data_7Y6O # _entry.id 7Y6O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Y6O pdb_00007y6o 10.2210/pdb7y6o/pdb WWPDB D_1300030385 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Y6O _pdbx_database_status.recvd_initial_deposition_date 2022-06-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, Q.' 1 0000-0002-2398-4482 'Yu, Y.' 2 0000-0002-4491-3034 'Cheng, J.' 3 0000-0001-9238-6446 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 2522 _citation.page_last 2522 _citation.title 'Structural basis for the self-recognition of sDSCAM in Chelicerata.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-38205-1 _citation.pdbx_database_id_PubMed 37130844 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cheng, J.' 1 ? primary 'Yu, Y.' 2 0000-0002-4491-3034 primary 'Wang, X.' 3 ? primary 'Zheng, X.' 4 ? primary 'Liu, T.' 5 ? primary 'Hu, D.' 6 ? primary 'Jin, Y.' 7 0000-0001-7125-7055 primary 'Lai, Y.' 8 0000-0001-5347-5155 primary 'Fu, T.M.' 9 0000-0002-6281-1752 primary 'Chen, Q.' 10 0000-0002-2398-4482 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 7Y6O _cell.details ? _cell.formula_units_Z ? _cell.length_a 117.484 _cell.length_a_esd ? _cell.length_b 117.484 _cell.length_b_esd ? _cell.length_c 171.494 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7Y6O _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Down Syndrome Cell Adhesion Molecules' 32536.781 1 ? ? ? ? 2 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSPPIINHFHFSKDIKEGERQQVICGLKSGDPPFTFSWLKDGIDIKNFPEINIVDVPVSYISVLVISSVEAKHIGNYTCI IKNSNGMDSYTATLMMKVPPRWVKEPTDVAATLGSRLTIDCSATGYPQPQITWDKLTDRSEHQLPVGSDSQRTLASNGSL TFLRVDESDKGVYICQAYNGIGNGLQKKIHLTVHVAPKVKEDFTVITVRKGFTAHLKCEVFGEPPLNIIWKKEDKIIAGE KGSRFETLQENTANGATSDTLINDSQQNDSGIYTCHVSSQFGEAEGKIQLVVLES ; _entity_poly.pdbx_seq_one_letter_code_can ;GSPPIINHFHFSKDIKEGERQQVICGLKSGDPPFTFSWLKDGIDIKNFPEINIVDVPVSYISVLVISSVEAKHIGNYTCI IKNSNGMDSYTATLMMKVPPRWVKEPTDVAATLGSRLTIDCSATGYPQPQITWDKLTDRSEHQLPVGSDSQRTLASNGSL TFLRVDESDKGVYICQAYNGIGNGLQKKIHLTVHVAPKVKEDFTVITVRKGFTAHLKCEVFGEPPLNIIWKKEDKIIAGE KGSRFETLQENTANGATSDTLINDSQQNDSGIYTCHVSSQFGEAEGKIQLVVLES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 PRO n 1 5 ILE n 1 6 ILE n 1 7 ASN n 1 8 HIS n 1 9 PHE n 1 10 HIS n 1 11 PHE n 1 12 SER n 1 13 LYS n 1 14 ASP n 1 15 ILE n 1 16 LYS n 1 17 GLU n 1 18 GLY n 1 19 GLU n 1 20 ARG n 1 21 GLN n 1 22 GLN n 1 23 VAL n 1 24 ILE n 1 25 CYS n 1 26 GLY n 1 27 LEU n 1 28 LYS n 1 29 SER n 1 30 GLY n 1 31 ASP n 1 32 PRO n 1 33 PRO n 1 34 PHE n 1 35 THR n 1 36 PHE n 1 37 SER n 1 38 TRP n 1 39 LEU n 1 40 LYS n 1 41 ASP n 1 42 GLY n 1 43 ILE n 1 44 ASP n 1 45 ILE n 1 46 LYS n 1 47 ASN n 1 48 PHE n 1 49 PRO n 1 50 GLU n 1 51 ILE n 1 52 ASN n 1 53 ILE n 1 54 VAL n 1 55 ASP n 1 56 VAL n 1 57 PRO n 1 58 VAL n 1 59 SER n 1 60 TYR n 1 61 ILE n 1 62 SER n 1 63 VAL n 1 64 LEU n 1 65 VAL n 1 66 ILE n 1 67 SER n 1 68 SER n 1 69 VAL n 1 70 GLU n 1 71 ALA n 1 72 LYS n 1 73 HIS n 1 74 ILE n 1 75 GLY n 1 76 ASN n 1 77 TYR n 1 78 THR n 1 79 CYS n 1 80 ILE n 1 81 ILE n 1 82 LYS n 1 83 ASN n 1 84 SER n 1 85 ASN n 1 86 GLY n 1 87 MET n 1 88 ASP n 1 89 SER n 1 90 TYR n 1 91 THR n 1 92 ALA n 1 93 THR n 1 94 LEU n 1 95 MET n 1 96 MET n 1 97 LYS n 1 98 VAL n 1 99 PRO n 1 100 PRO n 1 101 ARG n 1 102 TRP n 1 103 VAL n 1 104 LYS n 1 105 GLU n 1 106 PRO n 1 107 THR n 1 108 ASP n 1 109 VAL n 1 110 ALA n 1 111 ALA n 1 112 THR n 1 113 LEU n 1 114 GLY n 1 115 SER n 1 116 ARG n 1 117 LEU n 1 118 THR n 1 119 ILE n 1 120 ASP n 1 121 CYS n 1 122 SER n 1 123 ALA n 1 124 THR n 1 125 GLY n 1 126 TYR n 1 127 PRO n 1 128 GLN n 1 129 PRO n 1 130 GLN n 1 131 ILE n 1 132 THR n 1 133 TRP n 1 134 ASP n 1 135 LYS n 1 136 LEU n 1 137 THR n 1 138 ASP n 1 139 ARG n 1 140 SER n 1 141 GLU n 1 142 HIS n 1 143 GLN n 1 144 LEU n 1 145 PRO n 1 146 VAL n 1 147 GLY n 1 148 SER n 1 149 ASP n 1 150 SER n 1 151 GLN n 1 152 ARG n 1 153 THR n 1 154 LEU n 1 155 ALA n 1 156 SER n 1 157 ASN n 1 158 GLY n 1 159 SER n 1 160 LEU n 1 161 THR n 1 162 PHE n 1 163 LEU n 1 164 ARG n 1 165 VAL n 1 166 ASP n 1 167 GLU n 1 168 SER n 1 169 ASP n 1 170 LYS n 1 171 GLY n 1 172 VAL n 1 173 TYR n 1 174 ILE n 1 175 CYS n 1 176 GLN n 1 177 ALA n 1 178 TYR n 1 179 ASN n 1 180 GLY n 1 181 ILE n 1 182 GLY n 1 183 ASN n 1 184 GLY n 1 185 LEU n 1 186 GLN n 1 187 LYS n 1 188 LYS n 1 189 ILE n 1 190 HIS n 1 191 LEU n 1 192 THR n 1 193 VAL n 1 194 HIS n 1 195 VAL n 1 196 ALA n 1 197 PRO n 1 198 LYS n 1 199 VAL n 1 200 LYS n 1 201 GLU n 1 202 ASP n 1 203 PHE n 1 204 THR n 1 205 VAL n 1 206 ILE n 1 207 THR n 1 208 VAL n 1 209 ARG n 1 210 LYS n 1 211 GLY n 1 212 PHE n 1 213 THR n 1 214 ALA n 1 215 HIS n 1 216 LEU n 1 217 LYS n 1 218 CYS n 1 219 GLU n 1 220 VAL n 1 221 PHE n 1 222 GLY n 1 223 GLU n 1 224 PRO n 1 225 PRO n 1 226 LEU n 1 227 ASN n 1 228 ILE n 1 229 ILE n 1 230 TRP n 1 231 LYS n 1 232 LYS n 1 233 GLU n 1 234 ASP n 1 235 LYS n 1 236 ILE n 1 237 ILE n 1 238 ALA n 1 239 GLY n 1 240 GLU n 1 241 LYS n 1 242 GLY n 1 243 SER n 1 244 ARG n 1 245 PHE n 1 246 GLU n 1 247 THR n 1 248 LEU n 1 249 GLN n 1 250 GLU n 1 251 ASN n 1 252 THR n 1 253 ALA n 1 254 ASN n 1 255 GLY n 1 256 ALA n 1 257 THR n 1 258 SER n 1 259 ASP n 1 260 THR n 1 261 LEU n 1 262 ILE n 1 263 ASN n 1 264 ASP n 1 265 SER n 1 266 GLN n 1 267 GLN n 1 268 ASN n 1 269 ASP n 1 270 SER n 1 271 GLY n 1 272 ILE n 1 273 TYR n 1 274 THR n 1 275 CYS n 1 276 HIS n 1 277 VAL n 1 278 SER n 1 279 SER n 1 280 GLN n 1 281 PHE n 1 282 GLY n 1 283 GLU n 1 284 ALA n 1 285 GLU n 1 286 GLY n 1 287 LYS n 1 288 ILE n 1 289 GLN n 1 290 LEU n 1 291 VAL n 1 292 VAL n 1 293 LEU n 1 294 GLU n 1 295 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 295 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name Chelicerata _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6843 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Trichoplusia ni' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7111 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7Y6O _struct_ref.pdbx_db_accession 7Y6O _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Y6O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 295 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7Y6O _struct_ref_seq.db_align_beg -1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 293 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -1 _struct_ref_seq.pdbx_auth_seq_align_end 293 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Y6O _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M KSCN, 15% (w/v) PEG 2,000, 0.1 M Glycine, 0.1 M Bis-Tris pH6.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-06-17 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97890 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97890 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7Y6O _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.10 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8498 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.001 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.118 _reflns.pdbx_Rpim_I_all 0.030 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 135929 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.985 _reflns.pdbx_CC_star 0.996 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.114 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.10 3.17 ? ? ? ? ? ? 565 ? ? ? ? ? ? ? ? ? ? ? 12.2 0.935 ? ? 0.957 0.261 ? 1 1 0.903 0.974 ? 99.6 ? 0.917 ? ? ? ? ? ? ? ? ? 3.17 3.25 ? ? ? ? ? ? 538 ? ? ? ? ? ? ? ? ? ? ? 14.2 0.982 ? ? 0.736 0.191 ? 2 1 0.964 0.991 ? 99.8 ? 0.710 ? ? ? ? ? ? ? ? ? 3.25 3.34 ? ? ? ? ? ? 561 ? ? ? ? ? ? ? ? ? ? ? 15.0 0.960 ? ? 0.691 0.176 ? 3 1 0.951 0.987 ? 100.0 ? 0.668 ? ? ? ? ? ? ? ? ? 3.34 3.44 ? ? ? ? ? ? 556 ? ? ? ? ? ? ? ? ? ? ? 16.4 1.053 ? ? 0.523 0.128 ? 4 1 0.980 0.995 ? 100.0 ? 0.507 ? ? ? ? ? ? ? ? ? 3.44 3.55 ? ? ? ? ? ? 569 ? ? ? ? ? ? ? ? ? ? ? 17.4 1.054 ? ? 0.401 0.096 ? 5 1 0.989 0.997 ? 100.0 ? 0.389 ? ? ? ? ? ? ? ? ? 3.55 3.68 ? ? ? ? ? ? 558 ? ? ? ? ? ? ? ? ? ? ? 17.4 1.007 ? ? 0.317 0.076 ? 6 1 0.994 0.998 ? 100.0 ? 0.308 ? ? ? ? ? ? ? ? ? 3.68 3.82 ? ? ? ? ? ? 550 ? ? ? ? ? ? ? ? ? ? ? 17.1 1.054 ? ? 0.247 0.059 ? 7 1 0.996 0.999 ? 100.0 ? 0.240 ? ? ? ? ? ? ? ? ? 3.82 4.00 ? ? ? ? ? ? 564 ? ? ? ? ? ? ? ? ? ? ? 16.4 1.036 ? ? 0.195 0.048 ? 8 1 0.994 0.998 ? 100.0 ? 0.189 ? ? ? ? ? ? ? ? ? 4.00 4.21 ? ? ? ? ? ? 570 ? ? ? ? ? ? ? ? ? ? ? 15.8 1.050 ? ? 0.157 0.039 ? 9 1 0.993 0.998 ? 100.0 ? 0.152 ? ? ? ? ? ? ? ? ? 4.21 4.47 ? ? ? ? ? ? 562 ? ? ? ? ? ? ? ? ? ? ? 17.2 1.126 ? ? 0.137 0.033 ? 10 1 0.995 0.999 ? 100.0 ? 0.133 ? ? ? ? ? ? ? ? ? 4.47 4.82 ? ? ? ? ? ? 559 ? ? ? ? ? ? ? ? ? ? ? 17.2 1.108 ? ? 0.124 0.030 ? 11 1 0.996 0.999 ? 100.0 ? 0.121 ? ? ? ? ? ? ? ? ? 4.82 5.30 ? ? ? ? ? ? 576 ? ? ? ? ? ? ? ? ? ? ? 16.3 1.061 ? ? 0.116 0.028 ? 12 1 0.996 0.999 ? 100.0 ? 0.113 ? ? ? ? ? ? ? ? ? 5.30 6.06 ? ? ? ? ? ? 574 ? ? ? ? ? ? ? ? ? ? ? 16.4 0.920 ? ? 0.102 0.025 ? 13 1 0.998 1.000 ? 100.0 ? 0.098 ? ? ? ? ? ? ? ? ? 6.06 7.64 ? ? ? ? ? ? 577 ? ? ? ? ? ? ? ? ? ? ? 16.5 0.816 ? ? 0.097 0.024 ? 14 1 0.997 0.999 ? 100.0 ? 0.094 ? ? ? ? ? ? ? ? ? 7.64 50.00 ? ? ? ? ? ? 619 ? ? ? ? ? ? ? ? ? ? ? 14.7 0.816 ? ? 0.091 0.024 ? 15 1 0.996 0.999 ? 99.8 ? 0.088 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Y6O _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.102 _refine.ls_d_res_low 33.915 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7501 _refine.ls_number_reflns_R_free 354 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 88.49 _refine.ls_percent_reflns_R_free 4.72 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2529 _refine.ls_R_factor_R_free 0.2874 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2511 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6ZR7 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.38 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.52 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.102 _refine_hist.d_res_low 33.915 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2248 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2234 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 2295 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.763 ? 3119 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 4.523 ? 845 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.107 ? 360 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 401 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.102 3.5502 . . 90 1743 66.00 . . . . 0.3005 . . . . . . . . . . . 0.3795 'X-RAY DIFFRACTION' 3.5502 4.4713 . . 111 2679 100.00 . . . . 0.2481 . . . . . . . . . . . 0.2822 'X-RAY DIFFRACTION' 4.4713 33.915 . . 153 2725 99.00 . . . . 0.2374 . . . . . . . . . . . 0.2584 # _struct.entry_id 7Y6O _struct.title 'Crystal structure of sDscam Ig1-3 domains, isoform alpha25' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Y6O _struct_keywords.text 'cell surface receptor, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 57 ? SER A 59 ? PRO A 55 SER A 57 5 ? 3 HELX_P HELX_P2 AA2 GLU A 70 ? ILE A 74 ? GLU A 68 ILE A 72 5 ? 5 HELX_P HELX_P3 AA3 ASP A 166 ? LYS A 170 ? ASP A 164 LYS A 168 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 23 A CYS 77 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf2 disulf ? ? A CYS 121 SG ? ? ? 1_555 A CYS 175 SG ? ? A CYS 119 A CYS 173 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf3 disulf ? ? A CYS 218 SG ? ? ? 1_555 A CYS 275 SG ? ? A CYS 216 A CYS 273 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 32 A . ? PRO 30 A PRO 33 A ? PRO 31 A 1 1.28 2 TYR 126 A . ? TYR 124 A PRO 127 A ? PRO 125 A 1 -1.94 3 PRO 224 A . ? PRO 222 A PRO 225 A ? PRO 223 A 1 3.41 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 5 ? AA5 ? 3 ? AA6 ? 4 ? AA7 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA7 1 2 ? parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA7 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 5 ? ASN A 7 ? ILE A 3 ASN A 5 AA1 2 GLN A 21 ? SER A 29 ? GLN A 19 SER A 27 AA1 3 ILE A 61 ? ILE A 66 ? ILE A 59 ILE A 64 AA1 4 ILE A 51 ? VAL A 56 ? ILE A 49 VAL A 54 AA2 1 ILE A 43 ? ASP A 44 ? ILE A 41 ASP A 42 AA2 2 THR A 35 ? LYS A 40 ? THR A 33 LYS A 38 AA2 3 GLY A 75 ? ASN A 83 ? GLY A 73 ASN A 81 AA2 4 GLY A 86 ? LEU A 94 ? GLY A 84 LEU A 92 AA3 1 VAL A 98 ? LYS A 104 ? VAL A 96 LYS A 102 AA3 2 SER A 122 ? TYR A 126 ? SER A 120 TYR A 124 AA4 1 VAL A 109 ? THR A 112 ? VAL A 107 THR A 110 AA4 2 LEU A 185 ? HIS A 194 ? LEU A 183 HIS A 192 AA4 3 GLY A 171 ? TYR A 178 ? GLY A 169 TYR A 176 AA4 4 GLN A 130 ? THR A 137 ? GLN A 128 THR A 135 AA4 5 HIS A 142 ? PRO A 145 ? HIS A 140 PRO A 143 AA5 1 THR A 118 ? ILE A 119 ? THR A 116 ILE A 117 AA5 2 LEU A 160 ? PHE A 162 ? LEU A 158 PHE A 160 AA5 3 ARG A 152 ? LEU A 154 ? ARG A 150 LEU A 152 AA6 1 LYS A 198 ? VAL A 199 ? LYS A 196 VAL A 197 AA6 2 ALA A 214 ? PHE A 221 ? ALA A 212 PHE A 219 AA6 3 GLY A 255 ? ILE A 262 ? GLY A 253 ILE A 260 AA6 4 GLU A 246 ? ASN A 251 ? GLU A 244 ASN A 249 AA7 1 VAL A 205 ? ARG A 209 ? VAL A 203 ARG A 207 AA7 2 GLU A 283 ? LEU A 293 ? GLU A 281 LEU A 291 AA7 3 GLY A 271 ? SER A 278 ? GLY A 269 SER A 276 AA7 4 ASN A 227 ? LYS A 232 ? ASN A 225 LYS A 230 AA7 5 LYS A 235 ? ILE A 236 ? LYS A 233 ILE A 234 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 7 ? N ASN A 5 O GLY A 26 ? O GLY A 24 AA1 2 3 N CYS A 25 ? N CYS A 23 O SER A 62 ? O SER A 60 AA1 3 4 O VAL A 63 ? O VAL A 61 N VAL A 54 ? N VAL A 52 AA2 1 2 O ILE A 43 ? O ILE A 41 N LYS A 40 ? N LYS A 38 AA2 2 3 N SER A 37 ? N SER A 35 O ILE A 80 ? O ILE A 78 AA2 3 4 N TYR A 77 ? N TYR A 75 O ALA A 92 ? O ALA A 90 AA3 1 2 N ARG A 101 ? N ARG A 99 O THR A 124 ? O THR A 122 AA4 1 2 N ALA A 111 ? N ALA A 109 O HIS A 194 ? O HIS A 192 AA4 2 3 O LEU A 185 ? O LEU A 183 N ALA A 177 ? N ALA A 175 AA4 3 4 O ILE A 174 ? O ILE A 172 N ASP A 134 ? N ASP A 132 AA4 4 5 N LYS A 135 ? N LYS A 133 O LEU A 144 ? O LEU A 142 AA5 1 2 N ILE A 119 ? N ILE A 117 O LEU A 160 ? O LEU A 158 AA5 2 3 O THR A 161 ? O THR A 159 N THR A 153 ? N THR A 151 AA6 1 2 N LYS A 198 ? N LYS A 196 O PHE A 221 ? O PHE A 219 AA6 2 3 N LEU A 216 ? N LEU A 214 O THR A 260 ? O THR A 258 AA6 3 4 O THR A 257 ? O THR A 255 N GLU A 250 ? N GLU A 248 AA7 1 2 N ILE A 206 ? N ILE A 204 O GLN A 289 ? O GLN A 287 AA7 2 3 O ILE A 288 ? O ILE A 286 N TYR A 273 ? N TYR A 271 AA7 3 4 O HIS A 276 ? O HIS A 274 N ILE A 229 ? N ILE A 227 AA7 4 5 N LYS A 232 ? N LYS A 230 O LYS A 235 ? O LYS A 233 # _atom_sites.entry_id 7Y6O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008512 _atom_sites.fract_transf_matrix[1][2] 0.004914 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009829 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005831 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 PRO 3 1 1 PRO PRO A . n A 1 4 PRO 4 2 2 PRO PRO A . n A 1 5 ILE 5 3 3 ILE ILE A . n A 1 6 ILE 6 4 4 ILE ILE A . n A 1 7 ASN 7 5 5 ASN ASN A . n A 1 8 HIS 8 6 6 HIS HIS A . n A 1 9 PHE 9 7 7 PHE PHE A . n A 1 10 HIS 10 8 8 HIS HIS A . n A 1 11 PHE 11 9 9 PHE PHE A . n A 1 12 SER 12 10 10 SER SER A . n A 1 13 LYS 13 11 11 LYS LYS A . n A 1 14 ASP 14 12 12 ASP ASP A . n A 1 15 ILE 15 13 13 ILE ILE A . n A 1 16 LYS 16 14 14 LYS LYS A . n A 1 17 GLU 17 15 15 GLU GLU A . n A 1 18 GLY 18 16 16 GLY GLY A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 ARG 20 18 18 ARG ARG A . n A 1 21 GLN 21 19 19 GLN GLN A . n A 1 22 GLN 22 20 20 GLN GLN A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 ILE 24 22 22 ILE ILE A . n A 1 25 CYS 25 23 23 CYS CYS A . n A 1 26 GLY 26 24 24 GLY GLY A . n A 1 27 LEU 27 25 25 LEU LEU A . n A 1 28 LYS 28 26 26 LYS LYS A . n A 1 29 SER 29 27 27 SER SER A . n A 1 30 GLY 30 28 28 GLY GLY A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 PRO 32 30 30 PRO PRO A . n A 1 33 PRO 33 31 31 PRO PRO A . n A 1 34 PHE 34 32 32 PHE PHE A . n A 1 35 THR 35 33 33 THR THR A . n A 1 36 PHE 36 34 34 PHE PHE A . n A 1 37 SER 37 35 35 SER SER A . n A 1 38 TRP 38 36 36 TRP TRP A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 ASP 41 39 39 ASP ASP A . n A 1 42 GLY 42 40 40 GLY GLY A . n A 1 43 ILE 43 41 41 ILE ILE A . n A 1 44 ASP 44 42 42 ASP ASP A . n A 1 45 ILE 45 43 43 ILE ILE A . n A 1 46 LYS 46 44 44 LYS LYS A . n A 1 47 ASN 47 45 45 ASN ASN A . n A 1 48 PHE 48 46 46 PHE PHE A . n A 1 49 PRO 49 47 47 PRO PRO A . n A 1 50 GLU 50 48 48 GLU GLU A . n A 1 51 ILE 51 49 49 ILE ILE A . n A 1 52 ASN 52 50 50 ASN ASN A . n A 1 53 ILE 53 51 51 ILE ILE A . n A 1 54 VAL 54 52 52 VAL VAL A . n A 1 55 ASP 55 53 53 ASP ASP A . n A 1 56 VAL 56 54 54 VAL VAL A . n A 1 57 PRO 57 55 55 PRO PRO A . n A 1 58 VAL 58 56 56 VAL VAL A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 TYR 60 58 58 TYR TYR A . n A 1 61 ILE 61 59 59 ILE ILE A . n A 1 62 SER 62 60 60 SER SER A . n A 1 63 VAL 63 61 61 VAL VAL A . n A 1 64 LEU 64 62 62 LEU LEU A . n A 1 65 VAL 65 63 63 VAL VAL A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 SER 67 65 65 SER SER A . n A 1 68 SER 68 66 66 SER SER A . n A 1 69 VAL 69 67 67 VAL VAL A . n A 1 70 GLU 70 68 68 GLU GLU A . n A 1 71 ALA 71 69 69 ALA ALA A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 HIS 73 71 71 HIS HIS A . n A 1 74 ILE 74 72 72 ILE ILE A . n A 1 75 GLY 75 73 73 GLY GLY A . n A 1 76 ASN 76 74 74 ASN ASN A . n A 1 77 TYR 77 75 75 TYR TYR A . n A 1 78 THR 78 76 76 THR THR A . n A 1 79 CYS 79 77 77 CYS CYS A . n A 1 80 ILE 80 78 78 ILE ILE A . n A 1 81 ILE 81 79 79 ILE ILE A . n A 1 82 LYS 82 80 80 LYS LYS A . n A 1 83 ASN 83 81 81 ASN ASN A . n A 1 84 SER 84 82 82 SER SER A . n A 1 85 ASN 85 83 83 ASN ASN A . n A 1 86 GLY 86 84 84 GLY GLY A . n A 1 87 MET 87 85 85 MET MET A . n A 1 88 ASP 88 86 86 ASP ASP A . n A 1 89 SER 89 87 87 SER SER A . n A 1 90 TYR 90 88 88 TYR TYR A . n A 1 91 THR 91 89 89 THR THR A . n A 1 92 ALA 92 90 90 ALA ALA A . n A 1 93 THR 93 91 91 THR THR A . n A 1 94 LEU 94 92 92 LEU LEU A . n A 1 95 MET 95 93 93 MET MET A . n A 1 96 MET 96 94 94 MET MET A . n A 1 97 LYS 97 95 95 LYS LYS A . n A 1 98 VAL 98 96 96 VAL VAL A . n A 1 99 PRO 99 97 97 PRO PRO A . n A 1 100 PRO 100 98 98 PRO PRO A . n A 1 101 ARG 101 99 99 ARG ARG A . n A 1 102 TRP 102 100 100 TRP TRP A . n A 1 103 VAL 103 101 101 VAL VAL A . n A 1 104 LYS 104 102 102 LYS LYS A . n A 1 105 GLU 105 103 103 GLU GLU A . n A 1 106 PRO 106 104 104 PRO PRO A . n A 1 107 THR 107 105 105 THR THR A . n A 1 108 ASP 108 106 106 ASP ASP A . n A 1 109 VAL 109 107 107 VAL VAL A . n A 1 110 ALA 110 108 108 ALA ALA A . n A 1 111 ALA 111 109 109 ALA ALA A . n A 1 112 THR 112 110 110 THR THR A . n A 1 113 LEU 113 111 111 LEU LEU A . n A 1 114 GLY 114 112 112 GLY GLY A . n A 1 115 SER 115 113 113 SER SER A . n A 1 116 ARG 116 114 114 ARG ARG A . n A 1 117 LEU 117 115 115 LEU LEU A . n A 1 118 THR 118 116 116 THR THR A . n A 1 119 ILE 119 117 117 ILE ILE A . n A 1 120 ASP 120 118 118 ASP ASP A . n A 1 121 CYS 121 119 119 CYS CYS A . n A 1 122 SER 122 120 120 SER SER A . n A 1 123 ALA 123 121 121 ALA ALA A . n A 1 124 THR 124 122 122 THR THR A . n A 1 125 GLY 125 123 123 GLY GLY A . n A 1 126 TYR 126 124 124 TYR TYR A . n A 1 127 PRO 127 125 125 PRO PRO A . n A 1 128 GLN 128 126 126 GLN GLN A . n A 1 129 PRO 129 127 127 PRO PRO A . n A 1 130 GLN 130 128 128 GLN GLN A . n A 1 131 ILE 131 129 129 ILE ILE A . n A 1 132 THR 132 130 130 THR THR A . n A 1 133 TRP 133 131 131 TRP TRP A . n A 1 134 ASP 134 132 132 ASP ASP A . n A 1 135 LYS 135 133 133 LYS LYS A . n A 1 136 LEU 136 134 134 LEU LEU A . n A 1 137 THR 137 135 135 THR THR A . n A 1 138 ASP 138 136 136 ASP ASP A . n A 1 139 ARG 139 137 137 ARG ARG A . n A 1 140 SER 140 138 138 SER SER A . n A 1 141 GLU 141 139 139 GLU GLU A . n A 1 142 HIS 142 140 140 HIS HIS A . n A 1 143 GLN 143 141 141 GLN GLN A . n A 1 144 LEU 144 142 142 LEU LEU A . n A 1 145 PRO 145 143 143 PRO PRO A . n A 1 146 VAL 146 144 144 VAL VAL A . n A 1 147 GLY 147 145 145 GLY GLY A . n A 1 148 SER 148 146 146 SER SER A . n A 1 149 ASP 149 147 147 ASP ASP A . n A 1 150 SER 150 148 148 SER SER A . n A 1 151 GLN 151 149 149 GLN GLN A . n A 1 152 ARG 152 150 150 ARG ARG A . n A 1 153 THR 153 151 151 THR THR A . n A 1 154 LEU 154 152 152 LEU LEU A . n A 1 155 ALA 155 153 153 ALA ALA A . n A 1 156 SER 156 154 154 SER SER A . n A 1 157 ASN 157 155 155 ASN ASN A . n A 1 158 GLY 158 156 156 GLY GLY A . n A 1 159 SER 159 157 157 SER SER A . n A 1 160 LEU 160 158 158 LEU LEU A . n A 1 161 THR 161 159 159 THR THR A . n A 1 162 PHE 162 160 160 PHE PHE A . n A 1 163 LEU 163 161 161 LEU LEU A . n A 1 164 ARG 164 162 162 ARG ARG A . n A 1 165 VAL 165 163 163 VAL VAL A . n A 1 166 ASP 166 164 164 ASP ASP A . n A 1 167 GLU 167 165 165 GLU GLU A . n A 1 168 SER 168 166 166 SER SER A . n A 1 169 ASP 169 167 167 ASP ASP A . n A 1 170 LYS 170 168 168 LYS LYS A . n A 1 171 GLY 171 169 169 GLY GLY A . n A 1 172 VAL 172 170 170 VAL VAL A . n A 1 173 TYR 173 171 171 TYR TYR A . n A 1 174 ILE 174 172 172 ILE ILE A . n A 1 175 CYS 175 173 173 CYS CYS A . n A 1 176 GLN 176 174 174 GLN GLN A . n A 1 177 ALA 177 175 175 ALA ALA A . n A 1 178 TYR 178 176 176 TYR TYR A . n A 1 179 ASN 179 177 177 ASN ASN A . n A 1 180 GLY 180 178 178 GLY GLY A . n A 1 181 ILE 181 179 179 ILE ILE A . n A 1 182 GLY 182 180 180 GLY GLY A . n A 1 183 ASN 183 181 181 ASN ASN A . n A 1 184 GLY 184 182 182 GLY GLY A . n A 1 185 LEU 185 183 183 LEU LEU A . n A 1 186 GLN 186 184 184 GLN GLN A . n A 1 187 LYS 187 185 185 LYS LYS A . n A 1 188 LYS 188 186 186 LYS LYS A . n A 1 189 ILE 189 187 187 ILE ILE A . n A 1 190 HIS 190 188 188 HIS HIS A . n A 1 191 LEU 191 189 189 LEU LEU A . n A 1 192 THR 192 190 190 THR THR A . n A 1 193 VAL 193 191 191 VAL VAL A . n A 1 194 HIS 194 192 192 HIS HIS A . n A 1 195 VAL 195 193 193 VAL VAL A . n A 1 196 ALA 196 194 194 ALA ALA A . n A 1 197 PRO 197 195 195 PRO PRO A . n A 1 198 LYS 198 196 196 LYS LYS A . n A 1 199 VAL 199 197 197 VAL VAL A . n A 1 200 LYS 200 198 198 LYS LYS A . n A 1 201 GLU 201 199 199 GLU GLU A . n A 1 202 ASP 202 200 200 ASP ASP A . n A 1 203 PHE 203 201 201 PHE PHE A . n A 1 204 THR 204 202 202 THR THR A . n A 1 205 VAL 205 203 203 VAL VAL A . n A 1 206 ILE 206 204 204 ILE ILE A . n A 1 207 THR 207 205 205 THR THR A . n A 1 208 VAL 208 206 206 VAL VAL A . n A 1 209 ARG 209 207 207 ARG ARG A . n A 1 210 LYS 210 208 208 LYS LYS A . n A 1 211 GLY 211 209 209 GLY GLY A . n A 1 212 PHE 212 210 210 PHE PHE A . n A 1 213 THR 213 211 211 THR THR A . n A 1 214 ALA 214 212 212 ALA ALA A . n A 1 215 HIS 215 213 213 HIS HIS A . n A 1 216 LEU 216 214 214 LEU LEU A . n A 1 217 LYS 217 215 215 LYS LYS A . n A 1 218 CYS 218 216 216 CYS CYS A . n A 1 219 GLU 219 217 217 GLU GLU A . n A 1 220 VAL 220 218 218 VAL VAL A . n A 1 221 PHE 221 219 219 PHE PHE A . n A 1 222 GLY 222 220 220 GLY GLY A . n A 1 223 GLU 223 221 221 GLU GLU A . n A 1 224 PRO 224 222 222 PRO PRO A . n A 1 225 PRO 225 223 223 PRO PRO A . n A 1 226 LEU 226 224 224 LEU LEU A . n A 1 227 ASN 227 225 225 ASN ASN A . n A 1 228 ILE 228 226 226 ILE ILE A . n A 1 229 ILE 229 227 227 ILE ILE A . n A 1 230 TRP 230 228 228 TRP TRP A . n A 1 231 LYS 231 229 229 LYS LYS A . n A 1 232 LYS 232 230 230 LYS LYS A . n A 1 233 GLU 233 231 231 GLU GLU A . n A 1 234 ASP 234 232 232 ASP ASP A . n A 1 235 LYS 235 233 233 LYS LYS A . n A 1 236 ILE 236 234 234 ILE ILE A . n A 1 237 ILE 237 235 235 ILE ILE A . n A 1 238 ALA 238 236 236 ALA ALA A . n A 1 239 GLY 239 237 ? ? ? A . n A 1 240 GLU 240 238 ? ? ? A . n A 1 241 LYS 241 239 ? ? ? A . n A 1 242 GLY 242 240 ? ? ? A . n A 1 243 SER 243 241 ? ? ? A . n A 1 244 ARG 244 242 ? ? ? A . n A 1 245 PHE 245 243 243 PHE PHE A . n A 1 246 GLU 246 244 244 GLU GLU A . n A 1 247 THR 247 245 245 THR THR A . n A 1 248 LEU 248 246 246 LEU LEU A . n A 1 249 GLN 249 247 247 GLN GLN A . n A 1 250 GLU 250 248 248 GLU GLU A . n A 1 251 ASN 251 249 249 ASN ASN A . n A 1 252 THR 252 250 250 THR THR A . n A 1 253 ALA 253 251 251 ALA ALA A . n A 1 254 ASN 254 252 252 ASN ASN A . n A 1 255 GLY 255 253 253 GLY GLY A . n A 1 256 ALA 256 254 254 ALA ALA A . n A 1 257 THR 257 255 255 THR THR A . n A 1 258 SER 258 256 256 SER SER A . n A 1 259 ASP 259 257 257 ASP ASP A . n A 1 260 THR 260 258 258 THR THR A . n A 1 261 LEU 261 259 259 LEU LEU A . n A 1 262 ILE 262 260 260 ILE ILE A . n A 1 263 ASN 263 261 261 ASN ASN A . n A 1 264 ASP 264 262 262 ASP ASP A . n A 1 265 SER 265 263 263 SER SER A . n A 1 266 GLN 266 264 264 GLN GLN A . n A 1 267 GLN 267 265 265 GLN GLN A . n A 1 268 ASN 268 266 266 ASN ASN A . n A 1 269 ASP 269 267 267 ASP ASP A . n A 1 270 SER 270 268 268 SER SER A . n A 1 271 GLY 271 269 269 GLY GLY A . n A 1 272 ILE 272 270 270 ILE ILE A . n A 1 273 TYR 273 271 271 TYR TYR A . n A 1 274 THR 274 272 272 THR THR A . n A 1 275 CYS 275 273 273 CYS CYS A . n A 1 276 HIS 276 274 274 HIS HIS A . n A 1 277 VAL 277 275 275 VAL VAL A . n A 1 278 SER 278 276 276 SER SER A . n A 1 279 SER 279 277 277 SER SER A . n A 1 280 GLN 280 278 278 GLN GLN A . n A 1 281 PHE 281 279 279 PHE PHE A . n A 1 282 GLY 282 280 280 GLY GLY A . n A 1 283 GLU 283 281 281 GLU GLU A . n A 1 284 ALA 284 282 282 ALA ALA A . n A 1 285 GLU 285 283 283 GLU GLU A . n A 1 286 GLY 286 284 284 GLY GLY A . n A 1 287 LYS 287 285 285 LYS LYS A . n A 1 288 ILE 288 286 286 ILE ILE A . n A 1 289 GLN 289 287 287 GLN GLN A . n A 1 290 LEU 290 288 288 LEU LEU A . n A 1 291 VAL 291 289 289 VAL VAL A . n A 1 292 VAL 292 290 290 VAL VAL A . n A 1 293 LEU 293 291 291 LEU LEU A . n A 1 294 GLU 294 292 292 GLU GLU A . n A 1 295 SER 295 293 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email qiang_chen@scu.edu.cn _pdbx_contact_author.name_first Qiang _pdbx_contact_author.name_last Chen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2398-4482 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id NAG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 1155 _pdbx_nonpoly_scheme.pdb_mon_id NAG _pdbx_nonpoly_scheme.auth_mon_id NAG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3710 ? 1 MORE -8 ? 1 'SSA (A^2)' 31150 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_455 y-1/3,x+1/3,-z+1/3 -0.5000000000 0.8660254038 0.0000000000 -58.7420000000 0.8660254038 0.5000000000 0.0000000000 33.9147095127 0.0000000000 0.0000000000 -1.0000000000 57.1646666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-24 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.15.2_3472: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7Y6O _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 138 ? ? -164.48 38.11 2 1 GLU A 139 ? ? 33.44 49.37 3 1 VAL A 144 ? ? -70.34 -75.01 4 1 GLN A 149 ? ? 82.15 14.18 5 1 ASP A 167 ? ? -96.67 54.18 6 1 CYS A 216 ? ? -161.04 83.38 7 1 THR A 250 ? ? -146.21 -159.90 8 1 ASN A 252 ? ? -80.00 23.01 9 1 ASP A 262 ? ? 63.74 102.01 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id NAG _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 301 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id NAG _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A GLY 237 ? A GLY 239 3 1 Y 1 A GLU 238 ? A GLU 240 4 1 Y 1 A LYS 239 ? A LYS 241 5 1 Y 1 A GLY 240 ? A GLY 242 6 1 Y 1 A SER 241 ? A SER 243 7 1 Y 1 A ARG 242 ? A ARG 244 8 1 Y 1 A SER 293 ? A SER 295 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 NAG C1 C N R 247 NAG C2 C N R 248 NAG C3 C N R 249 NAG C4 C N S 250 NAG C5 C N R 251 NAG C6 C N N 252 NAG C7 C N N 253 NAG C8 C N N 254 NAG N2 N N N 255 NAG O1 O N N 256 NAG O3 O N N 257 NAG O4 O N N 258 NAG O5 O N N 259 NAG O6 O N N 260 NAG O7 O N N 261 NAG H1 H N N 262 NAG H2 H N N 263 NAG H3 H N N 264 NAG H4 H N N 265 NAG H5 H N N 266 NAG H61 H N N 267 NAG H62 H N N 268 NAG H81 H N N 269 NAG H82 H N N 270 NAG H83 H N N 271 NAG HN2 H N N 272 NAG HO1 H N N 273 NAG HO3 H N N 274 NAG HO4 H N N 275 NAG HO6 H N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SER N N N N 317 SER CA C N S 318 SER C C N N 319 SER O O N N 320 SER CB C N N 321 SER OG O N N 322 SER OXT O N N 323 SER H H N N 324 SER H2 H N N 325 SER HA H N N 326 SER HB2 H N N 327 SER HB3 H N N 328 SER HG H N N 329 SER HXT H N N 330 THR N N N N 331 THR CA C N S 332 THR C C N N 333 THR O O N N 334 THR CB C N R 335 THR OG1 O N N 336 THR CG2 C N N 337 THR OXT O N N 338 THR H H N N 339 THR H2 H N N 340 THR HA H N N 341 THR HB H N N 342 THR HG1 H N N 343 THR HG21 H N N 344 THR HG22 H N N 345 THR HG23 H N N 346 THR HXT H N N 347 TRP N N N N 348 TRP CA C N S 349 TRP C C N N 350 TRP O O N N 351 TRP CB C N N 352 TRP CG C Y N 353 TRP CD1 C Y N 354 TRP CD2 C Y N 355 TRP NE1 N Y N 356 TRP CE2 C Y N 357 TRP CE3 C Y N 358 TRP CZ2 C Y N 359 TRP CZ3 C Y N 360 TRP CH2 C Y N 361 TRP OXT O N N 362 TRP H H N N 363 TRP H2 H N N 364 TRP HA H N N 365 TRP HB2 H N N 366 TRP HB3 H N N 367 TRP HD1 H N N 368 TRP HE1 H N N 369 TRP HE3 H N N 370 TRP HZ2 H N N 371 TRP HZ3 H N N 372 TRP HH2 H N N 373 TRP HXT H N N 374 TYR N N N N 375 TYR CA C N S 376 TYR C C N N 377 TYR O O N N 378 TYR CB C N N 379 TYR CG C Y N 380 TYR CD1 C Y N 381 TYR CD2 C Y N 382 TYR CE1 C Y N 383 TYR CE2 C Y N 384 TYR CZ C Y N 385 TYR OH O N N 386 TYR OXT O N N 387 TYR H H N N 388 TYR H2 H N N 389 TYR HA H N N 390 TYR HB2 H N N 391 TYR HB3 H N N 392 TYR HD1 H N N 393 TYR HD2 H N N 394 TYR HE1 H N N 395 TYR HE2 H N N 396 TYR HH H N N 397 TYR HXT H N N 398 VAL N N N N 399 VAL CA C N S 400 VAL C C N N 401 VAL O O N N 402 VAL CB C N N 403 VAL CG1 C N N 404 VAL CG2 C N N 405 VAL OXT O N N 406 VAL H H N N 407 VAL H2 H N N 408 VAL HA H N N 409 VAL HB H N N 410 VAL HG11 H N N 411 VAL HG12 H N N 412 VAL HG13 H N N 413 VAL HG21 H N N 414 VAL HG22 H N N 415 VAL HG23 H N N 416 VAL HXT H N N 417 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 NAG C1 C2 sing N N 235 NAG C1 O1 sing N N 236 NAG C1 O5 sing N N 237 NAG C1 H1 sing N N 238 NAG C2 C3 sing N N 239 NAG C2 N2 sing N N 240 NAG C2 H2 sing N N 241 NAG C3 C4 sing N N 242 NAG C3 O3 sing N N 243 NAG C3 H3 sing N N 244 NAG C4 C5 sing N N 245 NAG C4 O4 sing N N 246 NAG C4 H4 sing N N 247 NAG C5 C6 sing N N 248 NAG C5 O5 sing N N 249 NAG C5 H5 sing N N 250 NAG C6 O6 sing N N 251 NAG C6 H61 sing N N 252 NAG C6 H62 sing N N 253 NAG C7 C8 sing N N 254 NAG C7 N2 sing N N 255 NAG C7 O7 doub N N 256 NAG C8 H81 sing N N 257 NAG C8 H82 sing N N 258 NAG C8 H83 sing N N 259 NAG N2 HN2 sing N N 260 NAG O1 HO1 sing N N 261 NAG O3 HO3 sing N N 262 NAG O4 HO4 sing N N 263 NAG O6 HO6 sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TRP N CA sing N N 334 TRP N H sing N N 335 TRP N H2 sing N N 336 TRP CA C sing N N 337 TRP CA CB sing N N 338 TRP CA HA sing N N 339 TRP C O doub N N 340 TRP C OXT sing N N 341 TRP CB CG sing N N 342 TRP CB HB2 sing N N 343 TRP CB HB3 sing N N 344 TRP CG CD1 doub Y N 345 TRP CG CD2 sing Y N 346 TRP CD1 NE1 sing Y N 347 TRP CD1 HD1 sing N N 348 TRP CD2 CE2 doub Y N 349 TRP CD2 CE3 sing Y N 350 TRP NE1 CE2 sing Y N 351 TRP NE1 HE1 sing N N 352 TRP CE2 CZ2 sing Y N 353 TRP CE3 CZ3 doub Y N 354 TRP CE3 HE3 sing N N 355 TRP CZ2 CH2 doub Y N 356 TRP CZ2 HZ2 sing N N 357 TRP CZ3 CH2 sing Y N 358 TRP CZ3 HZ3 sing N N 359 TRP CH2 HH2 sing N N 360 TRP OXT HXT sing N N 361 TYR N CA sing N N 362 TYR N H sing N N 363 TYR N H2 sing N N 364 TYR CA C sing N N 365 TYR CA CB sing N N 366 TYR CA HA sing N N 367 TYR C O doub N N 368 TYR C OXT sing N N 369 TYR CB CG sing N N 370 TYR CB HB2 sing N N 371 TYR CB HB3 sing N N 372 TYR CG CD1 doub Y N 373 TYR CG CD2 sing Y N 374 TYR CD1 CE1 sing Y N 375 TYR CD1 HD1 sing N N 376 TYR CD2 CE2 doub Y N 377 TYR CD2 HD2 sing N N 378 TYR CE1 CZ doub Y N 379 TYR CE1 HE1 sing N N 380 TYR CE2 CZ sing Y N 381 TYR CE2 HE2 sing N N 382 TYR CZ OH sing N N 383 TYR OH HH sing N N 384 TYR OXT HXT sing N N 385 VAL N CA sing N N 386 VAL N H sing N N 387 VAL N H2 sing N N 388 VAL CA C sing N N 389 VAL CA CB sing N N 390 VAL CA HA sing N N 391 VAL C O doub N N 392 VAL C OXT sing N N 393 VAL CB CG1 sing N N 394 VAL CB CG2 sing N N 395 VAL CB HB sing N N 396 VAL CG1 HG11 sing N N 397 VAL CG1 HG12 sing N N 398 VAL CG1 HG13 sing N N 399 VAL CG2 HG21 sing N N 400 VAL CG2 HG22 sing N N 401 VAL CG2 HG23 sing N N 402 VAL OXT HXT sing N N 403 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NAG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NAG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6ZR7 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #