data_7XMW # _entry.id 7XMW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XMW pdb_00007xmw 10.2210/pdb7xmw/pdb WWPDB D_1300029207 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XMW _pdbx_database_status.recvd_initial_deposition_date 2022-04-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yan, X.' 1 ? 'Li, X.' 2 ? 'Song, G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 612 _citation.language ? _citation.page_first 84 _citation.page_last 90 _citation.title 'Structure of AcrVIA2 and its binding mechanism to CRISPR-Cas13a.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2022.04.091 _citation.pdbx_database_id_PubMed 35512461 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, G.' 1 ? primary 'Li, X.' 2 ? primary 'Wang, Z.' 3 ? primary 'Dong, C.' 4 ? primary 'Xie, X.' 5 ? primary 'Yan, X.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7XMW _cell.details ? _cell.formula_units_Z ? _cell.length_a 123.377 _cell.length_a_esd ? _cell.length_b 123.377 _cell.length_b_esd ? _cell.length_c 123.377 _cell.length_c_esd ? _cell.volume 1878030.398 _cell.volume_esd ? _cell.Z_PDB 48 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7XMW _symmetry.cell_setting ? _symmetry.Int_Tables_number 207 _symmetry.space_group_name_Hall 'P 4 2 3' _symmetry.space_group_name_H-M 'P 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man AcrVIA2 8352.190 2 ? ? ? ? 2 non-polymer syn '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 354.436 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn 'SELENIUM ATOM' 78.960 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code HHHHHAMWKCKKCGCDRFYQDITGGISEVLEMDKDGEVLDEIDDVEYGDFSCAKCDNSSSKIQEIAYWDEIN _entity_poly.pdbx_seq_one_letter_code_can HHHHHAMWKCKKCGCDRFYQDITGGISEVLEMDKDGEVLDEIDDVEYGDFSCAKCDNSSSKIQEIAYWDEIN _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 ALA n 1 7 MET n 1 8 TRP n 1 9 LYS n 1 10 CYS n 1 11 LYS n 1 12 LYS n 1 13 CYS n 1 14 GLY n 1 15 CYS n 1 16 ASP n 1 17 ARG n 1 18 PHE n 1 19 TYR n 1 20 GLN n 1 21 ASP n 1 22 ILE n 1 23 THR n 1 24 GLY n 1 25 GLY n 1 26 ILE n 1 27 SER n 1 28 GLU n 1 29 VAL n 1 30 LEU n 1 31 GLU n 1 32 MET n 1 33 ASP n 1 34 LYS n 1 35 ASP n 1 36 GLY n 1 37 GLU n 1 38 VAL n 1 39 LEU n 1 40 ASP n 1 41 GLU n 1 42 ILE n 1 43 ASP n 1 44 ASP n 1 45 VAL n 1 46 GLU n 1 47 TYR n 1 48 GLY n 1 49 ASP n 1 50 PHE n 1 51 SER n 1 52 CYS n 1 53 ALA n 1 54 LYS n 1 55 CYS n 1 56 ASP n 1 57 ASN n 1 58 SER n 1 59 SER n 1 60 SER n 1 61 LYS n 1 62 ILE n 1 63 GLN n 1 64 GLU n 1 65 ILE n 1 66 ALA n 1 67 TYR n 1 68 TRP n 1 69 ASP n 1 70 GLU n 1 71 ILE n 1 72 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 72 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HMPREF9015_01064 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain F0279 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Leptotrichia wadei (strain F0279)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 888055 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code U2Q5N5_LEPWF _struct_ref.pdbx_db_accession U2Q5N5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MWKCKKCGCDRFYQDITGGISEVLEMDKDGEVLDEIDDVEYGDFSCAKCDNSSSKIQEIAYWDEIN _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7XMW A 7 ? 72 ? U2Q5N5 1 ? 66 ? 1 66 2 1 7XMW B 7 ? 72 ? U2Q5N5 1 ? 66 ? 1 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XMW HIS A 1 ? UNP U2Q5N5 ? ? 'expression tag' -5 1 1 7XMW HIS A 2 ? UNP U2Q5N5 ? ? 'expression tag' -4 2 1 7XMW HIS A 3 ? UNP U2Q5N5 ? ? 'expression tag' -3 3 1 7XMW HIS A 4 ? UNP U2Q5N5 ? ? 'expression tag' -2 4 1 7XMW HIS A 5 ? UNP U2Q5N5 ? ? 'expression tag' -1 5 1 7XMW ALA A 6 ? UNP U2Q5N5 ? ? 'expression tag' 0 6 2 7XMW HIS B 1 ? UNP U2Q5N5 ? ? 'expression tag' -5 7 2 7XMW HIS B 2 ? UNP U2Q5N5 ? ? 'expression tag' -4 8 2 7XMW HIS B 3 ? UNP U2Q5N5 ? ? 'expression tag' -3 9 2 7XMW HIS B 4 ? UNP U2Q5N5 ? ? 'expression tag' -2 10 2 7XMW HIS B 5 ? UNP U2Q5N5 ? ? 'expression tag' -1 11 2 7XMW ALA B 6 ? UNP U2Q5N5 ? ? 'expression tag' 0 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PE4 non-polymer . '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 'POLYETHYLENE GLYCOL PEG4000' 'C16 H34 O8' 354.436 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SE non-polymer . 'SELENIUM ATOM' ? Se 78.960 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XMW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 74.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIQUID DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'TRIS hydrochloride, ammonium phosphate monobasic' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-05-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 84.03 _reflns.entry_id 7XMW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.59 _reflns.d_resolution_low 41.13 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9880 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.89 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 51.14 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.59 _reflns_shell.d_res_low 2.683 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 535 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.733 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 95.43 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XMW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.59 _refine.ls_d_res_low 41.13 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9855 _refine.ls_number_reflns_R_free 444 _refine.ls_number_reflns_R_work 9411 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.00 _refine.ls_percent_reflns_R_free 4.51 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2543 _refine.ls_R_factor_R_free 0.3067 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2522 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.2511 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3927 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.59 _refine_hist.d_res_low 41.13 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1153 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1102 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 51 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0130 ? 1171 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0774 ? 1563 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0497 ? 156 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0054 ? 201 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.1356 ? 190 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.59 2.96 . . 127 2672 81.53 . . . 0.3432 . 0.3289 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.96 3.73 . . 167 3301 99.97 . . . 0.3194 . 0.2916 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.73 41.13 . . 150 3438 97.10 . . . 0.2964 . 0.2315 . . . . . . . . . . . # _struct.entry_id 7XMW _struct.title 'Crystal structure of anti-CRISPR protein AcrVIA2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XMW _struct_keywords.text 'a bacteria antiviral protein, ANTIVIRAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIVIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 2 ? F N N 3 ? G N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 61 ? ILE A 65 ? LYS A 55 ILE A 59 1 ? 5 HELX_P HELX_P2 AA2 LYS B 61 ? ILE B 65 ? LYS B 55 ILE B 59 1 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? B CYS 13 SG ? ? ? 1_555 B CYS 55 SG ? ? B CYS 7 B CYS 49 1_555 ? ? ? ? ? ? ? 2.711 ? ? metalc1 metalc ? ? A CYS 10 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 4 A ZN 102 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc2 metalc ? ? A CYS 13 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 7 A ZN 102 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc3 metalc ? ? A CYS 52 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 46 A ZN 102 1_555 ? ? ? ? ? ? ? 2.228 ? ? metalc4 metalc ? ? A CYS 55 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 49 A ZN 102 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc5 metalc ? ? B CYS 10 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 4 B ZN 102 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc6 metalc ? ? B CYS 13 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 7 B ZN 102 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc7 metalc ? ? B CYS 52 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 46 B ZN 102 1_555 ? ? ? ? ? ? ? 2.308 ? ? metalc8 metalc ? ? B CYS 55 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 49 B ZN 102 1_555 ? ? ? ? ? ? ? 2.318 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 5 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 6 ? CYS A 10 ? ALA A 0 CYS A 4 AA1 2 ALA A 66 ? GLU A 70 ? ALA A 60 GLU A 64 AA2 1 VAL A 38 ? CYS A 52 ? VAL A 32 CYS A 46 AA2 2 PHE A 18 ? MET A 32 ? PHE A 12 MET A 26 AA2 3 ILE B 26 ? MET B 32 ? ILE B 20 MET B 26 AA2 4 VAL B 38 ? ASP B 44 ? VAL B 32 ASP B 38 AA3 1 VAL A 38 ? CYS A 52 ? VAL A 32 CYS A 46 AA3 2 PHE A 18 ? MET A 32 ? PHE A 12 MET A 26 AA3 3 PHE B 18 ? ILE B 22 ? PHE B 12 ILE B 16 AA3 4 TYR B 47 ? CYS B 52 ? TYR B 41 CYS B 46 AA3 5 SER B 58 ? SER B 59 ? SER B 52 SER B 53 AA4 1 TRP B 8 ? CYS B 10 ? TRP B 2 CYS B 4 AA4 2 ALA B 66 ? TRP B 68 ? ALA B 60 TRP B 62 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 7 ? N MET A 1 O ASP A 69 ? O ASP A 63 AA2 1 2 O GLY A 48 ? O GLY A 42 N ASP A 21 ? N ASP A 15 AA2 2 3 N GLN A 20 ? N GLN A 14 O SER B 27 ? O SER B 21 AA2 3 4 N GLU B 31 ? N GLU B 25 O LEU B 39 ? O LEU B 33 AA3 1 2 O GLY A 48 ? O GLY A 42 N ASP A 21 ? N ASP A 15 AA3 2 3 N SER A 27 ? N SER A 21 O GLN B 20 ? O GLN B 14 AA3 3 4 N ASP B 21 ? N ASP B 15 O GLY B 48 ? O GLY B 42 AA3 4 5 N PHE B 50 ? N PHE B 44 O SER B 59 ? O SER B 53 AA4 1 2 N LYS B 9 ? N LYS B 3 O TYR B 67 ? O TYR B 61 # _atom_sites.entry_id 7XMW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008105 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008105 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008105 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -5 ? ? ? A . n A 1 2 HIS 2 -4 -4 HIS HIS A . n A 1 3 HIS 3 -3 -3 HIS HIS A . n A 1 4 HIS 4 -2 -2 HIS HIS A . n A 1 5 HIS 5 -1 -1 HIS HIS A . n A 1 6 ALA 6 0 0 ALA ALA A . n A 1 7 MET 7 1 1 MET MET A . n A 1 8 TRP 8 2 2 TRP TRP A . n A 1 9 LYS 9 3 3 LYS LYS A . n A 1 10 CYS 10 4 4 CYS CYS A . n A 1 11 LYS 11 5 5 LYS LYS A . n A 1 12 LYS 12 6 6 LYS LYS A . n A 1 13 CYS 13 7 7 CYS CYS A . n A 1 14 GLY 14 8 8 GLY GLY A . n A 1 15 CYS 15 9 9 CYS CYS A . n A 1 16 ASP 16 10 10 ASP ASP A . n A 1 17 ARG 17 11 11 ARG ARG A . n A 1 18 PHE 18 12 12 PHE PHE A . n A 1 19 TYR 19 13 13 TYR TYR A . n A 1 20 GLN 20 14 14 GLN GLN A . n A 1 21 ASP 21 15 15 ASP ASP A . n A 1 22 ILE 22 16 16 ILE ILE A . n A 1 23 THR 23 17 17 THR THR A . n A 1 24 GLY 24 18 18 GLY GLY A . n A 1 25 GLY 25 19 19 GLY GLY A . n A 1 26 ILE 26 20 20 ILE ILE A . n A 1 27 SER 27 21 21 SER SER A . n A 1 28 GLU 28 22 22 GLU GLU A . n A 1 29 VAL 29 23 23 VAL VAL A . n A 1 30 LEU 30 24 24 LEU LEU A . n A 1 31 GLU 31 25 25 GLU GLU A . n A 1 32 MET 32 26 26 MET MET A . n A 1 33 ASP 33 27 27 ASP ASP A . n A 1 34 LYS 34 28 28 LYS LYS A . n A 1 35 ASP 35 29 29 ASP ASP A . n A 1 36 GLY 36 30 30 GLY GLY A . n A 1 37 GLU 37 31 31 GLU GLU A . n A 1 38 VAL 38 32 32 VAL VAL A . n A 1 39 LEU 39 33 33 LEU LEU A . n A 1 40 ASP 40 34 34 ASP ASP A . n A 1 41 GLU 41 35 35 GLU GLU A . n A 1 42 ILE 42 36 36 ILE ILE A . n A 1 43 ASP 43 37 37 ASP ASP A . n A 1 44 ASP 44 38 38 ASP ASP A . n A 1 45 VAL 45 39 39 VAL VAL A . n A 1 46 GLU 46 40 40 GLU GLU A . n A 1 47 TYR 47 41 41 TYR TYR A . n A 1 48 GLY 48 42 42 GLY GLY A . n A 1 49 ASP 49 43 43 ASP ASP A . n A 1 50 PHE 50 44 44 PHE PHE A . n A 1 51 SER 51 45 45 SER SER A . n A 1 52 CYS 52 46 46 CYS CYS A . n A 1 53 ALA 53 47 47 ALA ALA A . n A 1 54 LYS 54 48 48 LYS LYS A . n A 1 55 CYS 55 49 49 CYS CYS A . n A 1 56 ASP 56 50 50 ASP ASP A . n A 1 57 ASN 57 51 51 ASN ASN A . n A 1 58 SER 58 52 52 SER SER A . n A 1 59 SER 59 53 53 SER SER A . n A 1 60 SER 60 54 54 SER SER A . n A 1 61 LYS 61 55 55 LYS LYS A . n A 1 62 ILE 62 56 56 ILE ILE A . n A 1 63 GLN 63 57 57 GLN GLN A . n A 1 64 GLU 64 58 58 GLU GLU A . n A 1 65 ILE 65 59 59 ILE ILE A . n A 1 66 ALA 66 60 60 ALA ALA A . n A 1 67 TYR 67 61 61 TYR TYR A . n A 1 68 TRP 68 62 62 TRP TRP A . n A 1 69 ASP 69 63 63 ASP ASP A . n A 1 70 GLU 70 64 64 GLU GLU A . n A 1 71 ILE 71 65 65 ILE ILE A . n A 1 72 ASN 72 66 ? ? ? A . n B 1 1 HIS 1 -5 -5 HIS HIS B . n B 1 2 HIS 2 -4 -4 HIS ALA B . n B 1 3 HIS 3 -3 -3 HIS HIS B . n B 1 4 HIS 4 -2 -2 HIS HIS B . n B 1 5 HIS 5 -1 -1 HIS ALA B . n B 1 6 ALA 6 0 0 ALA ALA B . n B 1 7 MET 7 1 1 MET MET B . n B 1 8 TRP 8 2 2 TRP TRP B . n B 1 9 LYS 9 3 3 LYS LYS B . n B 1 10 CYS 10 4 4 CYS CYS B . n B 1 11 LYS 11 5 5 LYS LYS B . n B 1 12 LYS 12 6 6 LYS LYS B . n B 1 13 CYS 13 7 7 CYS CYS B . n B 1 14 GLY 14 8 8 GLY GLY B . n B 1 15 CYS 15 9 9 CYS CYS B . n B 1 16 ASP 16 10 10 ASP ASP B . n B 1 17 ARG 17 11 11 ARG ARG B . n B 1 18 PHE 18 12 12 PHE PHE B . n B 1 19 TYR 19 13 13 TYR TYR B . n B 1 20 GLN 20 14 14 GLN GLN B . n B 1 21 ASP 21 15 15 ASP ASP B . n B 1 22 ILE 22 16 16 ILE ILE B . n B 1 23 THR 23 17 17 THR THR B . n B 1 24 GLY 24 18 18 GLY GLY B . n B 1 25 GLY 25 19 19 GLY GLY B . n B 1 26 ILE 26 20 20 ILE ILE B . n B 1 27 SER 27 21 21 SER SER B . n B 1 28 GLU 28 22 22 GLU GLU B . n B 1 29 VAL 29 23 23 VAL VAL B . n B 1 30 LEU 30 24 24 LEU LEU B . n B 1 31 GLU 31 25 25 GLU GLU B . n B 1 32 MET 32 26 26 MET MET B . n B 1 33 ASP 33 27 27 ASP ASP B . n B 1 34 LYS 34 28 28 LYS LYS B . n B 1 35 ASP 35 29 29 ASP ASP B . n B 1 36 GLY 36 30 30 GLY GLY B . n B 1 37 GLU 37 31 31 GLU GLU B . n B 1 38 VAL 38 32 32 VAL VAL B . n B 1 39 LEU 39 33 33 LEU LEU B . n B 1 40 ASP 40 34 34 ASP ASP B . n B 1 41 GLU 41 35 35 GLU GLU B . n B 1 42 ILE 42 36 36 ILE ILE B . n B 1 43 ASP 43 37 37 ASP ASP B . n B 1 44 ASP 44 38 38 ASP ASP B . n B 1 45 VAL 45 39 39 VAL VAL B . n B 1 46 GLU 46 40 40 GLU GLU B . n B 1 47 TYR 47 41 41 TYR TYR B . n B 1 48 GLY 48 42 42 GLY GLY B . n B 1 49 ASP 49 43 43 ASP ASP B . n B 1 50 PHE 50 44 44 PHE PHE B . n B 1 51 SER 51 45 45 SER SER B . n B 1 52 CYS 52 46 46 CYS CYS B . n B 1 53 ALA 53 47 47 ALA ALA B . n B 1 54 LYS 54 48 48 LYS LYS B . n B 1 55 CYS 55 49 49 CYS CYS B . n B 1 56 ASP 56 50 50 ASP ASP B . n B 1 57 ASN 57 51 51 ASN ASN B . n B 1 58 SER 58 52 52 SER SER B . n B 1 59 SER 59 53 53 SER SER B . n B 1 60 SER 60 54 54 SER SER B . n B 1 61 LYS 61 55 55 LYS LYS B . n B 1 62 ILE 62 56 56 ILE ILE B . n B 1 63 GLN 63 57 57 GLN GLN B . n B 1 64 GLU 64 58 58 GLU GLU B . n B 1 65 ILE 65 59 59 ILE ILE B . n B 1 66 ALA 66 60 60 ALA ALA B . n B 1 67 TYR 67 61 61 TYR TYR B . n B 1 68 TRP 68 62 62 TRP TRP B . n B 1 69 ASP 69 63 63 ASP ASP B . n B 1 70 GLU 70 64 64 GLU GLU B . n B 1 71 ILE 71 65 65 ILE ILE B . n B 1 72 ASN 72 66 66 ASN ASN B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email xjyan@tmu.edu.cn _pdbx_contact_author.name_first Xiaojie _pdbx_contact_author.name_last Yan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5257-2148 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 PE4 1 101 101 PE4 PE4 A . D 3 ZN 1 102 1 ZN ZN A . E 2 PE4 1 101 101 PE4 PE4 B . F 3 ZN 1 102 2 ZN ZN B . G 4 SE 1 7 7 SE SE Z . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3120 ? 1 MORE -16 ? 1 'SSA (A^2)' 9200 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 10 ? A CYS 4 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 13 ? A CYS 7 ? 1_555 113.3 ? 2 SG ? A CYS 10 ? A CYS 4 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 52 ? A CYS 46 ? 1_555 102.6 ? 3 SG ? A CYS 13 ? A CYS 7 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 52 ? A CYS 46 ? 1_555 90.3 ? 4 SG ? A CYS 10 ? A CYS 4 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 55 ? A CYS 49 ? 1_555 107.0 ? 5 SG ? A CYS 13 ? A CYS 7 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 55 ? A CYS 49 ? 1_555 134.0 ? 6 SG ? A CYS 52 ? A CYS 46 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 SG ? A CYS 55 ? A CYS 49 ? 1_555 101.9 ? 7 SG ? B CYS 10 ? B CYS 4 ? 1_555 ZN ? F ZN . ? B ZN 102 ? 1_555 SG ? B CYS 13 ? B CYS 7 ? 1_555 141.7 ? 8 SG ? B CYS 10 ? B CYS 4 ? 1_555 ZN ? F ZN . ? B ZN 102 ? 1_555 SG ? B CYS 52 ? B CYS 46 ? 1_555 108.1 ? 9 SG ? B CYS 13 ? B CYS 7 ? 1_555 ZN ? F ZN . ? B ZN 102 ? 1_555 SG ? B CYS 52 ? B CYS 46 ? 1_555 101.8 ? 10 SG ? B CYS 10 ? B CYS 4 ? 1_555 ZN ? F ZN . ? B ZN 102 ? 1_555 SG ? B CYS 55 ? B CYS 49 ? 1_555 100.1 ? 11 SG ? B CYS 13 ? B CYS 7 ? 1_555 ZN ? F ZN . ? B ZN 102 ? 1_555 SG ? B CYS 55 ? B CYS 49 ? 1_555 71.8 ? 12 SG ? B CYS 52 ? B CYS 46 ? 1_555 ZN ? F ZN . ? B ZN 102 ? 1_555 SG ? B CYS 55 ? B CYS 49 ? 1_555 137.1 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-05-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-z,y 3 x,z,-y 4 z,y,-x 5 -z,y,x 6 -y,x,z 7 y,-x,z 8 z,x,y 9 y,z,x 10 -y,-z,x 11 z,-x,-y 12 -y,z,-x 13 -z,-x,y 14 -z,x,-y 15 y,-z,-x 16 x,-y,-z 17 -x,y,-z 18 -x,-y,z 19 y,x,-z 20 -y,-x,-z 21 z,-y,x 22 -z,-y,-x 23 -x,z,y 24 -x,-z,-y # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 32.6340708388 _pdbx_refine_tls.origin_y 35.9876254129 _pdbx_refine_tls.origin_z 11.8229401988 _pdbx_refine_tls.T[1][1] 0.840432064398 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.185756411963 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.10834436684 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.711559680182 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0979562363387 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.895263055368 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.627781849846 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0514807798229 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.314612595341 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] -0.802062106412 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.228744190033 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.214908386439 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0256016825218 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.040139473279 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0849607167623 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0561069212294 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0726463994477 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0804124848896 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0478012178062 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.039928560947 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.127094371327 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id -4 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id G _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id C _pdbx_refine_tls_group.end_auth_seq_id 2 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20_4459 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 7XMW _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 HH22 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 11 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 25 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 9_555 _pdbx_validate_symm_contact.dist 1.48 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 B _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 49 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 B _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 49 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.619 _pdbx_validate_rmsd_bond.bond_target_value 1.812 _pdbx_validate_rmsd_bond.bond_deviation -0.193 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.016 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 46 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 46 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 46 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.33 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 10.13 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A -2 ? ? 51.73 12.30 2 1 ALA A 0 ? ? 172.02 -162.54 3 1 HIS B -2 ? ? -144.87 19.29 4 1 ALA B 0 ? ? 177.16 -150.23 5 1 LYS B 48 ? ? -123.86 -67.36 6 1 ASP B 50 ? ? 82.84 8.45 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 28 ? CG ? A LYS 34 CG 2 1 Y 1 A LYS 28 ? CD ? A LYS 34 CD 3 1 Y 1 A LYS 28 ? CE ? A LYS 34 CE 4 1 Y 1 A LYS 28 ? NZ ? A LYS 34 NZ 5 1 Y 1 A GLU 31 ? CG ? A GLU 37 CG 6 1 Y 1 A GLU 31 ? CD ? A GLU 37 CD 7 1 Y 1 A GLU 31 ? OE1 ? A GLU 37 OE1 8 1 Y 1 A GLU 31 ? OE2 ? A GLU 37 OE2 9 1 Y 1 A LYS 48 ? CG ? A LYS 54 CG 10 1 Y 1 A LYS 48 ? CD ? A LYS 54 CD 11 1 Y 1 A LYS 48 ? CE ? A LYS 54 CE 12 1 Y 1 A LYS 48 ? NZ ? A LYS 54 NZ 13 1 Y 1 A LYS 55 ? CG ? A LYS 61 CG 14 1 Y 1 A LYS 55 ? CD ? A LYS 61 CD 15 1 Y 1 A LYS 55 ? CE ? A LYS 61 CE 16 1 Y 1 A LYS 55 ? NZ ? A LYS 61 NZ 17 1 Y 1 B HIS -4 ? CG ? B HIS 2 CG 18 1 Y 1 B HIS -4 ? ND1 ? B HIS 2 ND1 19 1 Y 1 B HIS -4 ? CD2 ? B HIS 2 CD2 20 1 Y 1 B HIS -4 ? CE1 ? B HIS 2 CE1 21 1 Y 1 B HIS -4 ? NE2 ? B HIS 2 NE2 22 1 Y 1 B HIS -1 ? CG ? B HIS 5 CG 23 1 Y 1 B HIS -1 ? ND1 ? B HIS 5 ND1 24 1 Y 1 B HIS -1 ? CD2 ? B HIS 5 CD2 25 1 Y 1 B HIS -1 ? CE1 ? B HIS 5 CE1 26 1 Y 1 B HIS -1 ? NE2 ? B HIS 5 NE2 27 1 Y 1 B GLU 25 ? CG ? B GLU 31 CG 28 1 Y 1 B GLU 25 ? CD ? B GLU 31 CD 29 1 Y 1 B GLU 25 ? OE1 ? B GLU 31 OE1 30 1 Y 1 B GLU 25 ? OE2 ? B GLU 31 OE2 31 1 Y 1 B LYS 28 ? CG ? B LYS 34 CG 32 1 Y 1 B LYS 28 ? CD ? B LYS 34 CD 33 1 Y 1 B LYS 28 ? CE ? B LYS 34 CE 34 1 Y 1 B LYS 28 ? NZ ? B LYS 34 NZ 35 1 Y 1 B GLU 31 ? CG ? B GLU 37 CG 36 1 Y 1 B GLU 31 ? CD ? B GLU 37 CD 37 1 Y 1 B GLU 31 ? OE1 ? B GLU 37 OE1 38 1 Y 1 B GLU 31 ? OE2 ? B GLU 37 OE2 39 1 Y 1 B LYS 48 ? CG ? B LYS 54 CG 40 1 Y 1 B LYS 48 ? CD ? B LYS 54 CD 41 1 Y 1 B LYS 48 ? CE ? B LYS 54 CE 42 1 Y 1 B LYS 48 ? NZ ? B LYS 54 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS -5 ? A HIS 1 2 1 Y 1 A ASN 66 ? A ASN 72 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' PE4 3 'ZINC ION' ZN 4 'SELENIUM ATOM' SE # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 4 3 2' _space_group.name_Hall 'P 4 2 3' _space_group.IT_number 207 _space_group.crystal_system cubic _space_group.id 1 #