data_7Y19 # _entry.id 7Y19 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Y19 pdb_00007y19 10.2210/pdb7y19/pdb WWPDB D_1300030062 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Y19 _pdbx_database_status.recvd_initial_deposition_date 2022-06-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ki, N.' 1 ? 'Ha, N.C.' 2 ? 'Seung-Ho, H.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis for the biofilm regulation of transcription factor BrpR in Vibrio vulnificus' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ki, N.' 1 ? primary 'Seung-Ho, H.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7Y19 _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.259 _cell.length_a_esd ? _cell.length_b 53.259 _cell.length_b_esd ? _cell.length_c 143.926 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7Y19 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator VpsR' 16321.154 1 ? ? ? ? 2 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'transcriptional regulator BrpR' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ATQFK(MSE)DSVPGSLVVVGGTYEPWLSVLEQVGWKCHQCADLRKVDALLEDIGPCIGIVDLSHDEFSLNGIAN LVSTHKHVRWLAFIREQQLSSDTICQFIVNFCIDFFTAPIPDAQLLSTIGHQLG(MSE)LKLEKKVWPTFGNNQD(MSE) ; _entity_poly.pdbx_seq_one_letter_code_can ;MATQFKMDSVPGSLVVVGGTYEPWLSVLEQVGWKCHQCADLRKVDALLEDIGPCIGIVDLSHDEFSLNGIANLVSTHKHV RWLAFIREQQLSSDTICQFIVNFCIDFFTAPIPDAQLLSTIGHQLGMLKLEKKVWPTFGNNQDM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 THR n 1 4 GLN n 1 5 PHE n 1 6 LYS n 1 7 MSE n 1 8 ASP n 1 9 SER n 1 10 VAL n 1 11 PRO n 1 12 GLY n 1 13 SER n 1 14 LEU n 1 15 VAL n 1 16 VAL n 1 17 VAL n 1 18 GLY n 1 19 GLY n 1 20 THR n 1 21 TYR n 1 22 GLU n 1 23 PRO n 1 24 TRP n 1 25 LEU n 1 26 SER n 1 27 VAL n 1 28 LEU n 1 29 GLU n 1 30 GLN n 1 31 VAL n 1 32 GLY n 1 33 TRP n 1 34 LYS n 1 35 CYS n 1 36 HIS n 1 37 GLN n 1 38 CYS n 1 39 ALA n 1 40 ASP n 1 41 LEU n 1 42 ARG n 1 43 LYS n 1 44 VAL n 1 45 ASP n 1 46 ALA n 1 47 LEU n 1 48 LEU n 1 49 GLU n 1 50 ASP n 1 51 ILE n 1 52 GLY n 1 53 PRO n 1 54 CYS n 1 55 ILE n 1 56 GLY n 1 57 ILE n 1 58 VAL n 1 59 ASP n 1 60 LEU n 1 61 SER n 1 62 HIS n 1 63 ASP n 1 64 GLU n 1 65 PHE n 1 66 SER n 1 67 LEU n 1 68 ASN n 1 69 GLY n 1 70 ILE n 1 71 ALA n 1 72 ASN n 1 73 LEU n 1 74 VAL n 1 75 SER n 1 76 THR n 1 77 HIS n 1 78 LYS n 1 79 HIS n 1 80 VAL n 1 81 ARG n 1 82 TRP n 1 83 LEU n 1 84 ALA n 1 85 PHE n 1 86 ILE n 1 87 ARG n 1 88 GLU n 1 89 GLN n 1 90 GLN n 1 91 LEU n 1 92 SER n 1 93 SER n 1 94 ASP n 1 95 THR n 1 96 ILE n 1 97 CYS n 1 98 GLN n 1 99 PHE n 1 100 ILE n 1 101 VAL n 1 102 ASN n 1 103 PHE n 1 104 CYS n 1 105 ILE n 1 106 ASP n 1 107 PHE n 1 108 PHE n 1 109 THR n 1 110 ALA n 1 111 PRO n 1 112 ILE n 1 113 PRO n 1 114 ASP n 1 115 ALA n 1 116 GLN n 1 117 LEU n 1 118 LEU n 1 119 SER n 1 120 THR n 1 121 ILE n 1 122 GLY n 1 123 HIS n 1 124 GLN n 1 125 LEU n 1 126 GLY n 1 127 MSE n 1 128 LEU n 1 129 LYS n 1 130 LEU n 1 131 GLU n 1 132 LYS n 1 133 LYS n 1 134 VAL n 1 135 TRP n 1 136 PRO n 1 137 THR n 1 138 PHE n 1 139 GLY n 1 140 ASN n 1 141 ASN n 1 142 GLN n 1 143 ASP n 1 144 MSE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 144 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene VV1_0525 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain CMCP6 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio vulnificus CMCP6' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 216895 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A3Q0L274_VIBVU _struct_ref.pdbx_db_accession A0A3Q0L274 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MATQFKMDSVPGSLVVVGGTYEPWLSVLEQVGWKCHQCADLRKVDALLEDIGPCIGIVDLSHDEFSLNGIANLVSTHKHV RWLAFIREQQLSSDTICQFIVNFCIDFFTAPIPDAQLLSTIGHQLGMLKLEKKVWPTFGNNQDM ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Y19 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A3Q0L274 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 144 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 144 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Y19 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.83 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.035 M Citric acid, 0.065 M BIS-TRIS propane pH 7.0, 22% w/v Polyethylene glycol 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.15 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-07-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0448 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0448 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 29.480 _reflns.entry_id 7Y19 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.39 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5217 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24.200 _reflns.pdbx_Rmerge_I_obs 0.106 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.129 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.107 _reflns.pdbx_Rpim_I_all 0.019 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.400 2.440 ? ? ? ? ? ? 252 96.900 ? ? ? ? 0.309 ? ? ? ? ? ? ? ? 12.800 ? 0.862 ? ? 0.321 0.082 ? 1 1 0.948 ? ? ? ? ? ? ? ? ? ? 2.440 2.490 ? ? ? ? ? ? 236 97.900 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 14.800 ? 0.863 ? ? 0.313 0.075 ? 2 1 0.925 ? ? ? ? ? ? ? ? ? ? 2.490 2.530 ? ? ? ? ? ? 252 99.200 ? ? ? ? 0.298 ? ? ? ? ? ? ? ? 15.300 ? 0.825 ? ? 0.307 0.073 ? 3 1 0.939 ? ? ? ? ? ? ? ? ? ? 2.530 2.590 ? ? ? ? ? ? 242 97.200 ? ? ? ? 0.288 ? ? ? ? ? ? ? ? 16.000 ? 0.918 ? ? 0.296 0.068 ? 4 1 0.944 ? ? ? ? ? ? ? ? ? ? 2.590 2.640 ? ? ? ? ? ? 248 98.400 ? ? ? ? 0.265 ? ? ? ? ? ? ? ? 18.500 ? 0.930 ? ? 0.272 0.059 ? 5 1 0.975 ? ? ? ? ? ? ? ? ? ? 2.640 2.700 ? ? ? ? ? ? 252 98.800 ? ? ? ? 0.245 ? ? ? ? ? ? ? ? 18.300 ? 1.061 ? ? 0.251 0.053 ? 6 1 0.985 ? ? ? ? ? ? ? ? ? ? 2.700 2.770 ? ? ? ? ? ? 252 98.400 ? ? ? ? 0.257 ? ? ? ? ? ? ? ? 18.800 ? 1.038 ? ? 0.263 0.056 ? 7 1 0.975 ? ? ? ? ? ? ? ? ? ? 2.770 2.850 ? ? ? ? ? ? 254 99.600 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 21.100 ? 1.114 ? ? 0.228 0.046 ? 8 1 0.995 ? ? ? ? ? ? ? ? ? ? 2.850 2.930 ? ? ? ? ? ? 251 99.200 ? ? ? ? 0.218 ? ? ? ? ? ? ? ? 21.000 ? 1.130 ? ? 0.223 0.045 ? 9 1 0.991 ? ? ? ? ? ? ? ? ? ? 2.930 3.020 ? ? ? ? ? ? 253 98.400 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? 21.400 ? 1.194 ? ? 0.196 0.040 ? 10 1 0.991 ? ? ? ? ? ? ? ? ? ? 3.020 3.130 ? ? ? ? ? ? 261 99.200 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 22.100 ? 1.202 ? ? 0.185 0.037 ? 11 1 0.995 ? ? ? ? ? ? ? ? ? ? 3.130 3.260 ? ? ? ? ? ? 250 99.600 ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 26.000 ? 1.401 ? ? 0.171 0.031 ? 12 1 0.995 ? ? ? ? ? ? ? ? ? ? 3.260 3.410 ? ? ? ? ? ? 262 98.900 ? ? ? ? 0.161 ? ? ? ? ? ? ? ? 28.800 ? 1.406 ? ? 0.164 0.029 ? 13 1 0.996 ? ? ? ? ? ? ? ? ? ? 3.410 3.580 ? ? ? ? ? ? 267 99.600 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 31.500 ? 1.460 ? ? 0.149 0.025 ? 14 1 0.998 ? ? ? ? ? ? ? ? ? ? 3.580 3.810 ? ? ? ? ? ? 267 98.900 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 33.400 ? 1.471 ? ? 0.145 0.024 ? 15 1 0.998 ? ? ? ? ? ? ? ? ? ? 3.810 4.100 ? ? ? ? ? ? 261 99.600 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 33.700 ? 1.394 ? ? 0.128 0.021 ? 16 1 0.996 ? ? ? ? ? ? ? ? ? ? 4.100 4.520 ? ? ? ? ? ? 271 98.900 ? ? ? ? 0.106 ? ? ? ? ? ? ? ? 33.800 ? 1.138 ? ? 0.108 0.018 ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.520 5.170 ? ? ? ? ? ? 276 99.300 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 32.200 ? 1.060 ? ? 0.101 0.017 ? 18 1 0.991 ? ? ? ? ? ? ? ? ? ? 5.170 6.510 ? ? ? ? ? ? 284 99.000 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 28.000 ? 0.867 ? ? 0.092 0.017 ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 6.510 50.000 ? ? ? ? ? ? 326 95.900 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 29.900 ? 0.631 ? ? 0.067 0.012 ? 20 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 73.790 _refine.B_iso_mean 31.4427 _refine.B_iso_min 7.270 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Y19 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3900 _refine.ls_d_res_low 33.2500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5199 _refine.ls_number_reflns_R_free 520 _refine.ls_number_reflns_R_work 4679 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.9000 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2275 _refine.ls_R_factor_R_free 0.2908 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2206 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.520 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.6300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3900 _refine_hist.d_res_low 33.2500 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1039 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 132 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 15.59 _refine_hist.pdbx_number_atoms_protein 1035 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3900 2.6300 1214 . 121 1093 96.0000 . . . 0.3103 0.0000 0.2358 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.6300 3.0100 1265 . 126 1139 99.0000 . . . 0.3029 0.0000 0.2480 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.0200 3.8000 1306 . 132 1174 100.0000 . . . 0.2908 0.0000 0.2200 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.8000 33.2500 1414 . 141 1273 100.0000 . . . 0.2794 0.0000 0.2065 . . . . . . . 4 . . . # _struct.entry_id 7Y19 _struct.title 'Transcriptional regulator BrpR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Y19 _struct_keywords.text 'Vibrio vulnificus, biofilm, colony morphology, transcriptional regulator, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 22 ? VAL A 31 ? GLU A 22 VAL A 31 1 ? 10 HELX_P HELX_P2 AA2 ASP A 40 ? GLY A 52 ? ASP A 40 GLY A 52 1 ? 13 HELX_P HELX_P3 AA3 SER A 66 ? HIS A 77 ? SER A 66 HIS A 77 1 ? 12 HELX_P HELX_P4 AA4 ARG A 87 ? SER A 92 ? ARG A 87 SER A 92 5 ? 6 HELX_P HELX_P5 AA5 SER A 93 ? CYS A 104 ? SER A 93 CYS A 104 1 ? 12 HELX_P HELX_P6 AA6 PRO A 113 ? HIS A 123 ? PRO A 113 HIS A 123 1 ? 11 HELX_P HELX_P7 AA7 GLN A 124 ? TRP A 135 ? GLN A 124 TRP A 135 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LYS 6 C ? ? ? 1_555 A MSE 7 N ? ? A LYS 6 A MSE 7 1_555 ? ? ? ? ? ? ? 1.312 ? ? covale2 covale both ? A MSE 7 C ? ? ? 1_555 A ASP 8 N ? ? A MSE 7 A ASP 8 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale3 covale both ? A GLY 126 C ? ? ? 1_555 A MSE 127 N ? ? A GLY 126 A MSE 127 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 127 C ? ? ? 1_555 A LEU 128 N ? ? A MSE 127 A LEU 128 1_555 ? ? ? ? ? ? ? 1.335 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 34 ? CYS A 38 ? LYS A 34 CYS A 38 AA1 2 SER A 13 ? VAL A 17 ? SER A 13 VAL A 17 AA1 3 ILE A 55 ? ASP A 59 ? ILE A 55 ASP A 59 AA1 4 ARG A 81 ? ILE A 86 ? ARG A 81 ILE A 86 AA1 5 ASP A 106 ? THR A 109 ? ASP A 106 THR A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 34 ? O LYS A 34 N LEU A 14 ? N LEU A 14 AA1 2 3 N VAL A 15 ? N VAL A 15 O ILE A 57 ? O ILE A 57 AA1 3 4 N GLY A 56 ? N GLY A 56 O LEU A 83 ? O LEU A 83 AA1 4 5 N ALA A 84 ? N ALA A 84 O ASP A 106 ? O ASP A 106 # _atom_sites.entry_id 7Y19 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018776 _atom_sites.fract_transf_matrix[1][2] 0.010840 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021681 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006948 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 MSE 7 7 7 MSE MSE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 CYS 104 104 104 CYS CYS A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 MSE 127 127 127 MSE MSE A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 PHE 138 138 ? ? ? A . n A 1 139 GLY 139 139 ? ? ? A . n A 1 140 ASN 140 140 ? ? ? A . n A 1 141 ASN 141 141 ? ? ? A . n A 1 142 GLN 142 142 ? ? ? A . n A 1 143 ASP 143 143 ? ? ? A . n A 1 144 MSE 144 144 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email hanc210@snu.ac.kr _pdbx_contact_author.name_first Nam-Chul _pdbx_contact_author.name_last Ha _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4813-748X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 8 HOH HOH A . B 2 HOH 2 202 3 HOH HOH A . B 2 HOH 3 203 6 HOH HOH A . B 2 HOH 4 204 2 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 7 A MSE 7 ? MET 'modified residue' 2 A MSE 127 A MSE 127 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-07-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 7Y19 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OH _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 21 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 26 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 17 ? ? -59.41 88.33 2 1 THR A 20 ? ? 70.89 142.97 3 1 CYS A 35 ? ? -109.29 78.77 4 1 ASP A 63 ? ? -56.78 65.10 5 1 LEU A 67 ? ? -55.77 -6.28 6 1 ALA A 110 ? ? -54.87 -73.13 7 1 PRO A 136 ? ? -55.96 73.80 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A PHE 138 ? A PHE 138 7 1 Y 1 A GLY 139 ? A GLY 139 8 1 Y 1 A ASN 140 ? A ASN 140 9 1 Y 1 A ASN 141 ? A ASN 141 10 1 Y 1 A GLN 142 ? A GLN 142 11 1 Y 1 A ASP 143 ? A ASP 143 12 1 Y 1 A MSE 144 ? A MSE 144 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #