data_7XP9 # _entry.id 7XP9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XP9 pdb_00007xp9 10.2210/pdb7xp9/pdb WWPDB D_1300027435 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-07 2 'Structure model' 1 1 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XP9 _pdbx_database_status.recvd_initial_deposition_date 2022-05-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email weimanxing@shnu.edu.cn _pdbx_contact_author.name_first Weiman _pdbx_contact_author.name_last Xing _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6238-0075 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xing, W.' 1 0000-0002-6238-0075 'Hu, Q.' 2 0000-0001-6706-7347 'Zhou, J.' 3 0000-0002-3454-1927 'Yao, D.' 4 0000-0003-4881-265X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Chloroplast Protein GLYK Hijacked by Phytophthora Infestans Effector AVRvnt1 in Cytoplasm to Activate NLR' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xing, W.' 1 0000-0002-6238-0075 primary 'Hu, Q.' 2 0000-0001-6706-7347 primary 'Zhou, J.' 3 0000-0002-3454-1927 primary 'Yao, D.' 4 0000-0003-4881-265X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RxLR effector protein Avr-vnt11' 9581.048 1 ? ? ? ? 2 water nat water 18.015 50 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Avirulence protein Avr-vnt1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STQNLGNSLMRVFSKEATRKYYLDLFKRADFTANLPKLAKKGGPDRLNDALKKLRKAGISEEKFAELKGAAAKYADDWYR IYGK ; _entity_poly.pdbx_seq_one_letter_code_can ;STQNLGNSLMRVFSKEATRKYYLDLFKRADFTANLPKLAKKGGPDRLNDALKKLRKAGISEEKFAELKGAAAKYADDWYR IYGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 GLN n 1 4 ASN n 1 5 LEU n 1 6 GLY n 1 7 ASN n 1 8 SER n 1 9 LEU n 1 10 MET n 1 11 ARG n 1 12 VAL n 1 13 PHE n 1 14 SER n 1 15 LYS n 1 16 GLU n 1 17 ALA n 1 18 THR n 1 19 ARG n 1 20 LYS n 1 21 TYR n 1 22 TYR n 1 23 LEU n 1 24 ASP n 1 25 LEU n 1 26 PHE n 1 27 LYS n 1 28 ARG n 1 29 ALA n 1 30 ASP n 1 31 PHE n 1 32 THR n 1 33 ALA n 1 34 ASN n 1 35 LEU n 1 36 PRO n 1 37 LYS n 1 38 LEU n 1 39 ALA n 1 40 LYS n 1 41 LYS n 1 42 GLY n 1 43 GLY n 1 44 PRO n 1 45 ASP n 1 46 ARG n 1 47 LEU n 1 48 ASN n 1 49 ASP n 1 50 ALA n 1 51 LEU n 1 52 LYS n 1 53 LYS n 1 54 LEU n 1 55 ARG n 1 56 LYS n 1 57 ALA n 1 58 GLY n 1 59 ILE n 1 60 SER n 1 61 GLU n 1 62 GLU n 1 63 LYS n 1 64 PHE n 1 65 ALA n 1 66 GLU n 1 67 LEU n 1 68 LYS n 1 69 GLY n 1 70 ALA n 1 71 ALA n 1 72 ALA n 1 73 LYS n 1 74 TYR n 1 75 ALA n 1 76 ASP n 1 77 ASP n 1 78 TRP n 1 79 TYR n 1 80 ARG n 1 81 ILE n 1 82 TYR n 1 83 GLY n 1 84 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 84 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Avr-vnt1, PITG_16294' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain T30-4 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Phytophthora infestans T30-4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 403677 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 64 ? ? ? A . n A 1 2 THR 2 65 ? ? ? A . n A 1 3 GLN 3 66 ? ? ? A . n A 1 4 ASN 4 67 ? ? ? A . n A 1 5 LEU 5 68 ? ? ? A . n A 1 6 GLY 6 69 ? ? ? A . n A 1 7 ASN 7 70 ? ? ? A . n A 1 8 SER 8 71 ? ? ? A . n A 1 9 LEU 9 72 72 LEU LEU A . n A 1 10 MET 10 73 73 MET MET A . n A 1 11 ARG 11 74 74 ARG ARG A . n A 1 12 VAL 12 75 75 VAL VAL A . n A 1 13 PHE 13 76 76 PHE PHE A . n A 1 14 SER 14 77 77 SER SER A . n A 1 15 LYS 15 78 78 LYS LYS A . n A 1 16 GLU 16 79 79 GLU GLU A . n A 1 17 ALA 17 80 80 ALA ALA A . n A 1 18 THR 18 81 81 THR THR A . n A 1 19 ARG 19 82 82 ARG ARG A . n A 1 20 LYS 20 83 83 LYS LYS A . n A 1 21 TYR 21 84 84 TYR TYR A . n A 1 22 TYR 22 85 85 TYR TYR A . n A 1 23 LEU 23 86 86 LEU LEU A . n A 1 24 ASP 24 87 87 ASP ASP A . n A 1 25 LEU 25 88 88 LEU LEU A . n A 1 26 PHE 26 89 89 PHE PHE A . n A 1 27 LYS 27 90 90 LYS LYS A . n A 1 28 ARG 28 91 91 ARG ARG A . n A 1 29 ALA 29 92 92 ALA ALA A . n A 1 30 ASP 30 93 93 ASP ASP A . n A 1 31 PHE 31 94 94 PHE PHE A . n A 1 32 THR 32 95 95 THR THR A . n A 1 33 ALA 33 96 96 ALA ALA A . n A 1 34 ASN 34 97 97 ASN ASN A . n A 1 35 LEU 35 98 98 LEU LEU A . n A 1 36 PRO 36 99 99 PRO PRO A . n A 1 37 LYS 37 100 100 LYS LYS A . n A 1 38 LEU 38 101 101 LEU LEU A . n A 1 39 ALA 39 102 102 ALA ALA A . n A 1 40 LYS 40 103 103 LYS LYS A . n A 1 41 LYS 41 104 104 LYS LYS A . n A 1 42 GLY 42 105 105 GLY GLY A . n A 1 43 GLY 43 106 106 GLY GLY A . n A 1 44 PRO 44 107 107 PRO PRO A . n A 1 45 ASP 45 108 108 ASP ASP A . n A 1 46 ARG 46 109 109 ARG ARG A . n A 1 47 LEU 47 110 110 LEU LEU A . n A 1 48 ASN 48 111 111 ASN ASN A . n A 1 49 ASP 49 112 112 ASP ASP A . n A 1 50 ALA 50 113 113 ALA ALA A . n A 1 51 LEU 51 114 114 LEU LEU A . n A 1 52 LYS 52 115 115 LYS LYS A . n A 1 53 LYS 53 116 116 LYS LYS A . n A 1 54 LEU 54 117 117 LEU LEU A . n A 1 55 ARG 55 118 118 ARG ARG A . n A 1 56 LYS 56 119 119 LYS LYS A . n A 1 57 ALA 57 120 120 ALA ALA A . n A 1 58 GLY 58 121 121 GLY GLY A . n A 1 59 ILE 59 122 122 ILE ILE A . n A 1 60 SER 60 123 123 SER SER A . n A 1 61 GLU 61 124 124 GLU GLU A . n A 1 62 GLU 62 125 125 GLU GLU A . n A 1 63 LYS 63 126 126 LYS LYS A . n A 1 64 PHE 64 127 127 PHE PHE A . n A 1 65 ALA 65 128 128 ALA ALA A . n A 1 66 GLU 66 129 129 GLU GLU A . n A 1 67 LEU 67 130 130 LEU LEU A . n A 1 68 LYS 68 131 131 LYS LYS A . n A 1 69 GLY 69 132 132 GLY GLY A . n A 1 70 ALA 70 133 133 ALA ALA A . n A 1 71 ALA 71 134 134 ALA ALA A . n A 1 72 ALA 72 135 135 ALA ALA A . n A 1 73 LYS 73 136 136 LYS LYS A . n A 1 74 TYR 74 137 137 TYR TYR A . n A 1 75 ALA 75 138 138 ALA ALA A . n A 1 76 ASP 76 139 139 ASP ASP A . n A 1 77 ASP 77 140 140 ASP ASP A . n A 1 78 TRP 78 141 141 TRP TRP A . n A 1 79 TYR 79 142 142 TYR TYR A . n A 1 80 ARG 80 143 143 ARG ARG A . n A 1 81 ILE 81 144 144 ILE ILE A . n A 1 82 TYR 82 145 145 TYR TYR A . n A 1 83 GLY 83 146 146 GLY GLY A . n A 1 84 LYS 84 147 147 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 42 HOH HOH A . B 2 HOH 2 202 8 HOH HOH A . B 2 HOH 3 203 26 HOH HOH A . B 2 HOH 4 204 31 HOH HOH A . B 2 HOH 5 205 36 HOH HOH A . B 2 HOH 6 206 46 HOH HOH A . B 2 HOH 7 207 25 HOH HOH A . B 2 HOH 8 208 9 HOH HOH A . B 2 HOH 9 209 3 HOH HOH A . B 2 HOH 10 210 23 HOH HOH A . B 2 HOH 11 211 22 HOH HOH A . B 2 HOH 12 212 34 HOH HOH A . B 2 HOH 13 213 5 HOH HOH A . B 2 HOH 14 214 2 HOH HOH A . B 2 HOH 15 215 15 HOH HOH A . B 2 HOH 16 216 14 HOH HOH A . B 2 HOH 17 217 4 HOH HOH A . B 2 HOH 18 218 7 HOH HOH A . B 2 HOH 19 219 32 HOH HOH A . B 2 HOH 20 220 29 HOH HOH A . B 2 HOH 21 221 40 HOH HOH A . B 2 HOH 22 222 6 HOH HOH A . B 2 HOH 23 223 19 HOH HOH A . B 2 HOH 24 224 27 HOH HOH A . B 2 HOH 25 225 1 HOH HOH A . B 2 HOH 26 226 28 HOH HOH A . B 2 HOH 27 227 35 HOH HOH A . B 2 HOH 28 228 44 HOH HOH A . B 2 HOH 29 229 11 HOH HOH A . B 2 HOH 30 230 43 HOH HOH A . B 2 HOH 31 231 17 HOH HOH A . B 2 HOH 32 232 30 HOH HOH A . B 2 HOH 33 233 24 HOH HOH A . B 2 HOH 34 234 13 HOH HOH A . B 2 HOH 35 235 47 HOH HOH A . B 2 HOH 36 236 18 HOH HOH A . B 2 HOH 37 237 21 HOH HOH A . B 2 HOH 38 238 10 HOH HOH A . B 2 HOH 39 239 41 HOH HOH A . B 2 HOH 40 240 38 HOH HOH A . B 2 HOH 41 241 39 HOH HOH A . B 2 HOH 42 242 49 HOH HOH A . B 2 HOH 43 243 33 HOH HOH A . B 2 HOH 44 244 20 HOH HOH A . B 2 HOH 45 245 16 HOH HOH A . B 2 HOH 46 246 50 HOH HOH A . B 2 HOH 47 247 12 HOH HOH A . B 2 HOH 48 248 45 HOH HOH A . B 2 HOH 49 249 37 HOH HOH A . B 2 HOH 50 250 48 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 74 ? CG ? A ARG 11 CG 2 1 Y 1 A ARG 74 ? CD ? A ARG 11 CD 3 1 Y 1 A ARG 74 ? NE ? A ARG 11 NE 4 1 Y 1 A ARG 74 ? CZ ? A ARG 11 CZ 5 1 Y 1 A ARG 74 ? NH1 ? A ARG 11 NH1 6 1 Y 1 A ARG 74 ? NH2 ? A ARG 11 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7XP9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.004 _cell.length_a_esd ? _cell.length_b 54.004 _cell.length_b_esd ? _cell.length_c 116.547 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7XP9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XP9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.56 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% w/v Polyethylene glycol 3,350, 0.1 M Bis-Tris pH 5.5 and 0.2 M Li2SO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 27.460 _reflns.entry_id 7XP9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.930 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14032 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 40.200 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.945 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all 0.010 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.930 1.960 ? ? ? ? ? ? 364 95.800 ? ? ? ? 0.165 ? ? ? ? ? ? ? ? 41.400 ? 1.877 ? ? 0.167 0.026 ? 1 1 0.997 ? ? ? ? ? ? ? ? ? ? 1.960 2.000 ? ? ? ? ? ? 387 96.300 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 43.100 ? 2.057 ? ? 0.145 0.022 ? 2 1 0.998 ? ? ? ? ? ? ? ? ? ? 2.000 2.040 ? ? ? ? ? ? 369 96.600 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 42.100 ? 2.298 ? ? 0.132 0.020 ? 3 1 0.998 ? ? ? ? ? ? ? ? ? ? 2.040 2.080 ? ? ? ? ? ? 390 96.100 ? ? ? ? 0.118 ? ? ? ? ? ? ? ? 41.900 ? 2.433 ? ? 0.119 0.018 ? 4 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.080 2.120 ? ? ? ? ? ? 370 96.600 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 42.200 ? 2.528 ? ? 0.107 0.016 ? 5 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.120 2.170 ? ? ? ? ? ? 390 96.800 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 42.300 ? 2.624 ? ? 0.101 0.015 ? 6 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.170 2.230 ? ? ? ? ? ? 377 96.900 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 41.500 ? 2.748 ? ? 0.092 0.014 ? 7 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.230 2.290 ? ? ? ? ? ? 383 96.500 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 41.700 ? 2.810 ? ? 0.084 0.013 ? 8 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.290 2.360 ? ? ? ? ? ? 389 97.200 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 41.700 ? 2.812 ? ? 0.079 0.012 ? 9 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.360 2.430 ? ? ? ? ? ? 380 96.700 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 41.500 ? 2.831 ? ? 0.077 0.012 ? 10 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.430 2.520 ? ? ? ? ? ? 391 98.000 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 40.900 ? 3.017 ? ? 0.073 0.012 ? 11 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.520 2.620 ? ? ? ? ? ? 394 97.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 41.000 ? 2.940 ? ? 0.071 0.011 ? 12 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.620 2.740 ? ? ? ? ? ? 405 97.800 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 41.000 ? 3.017 ? ? 0.067 0.010 ? 13 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.740 2.880 ? ? ? ? ? ? 390 97.700 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 41.000 ? 3.249 ? ? 0.063 0.010 ? 14 1 1.000 ? ? ? ? ? ? ? ? ? ? 2.880 3.060 ? ? ? ? ? ? 403 97.300 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 39.600 ? 3.372 ? ? 0.058 0.009 ? 15 1 1.000 ? ? ? ? ? ? ? ? ? ? 3.060 3.300 ? ? ? ? ? ? 398 98.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 39.900 ? 3.347 ? ? 0.056 0.009 ? 16 1 1.000 ? ? ? ? ? ? ? ? ? ? 3.300 3.630 ? ? ? ? ? ? 417 98.300 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 38.400 ? 3.697 ? ? 0.055 0.009 ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.630 4.160 ? ? ? ? ? ? 420 98.100 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 37.800 ? 3.733 ? ? 0.052 0.008 ? 18 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.160 5.240 ? ? ? ? ? ? 425 97.700 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 35.800 ? 3.518 ? ? 0.049 0.008 ? 19 1 1.000 ? ? ? ? ? ? ? ? ? ? 5.240 50.000 ? ? ? ? ? ? 466 92.600 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 31.300 ? 4.112 ? ? 0.051 0.009 ? 20 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 61.810 _refine.B_iso_mean 27.2077 _refine.B_iso_min 15.940 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XP9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9300 _refine.ls_d_res_low 36.4700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14032 _refine.ls_number_reflns_R_free 1407 _refine.ls_number_reflns_R_work 12625 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.1800 _refine.ls_percent_reflns_R_free 10.0300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2263 _refine.ls_R_factor_R_free 0.2629 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2222 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.400 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.1600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9300 _refine_hist.d_res_low 36.4700 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 663 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 76 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 28.93 _refine_hist.pdbx_number_atoms_protein 613 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9300 2.0000 1391 . 143 1248 97.0000 . . . 0.3222 0.0000 0.2597 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.0000 2.0800 1389 . 135 1254 97.0000 . . . 0.2881 0.0000 0.2256 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.0800 2.1700 1396 . 142 1254 98.0000 . . . 0.2396 0.0000 0.2217 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.1700 2.2900 1387 . 142 1245 98.0000 . . . 0.2485 0.0000 0.2318 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.2900 2.4300 1395 . 134 1261 98.0000 . . . 0.2696 0.0000 0.2308 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.4300 2.6200 1413 . 142 1271 99.0000 . . . 0.3445 0.0000 0.2526 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.6200 2.8800 1418 . 148 1270 99.0000 . . . 0.3084 0.0000 0.2567 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.8800 3.3000 1412 . 136 1276 99.0000 . . . 0.2764 0.0000 0.2193 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.3000 4.1500 1431 . 147 1284 99.0000 . . . 0.2102 0.0000 0.1956 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 4.1600 36.4700 1400 . 138 1262 98.0000 . . . 0.2507 0.0000 0.2100 . . . . . . . 10 . . . # _struct.entry_id 7XP9 _struct.title 'Phytophthora infesfans RxLR effector AVRvnt1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XP9 _struct_keywords.text 'RxLR effector, triggered plant immunity response, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AVNT1_PHYIT _struct_ref.pdbx_db_accession D0NTY1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;STQNLGNSLMRVFSKEATRKYYLDLFKRADFTANLPKLAKKGGPDRLNDALKKLRKAGISEEKFAELKGAAAKYADDWYR IYGK ; _struct_ref.pdbx_align_begin 64 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7XP9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D0NTY1 _struct_ref_seq.db_align_beg 64 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 64 _struct_ref_seq.pdbx_auth_seq_align_end 147 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5400 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 9 ? PHE A 31 ? LEU A 72 PHE A 94 1 ? 23 HELX_P HELX_P2 AA2 ASN A 34 ? LYS A 40 ? ASN A 97 LYS A 103 1 ? 7 HELX_P HELX_P3 AA3 ASP A 45 ? GLY A 58 ? ASP A 108 GLY A 121 1 ? 14 HELX_P HELX_P4 AA4 SER A 60 ? GLY A 83 ? SER A 123 GLY A 146 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 64 ? A SER 1 2 1 Y 1 A THR 65 ? A THR 2 3 1 Y 1 A GLN 66 ? A GLN 3 4 1 Y 1 A ASN 67 ? A ASN 4 5 1 Y 1 A LEU 68 ? A LEU 5 6 1 Y 1 A GLY 69 ? A GLY 6 7 1 Y 1 A ASN 70 ? A ASN 7 8 1 Y 1 A SER 71 ? A SER 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 PRO N N N N 238 PRO CA C N S 239 PRO C C N N 240 PRO O O N N 241 PRO CB C N N 242 PRO CG C N N 243 PRO CD C N N 244 PRO OXT O N N 245 PRO H H N N 246 PRO HA H N N 247 PRO HB2 H N N 248 PRO HB3 H N N 249 PRO HG2 H N N 250 PRO HG3 H N N 251 PRO HD2 H N N 252 PRO HD3 H N N 253 PRO HXT H N N 254 SER N N N N 255 SER CA C N S 256 SER C C N N 257 SER O O N N 258 SER CB C N N 259 SER OG O N N 260 SER OXT O N N 261 SER H H N N 262 SER H2 H N N 263 SER HA H N N 264 SER HB2 H N N 265 SER HB3 H N N 266 SER HG H N N 267 SER HXT H N N 268 THR N N N N 269 THR CA C N S 270 THR C C N N 271 THR O O N N 272 THR CB C N R 273 THR OG1 O N N 274 THR CG2 C N N 275 THR OXT O N N 276 THR H H N N 277 THR H2 H N N 278 THR HA H N N 279 THR HB H N N 280 THR HG1 H N N 281 THR HG21 H N N 282 THR HG22 H N N 283 THR HG23 H N N 284 THR HXT H N N 285 TRP N N N N 286 TRP CA C N S 287 TRP C C N N 288 TRP O O N N 289 TRP CB C N N 290 TRP CG C Y N 291 TRP CD1 C Y N 292 TRP CD2 C Y N 293 TRP NE1 N Y N 294 TRP CE2 C Y N 295 TRP CE3 C Y N 296 TRP CZ2 C Y N 297 TRP CZ3 C Y N 298 TRP CH2 C Y N 299 TRP OXT O N N 300 TRP H H N N 301 TRP H2 H N N 302 TRP HA H N N 303 TRP HB2 H N N 304 TRP HB3 H N N 305 TRP HD1 H N N 306 TRP HE1 H N N 307 TRP HE3 H N N 308 TRP HZ2 H N N 309 TRP HZ3 H N N 310 TRP HH2 H N N 311 TRP HXT H N N 312 TYR N N N N 313 TYR CA C N S 314 TYR C C N N 315 TYR O O N N 316 TYR CB C N N 317 TYR CG C Y N 318 TYR CD1 C Y N 319 TYR CD2 C Y N 320 TYR CE1 C Y N 321 TYR CE2 C Y N 322 TYR CZ C Y N 323 TYR OH O N N 324 TYR OXT O N N 325 TYR H H N N 326 TYR H2 H N N 327 TYR HA H N N 328 TYR HB2 H N N 329 TYR HB3 H N N 330 TYR HD1 H N N 331 TYR HD2 H N N 332 TYR HE1 H N N 333 TYR HE2 H N N 334 TYR HH H N N 335 TYR HXT H N N 336 VAL N N N N 337 VAL CA C N S 338 VAL C C N N 339 VAL O O N N 340 VAL CB C N N 341 VAL CG1 C N N 342 VAL CG2 C N N 343 VAL OXT O N N 344 VAL H H N N 345 VAL H2 H N N 346 VAL HA H N N 347 VAL HB H N N 348 VAL HG11 H N N 349 VAL HG12 H N N 350 VAL HG13 H N N 351 VAL HG21 H N N 352 VAL HG22 H N N 353 VAL HG23 H N N 354 VAL HXT H N N 355 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TRP N CA sing N N 272 TRP N H sing N N 273 TRP N H2 sing N N 274 TRP CA C sing N N 275 TRP CA CB sing N N 276 TRP CA HA sing N N 277 TRP C O doub N N 278 TRP C OXT sing N N 279 TRP CB CG sing N N 280 TRP CB HB2 sing N N 281 TRP CB HB3 sing N N 282 TRP CG CD1 doub Y N 283 TRP CG CD2 sing Y N 284 TRP CD1 NE1 sing Y N 285 TRP CD1 HD1 sing N N 286 TRP CD2 CE2 doub Y N 287 TRP CD2 CE3 sing Y N 288 TRP NE1 CE2 sing Y N 289 TRP NE1 HE1 sing N N 290 TRP CE2 CZ2 sing Y N 291 TRP CE3 CZ3 doub Y N 292 TRP CE3 HE3 sing N N 293 TRP CZ2 CH2 doub Y N 294 TRP CZ2 HZ2 sing N N 295 TRP CZ3 CH2 sing Y N 296 TRP CZ3 HZ3 sing N N 297 TRP CH2 HH2 sing N N 298 TRP OXT HXT sing N N 299 TYR N CA sing N N 300 TYR N H sing N N 301 TYR N H2 sing N N 302 TYR CA C sing N N 303 TYR CA CB sing N N 304 TYR CA HA sing N N 305 TYR C O doub N N 306 TYR C OXT sing N N 307 TYR CB CG sing N N 308 TYR CB HB2 sing N N 309 TYR CB HB3 sing N N 310 TYR CG CD1 doub Y N 311 TYR CG CD2 sing Y N 312 TYR CD1 CE1 sing Y N 313 TYR CD1 HD1 sing N N 314 TYR CD2 CE2 doub Y N 315 TYR CD2 HD2 sing N N 316 TYR CE1 CZ doub Y N 317 TYR CE1 HE1 sing N N 318 TYR CE2 CZ sing Y N 319 TYR CE2 HE2 sing N N 320 TYR CZ OH sing N N 321 TYR OH HH sing N N 322 TYR OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description ? _pdbx_serial_crystallography_sample_delivery.method 'fixed target' # _atom_sites.entry_id 7XP9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018517 _atom_sites.fract_transf_matrix[1][2] 0.010691 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021382 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008580 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_