data_7XXT # _entry.id 7XXT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XXT pdb_00007xxt 10.2210/pdb7xxt/pdb WWPDB D_1300029589 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XXT _pdbx_database_status.recvd_initial_deposition_date 2022-05-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Basu Choudhury, G.' 1 0000-0003-4574-8867 'Chaudhari, V.' 2 ? 'Ray Chaudhuri, S.' 3 ? 'Datta, S.' 4 0000-0002-3638-9383 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.J.Biol.Macromol. _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 0141-8130 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 233 _citation.language ? _citation.page_first 123495 _citation.page_last 123495 _citation.title ;Diversity in the ligand binding pocket of HapR attributes to its uniqueness towards several inhibitors with respect to other homologues - A structural and molecular perspective. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2023.123495 _citation.pdbx_database_id_PubMed 36739058 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sen, H.' 1 ? primary 'Choudhury, G.B.' 2 ? primary 'Pawar, G.' 3 ? primary 'Sharma, Y.' 4 ? primary 'Bhalerao, S.E.' 5 ? primary 'Chaudhari, V.D.' 6 ? primary 'Datta, S.' 7 ? primary 'Raychaudhuri, S.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7XXT _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.987 _cell.length_a_esd ? _cell.length_b 44.953 _cell.length_b_esd ? _cell.length_c 53.573 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7XXT _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hemagglutinin/protease regulatory protein' 23648.334 1 ? 'Y76F, L97I, I141V, F171C' ? ? 2 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 3 non-polymer syn '1-((5-phenylthiophen-2-yl)sulfonyl)-1H-pyrazole' 290.361 1 ? ? ? ? 4 water nat water 18.015 33 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TetR/AcrR family transcriptional regulator' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDASIEKRPRTRLSPQKRKLQLMEIALEVFAKRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDDVLNFVVRQFSNFL TDHIDLDLDVKTNLQTICKEMVKLAMTDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLVRNMFMKAMERGELCEKHDV DNMASLFHGICYSIFLQVNRLGEQEAVYKLADSYLNMLCIYKN ; _entity_poly.pdbx_seq_one_letter_code_can ;MDASIEKRPRTRLSPQKRKLQLMEIALEVFAKRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDDVLNFVVRQFSNFL TDHIDLDLDVKTNLQTICKEMVKLAMTDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLVRNMFMKAMERGELCEKHDV DNMASLFHGICYSIFLQVNRLGEQEAVYKLADSYLNMLCIYKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ALA n 1 4 SER n 1 5 ILE n 1 6 GLU n 1 7 LYS n 1 8 ARG n 1 9 PRO n 1 10 ARG n 1 11 THR n 1 12 ARG n 1 13 LEU n 1 14 SER n 1 15 PRO n 1 16 GLN n 1 17 LYS n 1 18 ARG n 1 19 LYS n 1 20 LEU n 1 21 GLN n 1 22 LEU n 1 23 MET n 1 24 GLU n 1 25 ILE n 1 26 ALA n 1 27 LEU n 1 28 GLU n 1 29 VAL n 1 30 PHE n 1 31 ALA n 1 32 LYS n 1 33 ARG n 1 34 GLY n 1 35 ILE n 1 36 GLY n 1 37 ARG n 1 38 GLY n 1 39 GLY n 1 40 HIS n 1 41 ALA n 1 42 ASP n 1 43 ILE n 1 44 ALA n 1 45 GLU n 1 46 ILE n 1 47 ALA n 1 48 GLN n 1 49 VAL n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 THR n 1 54 VAL n 1 55 PHE n 1 56 ASN n 1 57 TYR n 1 58 PHE n 1 59 PRO n 1 60 THR n 1 61 ARG n 1 62 GLU n 1 63 ASP n 1 64 LEU n 1 65 VAL n 1 66 ASP n 1 67 ASP n 1 68 VAL n 1 69 LEU n 1 70 ASN n 1 71 PHE n 1 72 VAL n 1 73 VAL n 1 74 ARG n 1 75 GLN n 1 76 PHE n 1 77 SER n 1 78 ASN n 1 79 PHE n 1 80 LEU n 1 81 THR n 1 82 ASP n 1 83 HIS n 1 84 ILE n 1 85 ASP n 1 86 LEU n 1 87 ASP n 1 88 LEU n 1 89 ASP n 1 90 VAL n 1 91 LYS n 1 92 THR n 1 93 ASN n 1 94 LEU n 1 95 GLN n 1 96 THR n 1 97 ILE n 1 98 CYS n 1 99 LYS n 1 100 GLU n 1 101 MET n 1 102 VAL n 1 103 LYS n 1 104 LEU n 1 105 ALA n 1 106 MET n 1 107 THR n 1 108 ASP n 1 109 CYS n 1 110 HIS n 1 111 TRP n 1 112 LEU n 1 113 LYS n 1 114 VAL n 1 115 TRP n 1 116 PHE n 1 117 GLU n 1 118 TRP n 1 119 SER n 1 120 ALA n 1 121 SER n 1 122 THR n 1 123 ARG n 1 124 ASP n 1 125 GLU n 1 126 VAL n 1 127 TRP n 1 128 PRO n 1 129 LEU n 1 130 PHE n 1 131 VAL n 1 132 SER n 1 133 THR n 1 134 ASN n 1 135 ARG n 1 136 THR n 1 137 ASN n 1 138 GLN n 1 139 LEU n 1 140 LEU n 1 141 VAL n 1 142 ARG n 1 143 ASN n 1 144 MET n 1 145 PHE n 1 146 MET n 1 147 LYS n 1 148 ALA n 1 149 MET n 1 150 GLU n 1 151 ARG n 1 152 GLY n 1 153 GLU n 1 154 LEU n 1 155 CYS n 1 156 GLU n 1 157 LYS n 1 158 HIS n 1 159 ASP n 1 160 VAL n 1 161 ASP n 1 162 ASN n 1 163 MET n 1 164 ALA n 1 165 SER n 1 166 LEU n 1 167 PHE n 1 168 HIS n 1 169 GLY n 1 170 ILE n 1 171 CYS n 1 172 TYR n 1 173 SER n 1 174 ILE n 1 175 PHE n 1 176 LEU n 1 177 GLN n 1 178 VAL n 1 179 ASN n 1 180 ARG n 1 181 LEU n 1 182 GLY n 1 183 GLU n 1 184 GLN n 1 185 GLU n 1 186 ALA n 1 187 VAL n 1 188 TYR n 1 189 LYS n 1 190 LEU n 1 191 ALA n 1 192 ASP n 1 193 SER n 1 194 TYR n 1 195 LEU n 1 196 ASN n 1 197 MET n 1 198 LEU n 1 199 CYS n 1 200 ILE n 1 201 TYR n 1 202 LYS n 1 203 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 203 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'hapR, D6U24_16025, ERS013186_00946, ERS013198_01284, ERS013202_02486' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio cholerae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 666 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2CKP3_VIBCL _struct_ref.pdbx_db_accession B2CKP3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDASIEKRPRTRLSPQKRKLQLMEIALEVFAKRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDDVLNFVVRQYSNFL TDHIDLDLDVKTNLQTLCKEMVKLAMTDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLIRNMFMKAMERGELCEKHDV DNMASLFHGIFYSIFLQVNRLGEQEAVYKLADSYLNMLCIYKN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7XXT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B2CKP3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 203 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 203 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XXT PHE A 76 ? UNP B2CKP3 TYR 76 'engineered mutation' 76 1 1 7XXT ILE A 97 ? UNP B2CKP3 LEU 97 'engineered mutation' 97 2 1 7XXT VAL A 141 ? UNP B2CKP3 ILE 141 'engineered mutation' 141 3 1 7XXT CYS A 171 ? UNP B2CKP3 PHE 171 'engineered mutation' 171 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 7PI non-polymer . '1-((5-phenylthiophen-2-yl)sulfonyl)-1H-pyrazole' IMTVC-212 'C13 H10 N2 O2 S2' 290.361 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XXT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 297 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '7-8% PEg 8000, 100 mM CHES pH 9.5, 200 mM NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'Bruker PHOTON III' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-02-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'BRUKER X8 PROTEUM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7XXT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.49 _reflns.d_resolution_low 27.35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14492 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.49 _reflns_shell.d_res_low 2.58 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 693 _reflns_shell.percent_possible_all 90.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.90 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 119.120 _refine.B_iso_mean 45.6985 _refine.B_iso_min 18.230 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XXT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5010 _refine.ls_d_res_low 26.7860 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14450 _refine.ls_number_reflns_R_free 1445 _refine.ls_number_reflns_R_work 13005 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7000 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2106 _refine.ls_R_factor_R_free 0.2589 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2053 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2PBX _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.9900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5010 _refine_hist.d_res_low 26.7860 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 1676 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 198 _refine_hist.pdbx_B_iso_mean_ligand 46.62 _refine_hist.pdbx_B_iso_mean_solvent 36.35 _refine_hist.pdbx_number_atoms_protein 1620 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.51 2.5901 . . 138 1275 98.0000 . . . 0.3503 0.0000 0.2776 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5901 2.6937 . . 147 1300 100.0000 . . . 0.3943 0.0000 0.2662 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6937 2.8162 . . 149 1329 100.0000 . . . 0.2587 0.0000 0.2423 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8162 2.9645 . . 140 1290 100.0000 . . . 0.3337 0.0000 0.2500 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9645 3.1499 . . 140 1293 100.0000 . . . 0.3182 0.0000 0.2317 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1499 3.3927 . . 145 1285 100.0000 . . . 0.2919 0.0000 0.2260 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3927 3.7333 . . 151 1327 100.0000 . . . 0.2610 0.0000 0.2108 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7333 4.2717 . . 143 1283 100.0000 . . . 0.2074 0.0000 0.1669 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2717 5.3747 . . 151 1324 100.0000 . . . 0.2239 0.0000 0.1677 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.3747 26.78 . . 141 1299 100.0000 . . . 0.2051 0.0000 0.1816 . . . . . . . . . . . # _struct.entry_id 7XXT _struct.title 'HapR Quadruple mutant, bound to IMTVC-212' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XXT _struct_keywords.text 'HapR Master Regulator, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 14 ? GLY A 34 ? SER A 14 GLY A 34 1 ? 21 HELX_P HELX_P2 AA2 GLY A 39 ? GLN A 48 ? GLY A 39 GLN A 48 1 ? 10 HELX_P HELX_P3 AA3 SER A 50 ? PHE A 58 ? SER A 50 PHE A 58 1 ? 9 HELX_P HELX_P4 AA4 THR A 60 ? ILE A 84 ? THR A 60 ILE A 84 1 ? 25 HELX_P HELX_P5 AA5 ASP A 89 ? THR A 107 ? ASP A 89 THR A 107 1 ? 19 HELX_P HELX_P6 AA6 CYS A 109 ? ALA A 120 ? CYS A 109 ALA A 120 1 ? 12 HELX_P HELX_P7 AA7 VAL A 126 ? ASN A 134 ? VAL A 126 ASN A 134 1 ? 9 HELX_P HELX_P8 AA8 ASN A 134 ? ARG A 151 ? ASN A 134 ARG A 151 1 ? 18 HELX_P HELX_P9 AA9 ASP A 159 ? LEU A 181 ? ASP A 159 LEU A 181 1 ? 23 HELX_P HELX_P10 AB1 GLU A 183 ? MET A 197 ? GLU A 183 MET A 197 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 199 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 199 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 199 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 199 _struct_conn.ptnr2_symmetry 2_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.025 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7XXT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011113 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022245 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018666 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 TRP 111 111 111 TRP TRP A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 TRP 118 118 118 TRP TRP A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 MET 144 144 144 MET MET A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 MET 146 146 146 MET MET A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 MET 149 149 149 MET MET A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 CYS 155 155 155 CYS CYS A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 HIS 158 158 158 HIS HIS A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 TYR 194 194 194 TYR TYR A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 MET 197 197 197 MET MET A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 CYS 199 199 199 CYS CYS A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 TYR 201 201 201 TYR TYR A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 ASN 203 203 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email saumen_datta@iicb.res.in _pdbx_contact_author.name_first Saumen _pdbx_contact_author.name_last Datta _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3638-9383 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DMS 1 301 301 DMS DMS A . C 3 7PI 1 302 501 7PI 7PI A . D 4 HOH 1 401 8 HOH HOH A . D 4 HOH 2 402 10 HOH HOH A . D 4 HOH 3 403 18 HOH HOH A . D 4 HOH 4 404 45 HOH HOH A . D 4 HOH 5 405 6 HOH HOH A . D 4 HOH 6 406 17 HOH HOH A . D 4 HOH 7 407 4 HOH HOH A . D 4 HOH 8 408 7 HOH HOH A . D 4 HOH 9 409 9 HOH HOH A . D 4 HOH 10 410 16 HOH HOH A . D 4 HOH 11 411 21 HOH HOH A . D 4 HOH 12 412 31 HOH HOH A . D 4 HOH 13 413 15 HOH HOH A . D 4 HOH 14 414 22 HOH HOH A . D 4 HOH 15 415 24 HOH HOH A . D 4 HOH 16 416 46 HOH HOH A . D 4 HOH 17 417 33 HOH HOH A . D 4 HOH 18 418 36 HOH HOH A . D 4 HOH 19 419 28 HOH HOH A . D 4 HOH 20 420 44 HOH HOH A . D 4 HOH 21 421 41 HOH HOH A . D 4 HOH 22 422 37 HOH HOH A . D 4 HOH 23 423 43 HOH HOH A . D 4 HOH 24 424 39 HOH HOH A . D 4 HOH 25 425 29 HOH HOH A . D 4 HOH 26 426 27 HOH HOH A . D 4 HOH 27 427 34 HOH HOH A . D 4 HOH 28 428 38 HOH HOH A . D 4 HOH 29 429 35 HOH HOH A . D 4 HOH 30 430 42 HOH HOH A . D 4 HOH 31 431 47 HOH HOH A . D 4 HOH 32 432 30 HOH HOH A . D 4 HOH 33 433 26 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3390 ? 1 MORE -7 ? 1 'SSA (A^2)' 18460 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-22 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 22.2161 2.4096 32.3909 0.3972 ? -0.0056 ? -0.0396 ? 0.2596 ? -0.1325 ? 0.3261 ? 0.9119 ? 0.6173 ? -0.8074 ? 0.7343 ? -0.8477 ? 1.0585 ? 0.1149 ? 0.4292 ? -0.2803 ? 0.1887 ? 0.4881 ? -0.5259 ? 0.1713 ? -0.0605 ? 0.1199 ? 2 'X-RAY DIFFRACTION' ? refined 16.0908 8.6692 29.9502 0.1968 ? -0.0623 ? -0.0121 ? 0.2772 ? -0.0018 ? 0.2763 ? 0.3354 ? 0.2465 ? 0.5041 ? 0.9704 ? 1.1443 ? 1.3248 ? 0.0369 ? 0.0376 ? 0.0478 ? 0.1188 ? -0.0619 ? 0.0070 ? -0.0214 ? -0.3677 ? 0.0045 ? 3 'X-RAY DIFFRACTION' ? refined 15.7931 2.1314 4.0480 0.1918 ? -0.0170 ? 0.0351 ? 0.3343 ? 0.0273 ? 0.2324 ? 0.4501 ? 0.5048 ? -0.1104 ? 0.7154 ? 0.1588 ? 0.5445 ? 0.0000 ? 0.0423 ? -0.1312 ? 0.0650 ? -0.2625 ? -0.2776 ? -0.1545 ? 0.6443 ? -0.0002 ? 4 'X-RAY DIFFRACTION' ? refined 5.4144 7.7729 20.3380 0.2630 ? -0.0507 ? -0.0118 ? 0.2637 ? -0.0308 ? 0.2875 ? 0.1313 ? 0.1226 ? 0.1821 ? 0.5054 ? -0.1651 ? 0.5795 ? -0.0336 ? -0.2635 ? 0.0463 ? 0.1423 ? -0.2165 ? 0.0660 ? -0.1104 ? -0.1311 ? -0.0017 ? 5 'X-RAY DIFFRACTION' ? refined 6.6591 13.9265 -1.0767 0.3163 ? -0.0042 ? 0.0472 ? 0.2136 ? 0.0052 ? 0.3085 ? 0.2440 ? -0.0383 ? -0.0613 ? 0.3887 ? 0.5647 ? 2.2754 ? 0.3628 ? 0.1325 ? 0.3523 ? -0.1737 ? 0.2961 ? -0.1726 ? -0.2312 ? 0.5253 ? 0.1093 ? 6 'X-RAY DIFFRACTION' ? refined 6.4315 -2.5925 5.4676 0.2845 ? 0.0210 ? 0.0231 ? 0.2295 ? -0.0061 ? 0.2990 ? 1.7792 ? 0.2049 ? -0.3612 ? 0.8855 ? 0.6575 ? 0.6946 ? -0.0048 ? -0.0230 ? -0.2693 ? -0.1868 ? -0.0434 ? 0.0435 ? 0.1325 ? 0.1455 ? 0.0014 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 5 ? ? ? A 33 ? ? ;chain 'A' and (resid 5 through 33 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 34 ? ? ? A 83 ? ? ;chain 'A' and (resid 34 through 83 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 84 ? ? ? A 107 ? ? ;chain 'A' and (resid 84 through 107 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 108 ? ? ? A 134 ? ? ;chain 'A' and (resid 108 through 134 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 135 ? ? ? A 159 ? ? ;chain 'A' and (resid 135 through 159 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 160 ? ? ? A 202 ? ? ;chain 'A' and (resid 160 through 202 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? 'PROTEUM PLUS' ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? 'PROTEUM PLUS' ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7XXT _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CB _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 CYS _pdbx_validate_symm_contact.auth_seq_id_1 199 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 SG _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 CYS _pdbx_validate_symm_contact.auth_seq_id_2 199 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_555 _pdbx_validate_symm_contact.dist 1.63 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 181 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -113.63 _pdbx_validate_torsion.psi -88.91 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 432 ? 5.90 . 2 1 O ? A HOH 433 ? 6.10 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A ASN 203 ? A ASN 203 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 7PI C1 C Y N 1 7PI C10 C Y N 2 7PI C11 C Y N 3 7PI C12 C Y N 4 7PI C13 C Y N 5 7PI C2 C Y N 6 7PI C3 C Y N 7 7PI C4 C Y N 8 7PI C5 C Y N 9 7PI C6 C Y N 10 7PI C7 C Y N 11 7PI C8 C Y N 12 7PI C9 C Y N 13 7PI N1 N Y N 14 7PI N2 N Y N 15 7PI O1 O N N 16 7PI O2 O N N 17 7PI S1 S Y N 18 7PI S2 S N N 19 7PI H1 H N N 20 7PI H2 H N N 21 7PI H3 H N N 22 7PI H4 H N N 23 7PI H5 H N N 24 7PI H6 H N N 25 7PI H7 H N N 26 7PI H8 H N N 27 7PI H9 H N N 28 7PI H10 H N N 29 ALA N N N N 30 ALA CA C N S 31 ALA C C N N 32 ALA O O N N 33 ALA CB C N N 34 ALA OXT O N N 35 ALA H H N N 36 ALA H2 H N N 37 ALA HA H N N 38 ALA HB1 H N N 39 ALA HB2 H N N 40 ALA HB3 H N N 41 ALA HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CYS N N N N 103 CYS CA C N R 104 CYS C C N N 105 CYS O O N N 106 CYS CB C N N 107 CYS SG S N N 108 CYS OXT O N N 109 CYS H H N N 110 CYS H2 H N N 111 CYS HA H N N 112 CYS HB2 H N N 113 CYS HB3 H N N 114 CYS HG H N N 115 CYS HXT H N N 116 DMS S S N N 117 DMS O O N N 118 DMS C1 C N N 119 DMS C2 C N N 120 DMS H11 H N N 121 DMS H12 H N N 122 DMS H13 H N N 123 DMS H21 H N N 124 DMS H22 H N N 125 DMS H23 H N N 126 GLN N N N N 127 GLN CA C N S 128 GLN C C N N 129 GLN O O N N 130 GLN CB C N N 131 GLN CG C N N 132 GLN CD C N N 133 GLN OE1 O N N 134 GLN NE2 N N N 135 GLN OXT O N N 136 GLN H H N N 137 GLN H2 H N N 138 GLN HA H N N 139 GLN HB2 H N N 140 GLN HB3 H N N 141 GLN HG2 H N N 142 GLN HG3 H N N 143 GLN HE21 H N N 144 GLN HE22 H N N 145 GLN HXT H N N 146 GLU N N N N 147 GLU CA C N S 148 GLU C C N N 149 GLU O O N N 150 GLU CB C N N 151 GLU CG C N N 152 GLU CD C N N 153 GLU OE1 O N N 154 GLU OE2 O N N 155 GLU OXT O N N 156 GLU H H N N 157 GLU H2 H N N 158 GLU HA H N N 159 GLU HB2 H N N 160 GLU HB3 H N N 161 GLU HG2 H N N 162 GLU HG3 H N N 163 GLU HE2 H N N 164 GLU HXT H N N 165 GLY N N N N 166 GLY CA C N N 167 GLY C C N N 168 GLY O O N N 169 GLY OXT O N N 170 GLY H H N N 171 GLY H2 H N N 172 GLY HA2 H N N 173 GLY HA3 H N N 174 GLY HXT H N N 175 HIS N N N N 176 HIS CA C N S 177 HIS C C N N 178 HIS O O N N 179 HIS CB C N N 180 HIS CG C Y N 181 HIS ND1 N Y N 182 HIS CD2 C Y N 183 HIS CE1 C Y N 184 HIS NE2 N Y N 185 HIS OXT O N N 186 HIS H H N N 187 HIS H2 H N N 188 HIS HA H N N 189 HIS HB2 H N N 190 HIS HB3 H N N 191 HIS HD1 H N N 192 HIS HD2 H N N 193 HIS HE1 H N N 194 HIS HE2 H N N 195 HIS HXT H N N 196 HOH O O N N 197 HOH H1 H N N 198 HOH H2 H N N 199 ILE N N N N 200 ILE CA C N S 201 ILE C C N N 202 ILE O O N N 203 ILE CB C N S 204 ILE CG1 C N N 205 ILE CG2 C N N 206 ILE CD1 C N N 207 ILE OXT O N N 208 ILE H H N N 209 ILE H2 H N N 210 ILE HA H N N 211 ILE HB H N N 212 ILE HG12 H N N 213 ILE HG13 H N N 214 ILE HG21 H N N 215 ILE HG22 H N N 216 ILE HG23 H N N 217 ILE HD11 H N N 218 ILE HD12 H N N 219 ILE HD13 H N N 220 ILE HXT H N N 221 LEU N N N N 222 LEU CA C N S 223 LEU C C N N 224 LEU O O N N 225 LEU CB C N N 226 LEU CG C N N 227 LEU CD1 C N N 228 LEU CD2 C N N 229 LEU OXT O N N 230 LEU H H N N 231 LEU H2 H N N 232 LEU HA H N N 233 LEU HB2 H N N 234 LEU HB3 H N N 235 LEU HG H N N 236 LEU HD11 H N N 237 LEU HD12 H N N 238 LEU HD13 H N N 239 LEU HD21 H N N 240 LEU HD22 H N N 241 LEU HD23 H N N 242 LEU HXT H N N 243 LYS N N N N 244 LYS CA C N S 245 LYS C C N N 246 LYS O O N N 247 LYS CB C N N 248 LYS CG C N N 249 LYS CD C N N 250 LYS CE C N N 251 LYS NZ N N N 252 LYS OXT O N N 253 LYS H H N N 254 LYS H2 H N N 255 LYS HA H N N 256 LYS HB2 H N N 257 LYS HB3 H N N 258 LYS HG2 H N N 259 LYS HG3 H N N 260 LYS HD2 H N N 261 LYS HD3 H N N 262 LYS HE2 H N N 263 LYS HE3 H N N 264 LYS HZ1 H N N 265 LYS HZ2 H N N 266 LYS HZ3 H N N 267 LYS HXT H N N 268 MET N N N N 269 MET CA C N S 270 MET C C N N 271 MET O O N N 272 MET CB C N N 273 MET CG C N N 274 MET SD S N N 275 MET CE C N N 276 MET OXT O N N 277 MET H H N N 278 MET H2 H N N 279 MET HA H N N 280 MET HB2 H N N 281 MET HB3 H N N 282 MET HG2 H N N 283 MET HG3 H N N 284 MET HE1 H N N 285 MET HE2 H N N 286 MET HE3 H N N 287 MET HXT H N N 288 PHE N N N N 289 PHE CA C N S 290 PHE C C N N 291 PHE O O N N 292 PHE CB C N N 293 PHE CG C Y N 294 PHE CD1 C Y N 295 PHE CD2 C Y N 296 PHE CE1 C Y N 297 PHE CE2 C Y N 298 PHE CZ C Y N 299 PHE OXT O N N 300 PHE H H N N 301 PHE H2 H N N 302 PHE HA H N N 303 PHE HB2 H N N 304 PHE HB3 H N N 305 PHE HD1 H N N 306 PHE HD2 H N N 307 PHE HE1 H N N 308 PHE HE2 H N N 309 PHE HZ H N N 310 PHE HXT H N N 311 PRO N N N N 312 PRO CA C N S 313 PRO C C N N 314 PRO O O N N 315 PRO CB C N N 316 PRO CG C N N 317 PRO CD C N N 318 PRO OXT O N N 319 PRO H H N N 320 PRO HA H N N 321 PRO HB2 H N N 322 PRO HB3 H N N 323 PRO HG2 H N N 324 PRO HG3 H N N 325 PRO HD2 H N N 326 PRO HD3 H N N 327 PRO HXT H N N 328 SER N N N N 329 SER CA C N S 330 SER C C N N 331 SER O O N N 332 SER CB C N N 333 SER OG O N N 334 SER OXT O N N 335 SER H H N N 336 SER H2 H N N 337 SER HA H N N 338 SER HB2 H N N 339 SER HB3 H N N 340 SER HG H N N 341 SER HXT H N N 342 THR N N N N 343 THR CA C N S 344 THR C C N N 345 THR O O N N 346 THR CB C N R 347 THR OG1 O N N 348 THR CG2 C N N 349 THR OXT O N N 350 THR H H N N 351 THR H2 H N N 352 THR HA H N N 353 THR HB H N N 354 THR HG1 H N N 355 THR HG21 H N N 356 THR HG22 H N N 357 THR HG23 H N N 358 THR HXT H N N 359 TRP N N N N 360 TRP CA C N S 361 TRP C C N N 362 TRP O O N N 363 TRP CB C N N 364 TRP CG C Y N 365 TRP CD1 C Y N 366 TRP CD2 C Y N 367 TRP NE1 N Y N 368 TRP CE2 C Y N 369 TRP CE3 C Y N 370 TRP CZ2 C Y N 371 TRP CZ3 C Y N 372 TRP CH2 C Y N 373 TRP OXT O N N 374 TRP H H N N 375 TRP H2 H N N 376 TRP HA H N N 377 TRP HB2 H N N 378 TRP HB3 H N N 379 TRP HD1 H N N 380 TRP HE1 H N N 381 TRP HE3 H N N 382 TRP HZ2 H N N 383 TRP HZ3 H N N 384 TRP HH2 H N N 385 TRP HXT H N N 386 TYR N N N N 387 TYR CA C N S 388 TYR C C N N 389 TYR O O N N 390 TYR CB C N N 391 TYR CG C Y N 392 TYR CD1 C Y N 393 TYR CD2 C Y N 394 TYR CE1 C Y N 395 TYR CE2 C Y N 396 TYR CZ C Y N 397 TYR OH O N N 398 TYR OXT O N N 399 TYR H H N N 400 TYR H2 H N N 401 TYR HA H N N 402 TYR HB2 H N N 403 TYR HB3 H N N 404 TYR HD1 H N N 405 TYR HD2 H N N 406 TYR HE1 H N N 407 TYR HE2 H N N 408 TYR HH H N N 409 TYR HXT H N N 410 VAL N N N N 411 VAL CA C N S 412 VAL C C N N 413 VAL O O N N 414 VAL CB C N N 415 VAL CG1 C N N 416 VAL CG2 C N N 417 VAL OXT O N N 418 VAL H H N N 419 VAL H2 H N N 420 VAL HA H N N 421 VAL HB H N N 422 VAL HG11 H N N 423 VAL HG12 H N N 424 VAL HG13 H N N 425 VAL HG21 H N N 426 VAL HG22 H N N 427 VAL HG23 H N N 428 VAL HXT H N N 429 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 7PI O1 S2 doub N N 1 7PI C3 C2 sing Y N 2 7PI C3 C4 doub Y N 3 7PI C2 C1 doub Y N 4 7PI C6 C7 doub Y N 5 7PI C6 C5 sing Y N 6 7PI C4 S2 sing N N 7 7PI C4 S1 sing Y N 8 7PI S2 N1 sing N N 9 7PI S2 O2 doub N N 10 7PI C1 C5 sing N N 11 7PI C1 S1 sing Y N 12 7PI C7 C8 sing Y N 13 7PI C11 N1 sing Y N 14 7PI C11 C12 doub Y N 15 7PI C5 C10 doub Y N 16 7PI N1 N2 sing Y N 17 7PI C12 C13 sing Y N 18 7PI C8 C9 doub Y N 19 7PI C10 C9 sing Y N 20 7PI N2 C13 doub Y N 21 7PI C10 H1 sing N N 22 7PI C11 H2 sing N N 23 7PI C12 H3 sing N N 24 7PI C13 H4 sing N N 25 7PI C2 H5 sing N N 26 7PI C3 H6 sing N N 27 7PI C6 H7 sing N N 28 7PI C7 H8 sing N N 29 7PI C8 H9 sing N N 30 7PI C9 H10 sing N N 31 ALA N CA sing N N 32 ALA N H sing N N 33 ALA N H2 sing N N 34 ALA CA C sing N N 35 ALA CA CB sing N N 36 ALA CA HA sing N N 37 ALA C O doub N N 38 ALA C OXT sing N N 39 ALA CB HB1 sing N N 40 ALA CB HB2 sing N N 41 ALA CB HB3 sing N N 42 ALA OXT HXT sing N N 43 ARG N CA sing N N 44 ARG N H sing N N 45 ARG N H2 sing N N 46 ARG CA C sing N N 47 ARG CA CB sing N N 48 ARG CA HA sing N N 49 ARG C O doub N N 50 ARG C OXT sing N N 51 ARG CB CG sing N N 52 ARG CB HB2 sing N N 53 ARG CB HB3 sing N N 54 ARG CG CD sing N N 55 ARG CG HG2 sing N N 56 ARG CG HG3 sing N N 57 ARG CD NE sing N N 58 ARG CD HD2 sing N N 59 ARG CD HD3 sing N N 60 ARG NE CZ sing N N 61 ARG NE HE sing N N 62 ARG CZ NH1 sing N N 63 ARG CZ NH2 doub N N 64 ARG NH1 HH11 sing N N 65 ARG NH1 HH12 sing N N 66 ARG NH2 HH21 sing N N 67 ARG NH2 HH22 sing N N 68 ARG OXT HXT sing N N 69 ASN N CA sing N N 70 ASN N H sing N N 71 ASN N H2 sing N N 72 ASN CA C sing N N 73 ASN CA CB sing N N 74 ASN CA HA sing N N 75 ASN C O doub N N 76 ASN C OXT sing N N 77 ASN CB CG sing N N 78 ASN CB HB2 sing N N 79 ASN CB HB3 sing N N 80 ASN CG OD1 doub N N 81 ASN CG ND2 sing N N 82 ASN ND2 HD21 sing N N 83 ASN ND2 HD22 sing N N 84 ASN OXT HXT sing N N 85 ASP N CA sing N N 86 ASP N H sing N N 87 ASP N H2 sing N N 88 ASP CA C sing N N 89 ASP CA CB sing N N 90 ASP CA HA sing N N 91 ASP C O doub N N 92 ASP C OXT sing N N 93 ASP CB CG sing N N 94 ASP CB HB2 sing N N 95 ASP CB HB3 sing N N 96 ASP CG OD1 doub N N 97 ASP CG OD2 sing N N 98 ASP OD2 HD2 sing N N 99 ASP OXT HXT sing N N 100 CYS N CA sing N N 101 CYS N H sing N N 102 CYS N H2 sing N N 103 CYS CA C sing N N 104 CYS CA CB sing N N 105 CYS CA HA sing N N 106 CYS C O doub N N 107 CYS C OXT sing N N 108 CYS CB SG sing N N 109 CYS CB HB2 sing N N 110 CYS CB HB3 sing N N 111 CYS SG HG sing N N 112 CYS OXT HXT sing N N 113 DMS S O doub N N 114 DMS S C1 sing N N 115 DMS S C2 sing N N 116 DMS C1 H11 sing N N 117 DMS C1 H12 sing N N 118 DMS C1 H13 sing N N 119 DMS C2 H21 sing N N 120 DMS C2 H22 sing N N 121 DMS C2 H23 sing N N 122 GLN N CA sing N N 123 GLN N H sing N N 124 GLN N H2 sing N N 125 GLN CA C sing N N 126 GLN CA CB sing N N 127 GLN CA HA sing N N 128 GLN C O doub N N 129 GLN C OXT sing N N 130 GLN CB CG sing N N 131 GLN CB HB2 sing N N 132 GLN CB HB3 sing N N 133 GLN CG CD sing N N 134 GLN CG HG2 sing N N 135 GLN CG HG3 sing N N 136 GLN CD OE1 doub N N 137 GLN CD NE2 sing N N 138 GLN NE2 HE21 sing N N 139 GLN NE2 HE22 sing N N 140 GLN OXT HXT sing N N 141 GLU N CA sing N N 142 GLU N H sing N N 143 GLU N H2 sing N N 144 GLU CA C sing N N 145 GLU CA CB sing N N 146 GLU CA HA sing N N 147 GLU C O doub N N 148 GLU C OXT sing N N 149 GLU CB CG sing N N 150 GLU CB HB2 sing N N 151 GLU CB HB3 sing N N 152 GLU CG CD sing N N 153 GLU CG HG2 sing N N 154 GLU CG HG3 sing N N 155 GLU CD OE1 doub N N 156 GLU CD OE2 sing N N 157 GLU OE2 HE2 sing N N 158 GLU OXT HXT sing N N 159 GLY N CA sing N N 160 GLY N H sing N N 161 GLY N H2 sing N N 162 GLY CA C sing N N 163 GLY CA HA2 sing N N 164 GLY CA HA3 sing N N 165 GLY C O doub N N 166 GLY C OXT sing N N 167 GLY OXT HXT sing N N 168 HIS N CA sing N N 169 HIS N H sing N N 170 HIS N H2 sing N N 171 HIS CA C sing N N 172 HIS CA CB sing N N 173 HIS CA HA sing N N 174 HIS C O doub N N 175 HIS C OXT sing N N 176 HIS CB CG sing N N 177 HIS CB HB2 sing N N 178 HIS CB HB3 sing N N 179 HIS CG ND1 sing Y N 180 HIS CG CD2 doub Y N 181 HIS ND1 CE1 doub Y N 182 HIS ND1 HD1 sing N N 183 HIS CD2 NE2 sing Y N 184 HIS CD2 HD2 sing N N 185 HIS CE1 NE2 sing Y N 186 HIS CE1 HE1 sing N N 187 HIS NE2 HE2 sing N N 188 HIS OXT HXT sing N N 189 HOH O H1 sing N N 190 HOH O H2 sing N N 191 ILE N CA sing N N 192 ILE N H sing N N 193 ILE N H2 sing N N 194 ILE CA C sing N N 195 ILE CA CB sing N N 196 ILE CA HA sing N N 197 ILE C O doub N N 198 ILE C OXT sing N N 199 ILE CB CG1 sing N N 200 ILE CB CG2 sing N N 201 ILE CB HB sing N N 202 ILE CG1 CD1 sing N N 203 ILE CG1 HG12 sing N N 204 ILE CG1 HG13 sing N N 205 ILE CG2 HG21 sing N N 206 ILE CG2 HG22 sing N N 207 ILE CG2 HG23 sing N N 208 ILE CD1 HD11 sing N N 209 ILE CD1 HD12 sing N N 210 ILE CD1 HD13 sing N N 211 ILE OXT HXT sing N N 212 LEU N CA sing N N 213 LEU N H sing N N 214 LEU N H2 sing N N 215 LEU CA C sing N N 216 LEU CA CB sing N N 217 LEU CA HA sing N N 218 LEU C O doub N N 219 LEU C OXT sing N N 220 LEU CB CG sing N N 221 LEU CB HB2 sing N N 222 LEU CB HB3 sing N N 223 LEU CG CD1 sing N N 224 LEU CG CD2 sing N N 225 LEU CG HG sing N N 226 LEU CD1 HD11 sing N N 227 LEU CD1 HD12 sing N N 228 LEU CD1 HD13 sing N N 229 LEU CD2 HD21 sing N N 230 LEU CD2 HD22 sing N N 231 LEU CD2 HD23 sing N N 232 LEU OXT HXT sing N N 233 LYS N CA sing N N 234 LYS N H sing N N 235 LYS N H2 sing N N 236 LYS CA C sing N N 237 LYS CA CB sing N N 238 LYS CA HA sing N N 239 LYS C O doub N N 240 LYS C OXT sing N N 241 LYS CB CG sing N N 242 LYS CB HB2 sing N N 243 LYS CB HB3 sing N N 244 LYS CG CD sing N N 245 LYS CG HG2 sing N N 246 LYS CG HG3 sing N N 247 LYS CD CE sing N N 248 LYS CD HD2 sing N N 249 LYS CD HD3 sing N N 250 LYS CE NZ sing N N 251 LYS CE HE2 sing N N 252 LYS CE HE3 sing N N 253 LYS NZ HZ1 sing N N 254 LYS NZ HZ2 sing N N 255 LYS NZ HZ3 sing N N 256 LYS OXT HXT sing N N 257 MET N CA sing N N 258 MET N H sing N N 259 MET N H2 sing N N 260 MET CA C sing N N 261 MET CA CB sing N N 262 MET CA HA sing N N 263 MET C O doub N N 264 MET C OXT sing N N 265 MET CB CG sing N N 266 MET CB HB2 sing N N 267 MET CB HB3 sing N N 268 MET CG SD sing N N 269 MET CG HG2 sing N N 270 MET CG HG3 sing N N 271 MET SD CE sing N N 272 MET CE HE1 sing N N 273 MET CE HE2 sing N N 274 MET CE HE3 sing N N 275 MET OXT HXT sing N N 276 PHE N CA sing N N 277 PHE N H sing N N 278 PHE N H2 sing N N 279 PHE CA C sing N N 280 PHE CA CB sing N N 281 PHE CA HA sing N N 282 PHE C O doub N N 283 PHE C OXT sing N N 284 PHE CB CG sing N N 285 PHE CB HB2 sing N N 286 PHE CB HB3 sing N N 287 PHE CG CD1 doub Y N 288 PHE CG CD2 sing Y N 289 PHE CD1 CE1 sing Y N 290 PHE CD1 HD1 sing N N 291 PHE CD2 CE2 doub Y N 292 PHE CD2 HD2 sing N N 293 PHE CE1 CZ doub Y N 294 PHE CE1 HE1 sing N N 295 PHE CE2 CZ sing Y N 296 PHE CE2 HE2 sing N N 297 PHE CZ HZ sing N N 298 PHE OXT HXT sing N N 299 PRO N CA sing N N 300 PRO N CD sing N N 301 PRO N H sing N N 302 PRO CA C sing N N 303 PRO CA CB sing N N 304 PRO CA HA sing N N 305 PRO C O doub N N 306 PRO C OXT sing N N 307 PRO CB CG sing N N 308 PRO CB HB2 sing N N 309 PRO CB HB3 sing N N 310 PRO CG CD sing N N 311 PRO CG HG2 sing N N 312 PRO CG HG3 sing N N 313 PRO CD HD2 sing N N 314 PRO CD HD3 sing N N 315 PRO OXT HXT sing N N 316 SER N CA sing N N 317 SER N H sing N N 318 SER N H2 sing N N 319 SER CA C sing N N 320 SER CA CB sing N N 321 SER CA HA sing N N 322 SER C O doub N N 323 SER C OXT sing N N 324 SER CB OG sing N N 325 SER CB HB2 sing N N 326 SER CB HB3 sing N N 327 SER OG HG sing N N 328 SER OXT HXT sing N N 329 THR N CA sing N N 330 THR N H sing N N 331 THR N H2 sing N N 332 THR CA C sing N N 333 THR CA CB sing N N 334 THR CA HA sing N N 335 THR C O doub N N 336 THR C OXT sing N N 337 THR CB OG1 sing N N 338 THR CB CG2 sing N N 339 THR CB HB sing N N 340 THR OG1 HG1 sing N N 341 THR CG2 HG21 sing N N 342 THR CG2 HG22 sing N N 343 THR CG2 HG23 sing N N 344 THR OXT HXT sing N N 345 TRP N CA sing N N 346 TRP N H sing N N 347 TRP N H2 sing N N 348 TRP CA C sing N N 349 TRP CA CB sing N N 350 TRP CA HA sing N N 351 TRP C O doub N N 352 TRP C OXT sing N N 353 TRP CB CG sing N N 354 TRP CB HB2 sing N N 355 TRP CB HB3 sing N N 356 TRP CG CD1 doub Y N 357 TRP CG CD2 sing Y N 358 TRP CD1 NE1 sing Y N 359 TRP CD1 HD1 sing N N 360 TRP CD2 CE2 doub Y N 361 TRP CD2 CE3 sing Y N 362 TRP NE1 CE2 sing Y N 363 TRP NE1 HE1 sing N N 364 TRP CE2 CZ2 sing Y N 365 TRP CE3 CZ3 doub Y N 366 TRP CE3 HE3 sing N N 367 TRP CZ2 CH2 doub Y N 368 TRP CZ2 HZ2 sing N N 369 TRP CZ3 CH2 sing Y N 370 TRP CZ3 HZ3 sing N N 371 TRP CH2 HH2 sing N N 372 TRP OXT HXT sing N N 373 TYR N CA sing N N 374 TYR N H sing N N 375 TYR N H2 sing N N 376 TYR CA C sing N N 377 TYR CA CB sing N N 378 TYR CA HA sing N N 379 TYR C O doub N N 380 TYR C OXT sing N N 381 TYR CB CG sing N N 382 TYR CB HB2 sing N N 383 TYR CB HB3 sing N N 384 TYR CG CD1 doub Y N 385 TYR CG CD2 sing Y N 386 TYR CD1 CE1 sing Y N 387 TYR CD1 HD1 sing N N 388 TYR CD2 CE2 doub Y N 389 TYR CD2 HD2 sing N N 390 TYR CE1 CZ doub Y N 391 TYR CE1 HE1 sing N N 392 TYR CE2 CZ sing Y N 393 TYR CE2 HE2 sing N N 394 TYR CZ OH sing N N 395 TYR OH HH sing N N 396 TYR OXT HXT sing N N 397 VAL N CA sing N N 398 VAL N H sing N N 399 VAL N H2 sing N N 400 VAL CA C sing N N 401 VAL CA CB sing N N 402 VAL CA HA sing N N 403 VAL C O doub N N 404 VAL C OXT sing N N 405 VAL CB CG1 sing N N 406 VAL CB CG2 sing N N 407 VAL CB HB sing N N 408 VAL CG1 HG11 sing N N 409 VAL CG1 HG12 sing N N 410 VAL CG1 HG13 sing N N 411 VAL CG2 HG21 sing N N 412 VAL CG2 HG22 sing N N 413 VAL CG2 HG23 sing N N 414 VAL OXT HXT sing N N 415 # _pdbx_audit_support.funding_organization 'Council of Scientific & Industrial Research (CSIR)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 7PI ? ? 7PI ? ? 'SUBJECT OF INVESTIGATION' ? 2 DMS ? ? DMS ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DIMETHYL SULFOXIDE' DMS 3 '1-((5-phenylthiophen-2-yl)sulfonyl)-1H-pyrazole' 7PI 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2PBX _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #