133 GLY C OXT sing N N 134 GLY OXT HXT sing N N 135 HIS N CA sing N N 136 HIS N H sing N N 137 HIS N H2 sing N N 138 HIS CA C sing N N 139 HIS CA CB sing N N 140 HIS CA HA sing N N 141 HIS C O doub N N 142 HIS C OXT sing N N 143 HIS CB CG sing N N 144 HIS CB HB2 sing N N 145 HIS CB HB3 sing N N 146 HIS CG ND1 sing Y N 147 HIS CG CD2 doub Y N 148 HIS ND1 CE1 doub Y N 149 HIS ND1 HD1 sing N N 150 HIS CD2 NE2 sing Y N 151 HIS CD2 HD2 sing N N 152 HIS CE1 NE2 sing Y N 153 HIS CE1 HE1 sing N N 154 HIS NE2 HE2 sing N N 155 HIS OXT HXT sing N N 156 HOH O H1 sing N N 157 HOH O H2 sing N N 158 ILE N CA sing N N 159 ILE N H sing N N 160 ILE N H2 sing N N 161 ILE CA C sing N N 162 ILE CA CB sing N N 163 ILE CA HA sing N N 164 ILE C O doub N N 165 ILE C OXT sing N N 166 ILE CB CG1 sing N N 167 ILE CB CG2 sing N N 168 ILE CB HB sing N N 169 ILE CG1 CD1 sing N N 170 ILE CG1 HG12 sing N N 171 ILE CG1 HG13 sing N N 172 ILE CG2 HG21 sing N N 173 ILE CG2 HG22 sing N N 174 ILE CG2 HG23 sing N N 175 ILE CD1 HD11 sing N N 176 ILE CD1 HD12 sing N N 177 ILE CD1 HD13 sing N N 178 ILE OXT HXT sing N N 179 LEU N CA sing N N 180 LEU N H sing N N 181 LEU N H2 sing N N 182 LEU CA C sing N N 183 LEU CA CB sing N N 184 LEU CA HA sing N N 185 LEU C O doub N N 186 LEU C OXT sing N N 187 LEU CB CG sing N N 188 LEU CB HB2 sing N N 189 LEU CB HB3 sing N N 190 LEU CG CD1 sing N N 191 LEU CG CD2 sing N N 192 LEU CG HG sing N N 193 LEU CD1 HD11 sing N N 194 LEU CD1 HD12 sing N N 195 LEU CD1 HD13 sing N N 196 LEU CD2 HD21 sing N N 197 LEU CD2 HD22 sing N N 198 LEU CD2 HD23 sing N N 199 LEU OXT HXT sing N N 200 LYS N CA sing N N 201 LYS N H sing N N 202 LYS N H2 sing N N 203 LYS CA C sing N N 204 LYS CA CB sing N N 205 LYS CA HA sing N N 206 LYS C O doub N N 207 LYS C OXT sing N N 208 LYS CB CG sing N N 209 LYS CB HB2 sing N N 210 LYS CB HB3 sing N N 211 LYS CG CD sing N N 212 LYS CG HG2 sing N N 213 LYS CG HG3 sing N N 214 LYS CD CE sing N N 215 LYS CD HD2 sing N N 216 LYS CD HD3 sing N N 217 LYS CE NZ sing N N 218 LYS CE HE2 sing N N 219 LYS CE HE3 sing N N 220 LYS NZ HZ1 sing N N 221 LYS NZ HZ2 sing N N 222 LYS NZ HZ3 sing N N 223 LYS OXT HXT sing N N 224 MET N CA sing N N 225 MET N H sing N N 226 MET N H2 sing N N 227 MET CA C sing N N 228 MET CA CB sing N N 229 MET CA HA sing N N 230 MET C O doub N N 231 MET C OXT sing N N 232 MET CB CG sing N N 233 MET CB HB2 sing N N 234 MET CB HB3 sing N N 235 MET CG SD sing N N 236 MET CG HG2 sing N N 237 MET CG HG3 sing N N 238 MET SD CE sing N N 239 MET CE HE1 sing N N 240 MET CE HE2 sing N N 241 MET CE HE3 sing N N 242 MET OXT HXT sing N N 243 PHE N CA sing N N 244 PHE N H sing N N 245 PHE N H2 sing N N 246 PHE CA C sing N N 247 PHE CA CB sing N N 248 PHE CA HA sing N N 249 PHE C O doub N N 250 PHE C OXT sing N N 251 PHE CB CG sing N N 252 PHE CB HB2 sing N N 253 PHE CB HB3 sing N N 254 PHE CG CD1 doub Y N 255 PHE CG CD2 sing Y N 256 PHE CD1 CE1 sing Y N 257 PHE CD1 HD1 sing N N 258 PHE CD2 CE2 doub Y N 259 PHE CD2 HD2 sing N N 260 PHE CE1 CZ doub Y N 261 PHE CE1 HE1 sing N N 262 PHE CE2 CZ sing Y N 263 PHE CE2 HE2 sing N N 264 PHE CZ HZ sing N N 265 PHE OXT HXT sing N N 266 PRO N CA sing N N 267 PRO N CD sing N N 268 PRO N H sing N N 269 PRO CA C sing N N 270 PRO CA CB sing N N 271 PRO CA HA sing N N 272 PRO C O doub N N 273 PRO C OXT sing N N 274 PRO CB CG sing N N 275 PRO CB HB2 sing N N 276 PRO CB HB3 sing N N 277 PRO CG CD sing N N 278 PRO CG HG2 sing N N 279 PRO CG HG3 sing N N 280 PRO CD HD2 sing N N 281 PRO CD HD3 sing N N 282 PRO OXT HXT sing N N 283 SER N CA sing N N 284 SER N H sing N N 285 SER N H2 sing N N 286 SER CA C sing N N 287 SER CA CB sing N N 288 SER CA HA sing N N 289 SER C O doub N N 290 SER C OXT sing N N 291 SER CB OG sing N N 292 SER CB HB2 sing N N 293 SER CB HB3 sing N N 294 SER OG HG sing N N 295 SER OXT HXT sing N N 296 THR N CA sing N N 297 THR N H sing N N 298 THR N H2 sing N N 299 THR CA C sing N N 300 THR CA CB sing N N 301 THR CA HA sing N N 302 THR C O doub N N 303 THR C OXT sing N N 304 THR CB OG1 sing N N 305 THR CB CG2 sing N N 306 THR CB HB sing N N 307 THR OG1 HG1 sing N N 308 THR CG2 HG21 sing N N 309 THR CG2 HG22 sing N N 310 THR CG2 HG23 sing N N 311 THR OXT HXT sing N N 312 TRP N CA sing N N 313 TRP N H sing N N 314 TRP N H2 sing N N 315 TRP CA C sing N N 316 TRP CA CB sing N N 317 TRP CA HA sing N N 318 TRP C O doub N N 319 TRP C OXT sing N N 320 TRP CB CG sing N N 321 TRP CB HB2 sing N N 322 TRP CB HB3 sing N N 323 TRP CG CD1 doub Y N 324 TRP CG CD2 sing Y N 325 TRP CD1 NE1 sing Y N 326 TRP CD1 HD1 sing N N 327 TRP CD2 CE2 doub Y N 328 TRP CD2 CE3 sing Y N 329 TRP NE1 CE2 sing Y N 330 TRP NE1 HE1 sing N N 331 TRP CE2 CZ2 sing Y N 332 TRP CE3 CZ3 doub Y N 333 TRP CE3 HE3 sing N N 334 TRP CZ2 CH2 doub Y N 335 TRP CZ2 HZ2 sing N N 336 TRP CZ3 CH2 sing Y N 337 TRP CZ3 HZ3 sing N N 338 TRP CH2 HH2 sing N N 339 TRP OXT HXT sing N N 340 TYR N CA sing N N 341 TYR N H sing N N 342 TYR N H2 sing N N 343 TYR CA C sing N N 344 TYR CA CB sing N N 345 TYR CA HA sing N N 346 TYR C O doub N N 347 TYR C OXT sing N N 348 TYR CB CG sing N N 349 TYR CB HB2 sing N N 350 TYR CB HB3 sing N N 351 TYR CG CD1 doub Y N 352 TYR CG CD2 sing Y N 353 TYR CD1 CE1 sing Y N 354 TYR CD1 HD1 sing N N 355 TYR CD2 CE2 doub Y N 356 TYR CD2 HD2 sing N N 357 TYR CE1 CZ doub Y N 358 TYR CE1 HE1 sing N N 359 TYR CE2 CZ sing Y N 360 TYR CE2 HE2 sing N N 361 TYR CZ OH sing N N 362 TYR OH HH sing N N 363 TYR OXT HXT sing N N 364 VAL N CA sing N N 365 VAL N H sing N N 366 VAL N H2 sing N N 367 VAL CA C sing N N 368 VAL CA CB sing N N 369 VAL CA HA sing N N 370 VAL C O doub N N 371 VAL C OXT sing N N 372 VAL CB CG1 sing N N 373 VAL CB CG2 sing N N 374 VAL CB HB sing N N 375 VAL CG1 HG11 sing N N 376 VAL CG1 HG12 sing N N 377 VAL CG1 HG13 sing N N 378 VAL CG2 HG21 sing N N 379 VAL CG2 HG22 sing N N 380 VAL CG2 HG23 sing N N 381 VAL OXT HXT sing N N 382 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 21K07050 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'ZINC ION' ZN 4 'ethyl 4-bromanyl-5-nitro-furan-2-carboxylate' E6I 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3QIN _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #