data_7YAZ # _entry.id 7YAZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YAZ pdb_00007yaz 10.2210/pdb7yaz/pdb WWPDB D_1300030581 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-08-09 2 'Structure model' 1 1 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_entry_details 4 2 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'IGV A 401 HAS WRONG CHIRALITY AT ATOM C25' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7YAZ _pdbx_database_status.recvd_initial_deposition_date 2022-06-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email luluhantu@126.com _pdbx_contact_author.name_first Lu-Lu _pdbx_contact_author.name_last Kong _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5266-8801 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kong, L.L.' 1 ? 'Yun, C.H.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 7405 _citation.page_last 7420 _citation.title 'Rational Design of Covalent Kinase Inhibitors by an Integrated Computational Workflow (Kin-Cov).' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.3c00088 _citation.pdbx_database_id_PubMed 37220641 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhou, Y.' 1 0000-0003-4167-6413 primary 'Yu, H.' 2 ? primary 'Vind, A.C.' 3 ? primary 'Kong, L.' 4 ? primary 'Liu, Y.' 5 ? primary 'Song, X.' 6 ? primary 'Tu, Z.' 7 ? primary 'Yun, C.' 8 0000-0002-5880-8307 primary 'Smaill, J.B.' 9 ? primary 'Zhang, Q.W.' 10 ? primary 'Ding, K.' 11 ? primary 'Bekker-Jensen, S.' 12 ? primary 'Lu, X.' 13 0000-0001-7931-6873 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase kinase kinase MLT' 35337.504 1 2.7.11.25 ? ? ? 2 non-polymer syn ;~{N}-[2,4-bis(fluoranyl)-3-[4-[3-[(3~{S})-1-propanoylpyrrolidin-3-yl]oxy-1~{H}-pyrazolo[3,4-b]pyridin-5-yl]-1,2,3-triazol-1-yl]phenyl]-3-phenyl-benzenesulfonamide ; 670.688 1 ? ? ? ? 3 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ZAK # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGSGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYG IVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHN HTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELL HQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELK ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGSGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYG IVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHN HTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELL HQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;~{N}-[2,4-bis(fluoranyl)-3-[4-[3-[(3~{S})-1-propanoylpyrrolidin-3-yl]oxy-1~{H}-pyrazolo[3,4-b]pyridin-5-yl]-1,2,3-triazol-1-yl]phenyl]-3-phenyl-benzenesulfonamide ; IGV 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 GLY n 1 7 ALA n 1 8 SER n 1 9 PHE n 1 10 VAL n 1 11 GLN n 1 12 ILE n 1 13 LYS n 1 14 PHE n 1 15 ASP n 1 16 ASP n 1 17 LEU n 1 18 GLN n 1 19 PHE n 1 20 PHE n 1 21 GLU n 1 22 ASN n 1 23 CYS n 1 24 GLY n 1 25 GLY n 1 26 GLY n 1 27 SER n 1 28 PHE n 1 29 GLY n 1 30 SER n 1 31 VAL n 1 32 TYR n 1 33 ARG n 1 34 ALA n 1 35 LYS n 1 36 TRP n 1 37 ILE n 1 38 SER n 1 39 GLN n 1 40 ASP n 1 41 LYS n 1 42 GLU n 1 43 VAL n 1 44 ALA n 1 45 VAL n 1 46 LYS n 1 47 LYS n 1 48 LEU n 1 49 LEU n 1 50 LYS n 1 51 ILE n 1 52 GLU n 1 53 LYS n 1 54 GLU n 1 55 ALA n 1 56 GLU n 1 57 ILE n 1 58 LEU n 1 59 SER n 1 60 VAL n 1 61 LEU n 1 62 SER n 1 63 HIS n 1 64 ARG n 1 65 ASN n 1 66 ILE n 1 67 ILE n 1 68 GLN n 1 69 PHE n 1 70 TYR n 1 71 GLY n 1 72 VAL n 1 73 ILE n 1 74 LEU n 1 75 GLU n 1 76 PRO n 1 77 PRO n 1 78 ASN n 1 79 TYR n 1 80 GLY n 1 81 ILE n 1 82 VAL n 1 83 THR n 1 84 GLU n 1 85 TYR n 1 86 ALA n 1 87 SER n 1 88 LEU n 1 89 GLY n 1 90 SER n 1 91 LEU n 1 92 TYR n 1 93 ASP n 1 94 TYR n 1 95 ILE n 1 96 ASN n 1 97 SER n 1 98 ASN n 1 99 ARG n 1 100 SER n 1 101 GLU n 1 102 GLU n 1 103 MET n 1 104 ASP n 1 105 MET n 1 106 ASP n 1 107 HIS n 1 108 ILE n 1 109 MET n 1 110 THR n 1 111 TRP n 1 112 ALA n 1 113 THR n 1 114 ASP n 1 115 VAL n 1 116 ALA n 1 117 LYS n 1 118 GLY n 1 119 MET n 1 120 HIS n 1 121 TYR n 1 122 LEU n 1 123 HIS n 1 124 MET n 1 125 GLU n 1 126 ALA n 1 127 PRO n 1 128 VAL n 1 129 LYS n 1 130 VAL n 1 131 ILE n 1 132 HIS n 1 133 ARG n 1 134 ASP n 1 135 LEU n 1 136 LYS n 1 137 SER n 1 138 ARG n 1 139 ASN n 1 140 VAL n 1 141 VAL n 1 142 ILE n 1 143 ALA n 1 144 ALA n 1 145 ASP n 1 146 GLY n 1 147 VAL n 1 148 LEU n 1 149 LYS n 1 150 ILE n 1 151 CYS n 1 152 ASP n 1 153 PHE n 1 154 GLY n 1 155 ALA n 1 156 SER n 1 157 ARG n 1 158 PHE n 1 159 HIS n 1 160 ASN n 1 161 HIS n 1 162 THR n 1 163 THR n 1 164 HIS n 1 165 MET n 1 166 SER n 1 167 LEU n 1 168 VAL n 1 169 GLY n 1 170 THR n 1 171 PHE n 1 172 PRO n 1 173 TRP n 1 174 MET n 1 175 ALA n 1 176 PRO n 1 177 GLU n 1 178 VAL n 1 179 ILE n 1 180 GLN n 1 181 SER n 1 182 LEU n 1 183 PRO n 1 184 VAL n 1 185 SER n 1 186 GLU n 1 187 THR n 1 188 CYS n 1 189 ASP n 1 190 THR n 1 191 TYR n 1 192 SER n 1 193 TYR n 1 194 GLY n 1 195 VAL n 1 196 VAL n 1 197 LEU n 1 198 TRP n 1 199 GLU n 1 200 MET n 1 201 LEU n 1 202 THR n 1 203 ARG n 1 204 GLU n 1 205 VAL n 1 206 PRO n 1 207 PHE n 1 208 LYS n 1 209 GLY n 1 210 LEU n 1 211 GLU n 1 212 GLY n 1 213 LEU n 1 214 GLN n 1 215 VAL n 1 216 ALA n 1 217 TRP n 1 218 LEU n 1 219 VAL n 1 220 VAL n 1 221 GLU n 1 222 LYS n 1 223 ASN n 1 224 GLU n 1 225 ARG n 1 226 LEU n 1 227 THR n 1 228 ILE n 1 229 PRO n 1 230 SER n 1 231 SER n 1 232 CYS n 1 233 PRO n 1 234 ARG n 1 235 SER n 1 236 PHE n 1 237 ALA n 1 238 GLU n 1 239 LEU n 1 240 LEU n 1 241 HIS n 1 242 GLN n 1 243 CYS n 1 244 TRP n 1 245 GLU n 1 246 ALA n 1 247 ASP n 1 248 ALA n 1 249 LYS n 1 250 LYS n 1 251 ARG n 1 252 PRO n 1 253 SER n 1 254 PHE n 1 255 LYS n 1 256 GLN n 1 257 ILE n 1 258 ILE n 1 259 SER n 1 260 ILE n 1 261 LEU n 1 262 GLU n 1 263 SER n 1 264 MET n 1 265 SER n 1 266 ASN n 1 267 ASP n 1 268 THR n 1 269 SER n 1 270 LEU n 1 271 PRO n 1 272 ASP n 1 273 LYS n 1 274 CYS n 1 275 ASN n 1 276 SER n 1 277 PHE n 1 278 LEU n 1 279 HIS n 1 280 ASN n 1 281 LYS n 1 282 ALA n 1 283 GLU n 1 284 TRP n 1 285 ARG n 1 286 CYS n 1 287 GLU n 1 288 ILE n 1 289 GLU n 1 290 ALA n 1 291 THR n 1 292 LEU n 1 293 GLU n 1 294 ARG n 1 295 LEU n 1 296 LYS n 1 297 LYS n 1 298 LEU n 1 299 GLU n 1 300 ARG n 1 301 ASP n 1 302 LEU n 1 303 SER n 1 304 PHE n 1 305 LYS n 1 306 GLU n 1 307 GLN n 1 308 GLU n 1 309 LEU n 1 310 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 310 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ZAK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IGV non-polymer . ;~{N}-[2,4-bis(fluoranyl)-3-[4-[3-[(3~{S})-1-propanoylpyrrolidin-3-yl]oxy-1~{H}-pyrazolo[3,4-b]pyridin-5-yl]-1,2,3-triazol-1-yl]phenyl]-3-phenyl-benzenesulfonamide ; ? 'C33 H28 F2 N8 O4 S' 670.688 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 ALA 2 1 ? ? ? A . n A 1 3 MET 3 2 ? ? ? A . n A 1 4 GLY 4 3 ? ? ? A . n A 1 5 SER 5 4 ? ? ? A . n A 1 6 GLY 6 5 ? ? ? A . n A 1 7 ALA 7 6 ? ? ? A . n A 1 8 SER 8 7 ? ? ? A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLN 11 10 10 GLN GLN A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 LYS 13 12 12 LYS LYS A . n A 1 14 PHE 14 13 13 PHE PHE A . n A 1 15 ASP 15 14 14 ASP ASP A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 LEU 17 16 16 LEU LEU A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 PHE 19 18 18 PHE PHE A . n A 1 20 PHE 20 19 19 PHE PHE A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 CYS 23 22 22 CYS LIG A A n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 SER 27 26 26 SER SER A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 GLY 29 28 28 GLY GLY A . n A 1 30 SER 30 29 29 SER SER A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 TYR 32 31 31 TYR TYR A . n A 1 33 ARG 33 32 32 ARG ARG A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 TRP 36 35 35 TRP TRP A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 SER 38 37 37 SER SER A . n A 1 39 GLN 39 38 38 GLN GLN A . n A 1 40 ASP 40 39 39 ASP ASP A . n A 1 41 LYS 41 40 40 LYS LYS A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 VAL 43 42 42 VAL VAL A . n A 1 44 ALA 44 43 43 ALA ALA A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 LYS 46 45 45 LYS LYS A . n A 1 47 LYS 47 46 46 LYS LYS A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 ILE 51 50 50 ILE ILE A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 ALA 55 54 54 ALA ALA A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 SER 59 58 58 SER SER A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 SER 62 61 61 SER SER A . n A 1 63 HIS 63 62 62 HIS HIS A . n A 1 64 ARG 64 63 63 ARG ARG A . n A 1 65 ASN 65 64 64 ASN ASN A . n A 1 66 ILE 66 65 65 ILE ILE A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 GLN 68 67 67 GLN GLN A . n A 1 69 PHE 69 68 68 PHE PHE A . n A 1 70 TYR 70 69 69 TYR TYR A . n A 1 71 GLY 71 70 70 GLY GLY A . n A 1 72 VAL 72 71 71 VAL VAL A . n A 1 73 ILE 73 72 72 ILE ILE A . n A 1 74 LEU 74 73 73 LEU LEU A . n A 1 75 GLU 75 74 74 GLU GLU A . n A 1 76 PRO 76 75 75 PRO PRO A . n A 1 77 PRO 77 76 76 PRO PRO A . n A 1 78 ASN 78 77 77 ASN ASN A . n A 1 79 TYR 79 78 78 TYR TYR A . n A 1 80 GLY 80 79 79 GLY GLY A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 TYR 85 84 84 TYR TYR A . n A 1 86 ALA 86 85 85 ALA ALA A . n A 1 87 SER 87 86 86 SER SER A . n A 1 88 LEU 88 87 87 LEU LEU A . n A 1 89 GLY 89 88 88 GLY GLY A . n A 1 90 SER 90 89 89 SER SER A . n A 1 91 LEU 91 90 90 LEU LEU A . n A 1 92 TYR 92 91 91 TYR TYR A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 TYR 94 93 93 TYR TYR A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 ASN 96 95 95 ASN ASN A . n A 1 97 SER 97 96 96 SER SER A . n A 1 98 ASN 98 97 97 ASN ASN A . n A 1 99 ARG 99 98 98 ARG ARG A . n A 1 100 SER 100 99 99 SER SER A . n A 1 101 GLU 101 100 100 GLU GLU A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 MET 103 102 102 MET MET A . n A 1 104 ASP 104 103 103 ASP ASP A . n A 1 105 MET 105 104 104 MET MET A . n A 1 106 ASP 106 105 105 ASP ASP A . n A 1 107 HIS 107 106 106 HIS HIS A . n A 1 108 ILE 108 107 107 ILE ILE A . n A 1 109 MET 109 108 108 MET MET A . n A 1 110 THR 110 109 109 THR THR A . n A 1 111 TRP 111 110 110 TRP TRP A . n A 1 112 ALA 112 111 111 ALA ALA A . n A 1 113 THR 113 112 112 THR THR A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 ALA 116 115 115 ALA ALA A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 GLY 118 117 117 GLY GLY A . n A 1 119 MET 119 118 118 MET MET A . n A 1 120 HIS 120 119 119 HIS HIS A . n A 1 121 TYR 121 120 120 TYR TYR A . n A 1 122 LEU 122 121 121 LEU LEU A . n A 1 123 HIS 123 122 122 HIS HIS A . n A 1 124 MET 124 123 123 MET MET A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 PRO 127 126 126 PRO PRO A . n A 1 128 VAL 128 127 127 VAL VAL A . n A 1 129 LYS 129 128 128 LYS LYS A . n A 1 130 VAL 130 129 129 VAL VAL A . n A 1 131 ILE 131 130 130 ILE ILE A . n A 1 132 HIS 132 131 131 HIS HIS A . n A 1 133 ARG 133 132 132 ARG ARG A . n A 1 134 ASP 134 133 133 ASP ASP A . n A 1 135 LEU 135 134 134 LEU LEU A . n A 1 136 LYS 136 135 135 LYS LYS A . n A 1 137 SER 137 136 136 SER SER A . n A 1 138 ARG 138 137 137 ARG ARG A . n A 1 139 ASN 139 138 138 ASN ASN A . n A 1 140 VAL 140 139 139 VAL VAL A . n A 1 141 VAL 141 140 140 VAL VAL A . n A 1 142 ILE 142 141 141 ILE ILE A . n A 1 143 ALA 143 142 142 ALA ALA A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 ASP 145 144 144 ASP ASP A . n A 1 146 GLY 146 145 145 GLY GLY A . n A 1 147 VAL 147 146 146 VAL VAL A . n A 1 148 LEU 148 147 147 LEU LEU A . n A 1 149 LYS 149 148 148 LYS LYS A . n A 1 150 ILE 150 149 149 ILE ILE A . n A 1 151 CYS 151 150 150 CYS CYS A . n A 1 152 ASP 152 151 151 ASP ASP A . n A 1 153 PHE 153 152 152 PHE PHE A . n A 1 154 GLY 154 153 153 GLY GLY A . n A 1 155 ALA 155 154 154 ALA ALA A . n A 1 156 SER 156 155 155 SER SER A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 PHE 158 157 157 PHE PHE A . n A 1 159 HIS 159 158 158 HIS HIS A . n A 1 160 ASN 160 159 159 ASN ASN A . n A 1 161 HIS 161 160 160 HIS HIS A . n A 1 162 THR 162 161 161 THR THR A . n A 1 163 THR 163 162 162 THR THR A . n A 1 164 HIS 164 163 163 HIS HIS A . n A 1 165 MET 165 164 ? ? ? A . n A 1 166 SER 166 165 165 SER SER A . n A 1 167 LEU 167 166 166 LEU LEU A . n A 1 168 VAL 168 167 167 VAL VAL A . n A 1 169 GLY 169 168 168 GLY GLY A . n A 1 170 THR 170 169 169 THR THR A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 PRO 172 171 171 PRO PRO A . n A 1 173 TRP 173 172 172 TRP TRP A . n A 1 174 MET 174 173 173 MET MET A . n A 1 175 ALA 175 174 174 ALA ALA A . n A 1 176 PRO 176 175 175 PRO PRO A . n A 1 177 GLU 177 176 176 GLU GLU A . n A 1 178 VAL 178 177 177 VAL VAL A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 GLN 180 179 179 GLN GLN A . n A 1 181 SER 181 180 180 SER SER A . n A 1 182 LEU 182 181 181 LEU LEU A . n A 1 183 PRO 183 182 182 PRO PRO A . n A 1 184 VAL 184 183 183 VAL VAL A . n A 1 185 SER 185 184 184 SER SER A . n A 1 186 GLU 186 185 185 GLU GLU A . n A 1 187 THR 187 186 186 THR THR A . n A 1 188 CYS 188 187 187 CYS CYS A . n A 1 189 ASP 189 188 188 ASP ASP A . n A 1 190 THR 190 189 189 THR THR A . n A 1 191 TYR 191 190 190 TYR TYR A . n A 1 192 SER 192 191 191 SER SER A . n A 1 193 TYR 193 192 192 TYR TYR A . n A 1 194 GLY 194 193 193 GLY GLY A . n A 1 195 VAL 195 194 194 VAL VAL A . n A 1 196 VAL 196 195 195 VAL VAL A . n A 1 197 LEU 197 196 196 LEU LEU A . n A 1 198 TRP 198 197 197 TRP TRP A . n A 1 199 GLU 199 198 198 GLU GLU A . n A 1 200 MET 200 199 199 MET MET A . n A 1 201 LEU 201 200 200 LEU LEU A . n A 1 202 THR 202 201 201 THR THR A . n A 1 203 ARG 203 202 202 ARG ARG A . n A 1 204 GLU 204 203 203 GLU GLU A . n A 1 205 VAL 205 204 204 VAL VAL A . n A 1 206 PRO 206 205 205 PRO PRO A . n A 1 207 PHE 207 206 206 PHE PHE A . n A 1 208 LYS 208 207 207 LYS LYS A . n A 1 209 GLY 209 208 208 GLY GLY A . n A 1 210 LEU 210 209 209 LEU LEU A . n A 1 211 GLU 211 210 210 GLU GLU A . n A 1 212 GLY 212 211 211 GLY GLY A . n A 1 213 LEU 213 212 212 LEU LEU A . n A 1 214 GLN 214 213 213 GLN GLN A . n A 1 215 VAL 215 214 214 VAL VAL A . n A 1 216 ALA 216 215 215 ALA ALA A . n A 1 217 TRP 217 216 216 TRP TRP A . n A 1 218 LEU 218 217 217 LEU LEU A . n A 1 219 VAL 219 218 218 VAL VAL A . n A 1 220 VAL 220 219 219 VAL VAL A . n A 1 221 GLU 221 220 220 GLU GLU A . n A 1 222 LYS 222 221 221 LYS LYS A . n A 1 223 ASN 223 222 222 ASN ASN A . n A 1 224 GLU 224 223 223 GLU GLU A . n A 1 225 ARG 225 224 224 ARG ARG A . n A 1 226 LEU 226 225 225 LEU LEU A . n A 1 227 THR 227 226 226 THR THR A . n A 1 228 ILE 228 227 227 ILE ILE A . n A 1 229 PRO 229 228 228 PRO PRO A . n A 1 230 SER 230 229 229 SER SER A . n A 1 231 SER 231 230 230 SER SER A . n A 1 232 CYS 232 231 231 CYS CYS A . n A 1 233 PRO 233 232 232 PRO PRO A . n A 1 234 ARG 234 233 233 ARG ARG A . n A 1 235 SER 235 234 234 SER SER A . n A 1 236 PHE 236 235 235 PHE PHE A . n A 1 237 ALA 237 236 236 ALA ALA A . n A 1 238 GLU 238 237 237 GLU GLU A . n A 1 239 LEU 239 238 238 LEU LEU A . n A 1 240 LEU 240 239 239 LEU LEU A . n A 1 241 HIS 241 240 240 HIS HIS A . n A 1 242 GLN 242 241 241 GLN GLN A . n A 1 243 CYS 243 242 242 CYS CYS A . n A 1 244 TRP 244 243 243 TRP TRP A . n A 1 245 GLU 245 244 244 GLU GLU A . n A 1 246 ALA 246 245 245 ALA ALA A . n A 1 247 ASP 247 246 246 ASP ASP A . n A 1 248 ALA 248 247 247 ALA ALA A . n A 1 249 LYS 249 248 248 LYS LYS A . n A 1 250 LYS 250 249 249 LYS LYS A . n A 1 251 ARG 251 250 250 ARG ARG A . n A 1 252 PRO 252 251 251 PRO PRO A . n A 1 253 SER 253 252 252 SER SER A . n A 1 254 PHE 254 253 253 PHE PHE A . n A 1 255 LYS 255 254 254 LYS LYS A . n A 1 256 GLN 256 255 255 GLN GLN A . n A 1 257 ILE 257 256 256 ILE ILE A . n A 1 258 ILE 258 257 257 ILE ILE A . n A 1 259 SER 259 258 258 SER SER A . n A 1 260 ILE 260 259 259 ILE ILE A . n A 1 261 LEU 261 260 260 LEU LEU A . n A 1 262 GLU 262 261 261 GLU GLU A . n A 1 263 SER 263 262 262 SER SER A . n A 1 264 MET 264 263 263 MET MET A . n A 1 265 SER 265 264 264 SER SER A . n A 1 266 ASN 266 265 265 ASN ASN A . n A 1 267 ASP 267 266 266 ASP ASP A . n A 1 268 THR 268 267 267 THR THR A . n A 1 269 SER 269 268 268 SER SER A . n A 1 270 LEU 270 269 269 LEU LEU A . n A 1 271 PRO 271 270 270 PRO PRO A . n A 1 272 ASP 272 271 271 ASP ASP A . n A 1 273 LYS 273 272 272 LYS LYS A . n A 1 274 CYS 274 273 273 CYS CYS A . n A 1 275 ASN 275 274 274 ASN ASN A . n A 1 276 SER 276 275 275 SER SER A . n A 1 277 PHE 277 276 276 PHE PHE A . n A 1 278 LEU 278 277 277 LEU LEU A . n A 1 279 HIS 279 278 278 HIS HIS A . n A 1 280 ASN 280 279 279 ASN ASN A . n A 1 281 LYS 281 280 280 LYS LYS A . n A 1 282 ALA 282 281 281 ALA ALA A . n A 1 283 GLU 283 282 282 GLU GLU A . n A 1 284 TRP 284 283 283 TRP TRP A . n A 1 285 ARG 285 284 284 ARG ARG A . n A 1 286 CYS 286 285 285 CYS CYS A . n A 1 287 GLU 287 286 286 GLU GLU A . n A 1 288 ILE 288 287 287 ILE ILE A . n A 1 289 GLU 289 288 288 GLU GLU A . n A 1 290 ALA 290 289 289 ALA ALA A . n A 1 291 THR 291 290 290 THR THR A . n A 1 292 LEU 292 291 291 LEU LEU A . n A 1 293 GLU 293 292 292 GLU GLU A . n A 1 294 ARG 294 293 293 ARG ARG A . n A 1 295 LEU 295 294 294 LEU LEU A . n A 1 296 LYS 296 295 295 LYS LYS A . n A 1 297 LYS 297 296 296 LYS LYS A . n A 1 298 LEU 298 297 297 LEU LEU A . n A 1 299 GLU 299 298 298 GLU GLU A . n A 1 300 ARG 300 299 299 ARG ARG A . n A 1 301 ASP 301 300 ? ? ? A . n A 1 302 LEU 302 301 ? ? ? A . n A 1 303 SER 303 302 ? ? ? A . n A 1 304 PHE 304 303 ? ? ? A . n A 1 305 LYS 305 304 ? ? ? A . n A 1 306 GLU 306 305 ? ? ? A . n A 1 307 GLN 307 306 ? ? ? A . n A 1 308 GLU 308 307 ? ? ? A . n A 1 309 LEU 309 308 ? ? ? A . n A 1 310 LYS 310 309 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IGV _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IGV _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IGV 1 401 22 IGV LIG A . C 3 HOH 1 501 4 HOH HOH A . C 3 HOH 2 502 24 HOH HOH A . C 3 HOH 3 503 22 HOH HOH A . C 3 HOH 4 504 20 HOH HOH A . C 3 HOH 5 505 25 HOH HOH A . C 3 HOH 6 506 1 HOH HOH A . C 3 HOH 7 507 2 HOH HOH A . C 3 HOH 8 508 27 HOH HOH A . C 3 HOH 9 509 16 HOH HOH A . C 3 HOH 10 510 9 HOH HOH A . C 3 HOH 11 511 8 HOH HOH A . C 3 HOH 12 512 6 HOH HOH A . C 3 HOH 13 513 7 HOH HOH A . C 3 HOH 14 514 30 HOH HOH A . C 3 HOH 15 515 14 HOH HOH A . C 3 HOH 16 516 21 HOH HOH A . C 3 HOH 17 517 29 HOH HOH A . C 3 HOH 18 518 26 HOH HOH A . C 3 HOH 19 519 19 HOH HOH A . C 3 HOH 20 520 5 HOH HOH A . C 3 HOH 21 521 23 HOH HOH A . C 3 HOH 22 522 31 HOH HOH A . C 3 HOH 23 523 11 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 163 ? ND1 ? A HIS 164 ND1 2 1 Y 1 A HIS 163 ? CE1 ? A HIS 164 CE1 3 1 Y 1 A HIS 163 ? NE2 ? A HIS 164 NE2 4 1 Y 1 A SER 165 ? OG ? A SER 166 OG 5 1 Y 1 A GLU 210 ? CD ? A GLU 211 CD 6 1 Y 1 A GLU 210 ? OE1 ? A GLU 211 OE1 7 1 Y 1 A GLU 210 ? OE2 ? A GLU 211 OE2 8 1 Y 1 A ARG 233 ? NH1 ? A ARG 234 NH1 9 1 Y 1 A ARG 233 ? NH2 ? A ARG 234 NH2 10 1 Y 1 A LYS 296 ? CG ? A LYS 297 CG 11 1 Y 1 A LYS 296 ? CD ? A LYS 297 CD 12 1 Y 1 A LYS 296 ? CE ? A LYS 297 CE 13 1 Y 1 A LYS 296 ? NZ ? A LYS 297 NZ 14 1 Y 1 A LEU 297 ? CG ? A LEU 298 CG 15 1 Y 1 A LEU 297 ? CD1 ? A LEU 298 CD1 16 1 Y 1 A LEU 297 ? CD2 ? A LEU 298 CD2 17 1 Y 1 A ARG 299 ? CG ? A ARG 300 CG 18 1 Y 1 A ARG 299 ? CD ? A ARG 300 CD 19 1 Y 1 A ARG 299 ? NE ? A ARG 300 NE 20 1 Y 1 A ARG 299 ? CZ ? A ARG 300 CZ 21 1 Y 1 A ARG 299 ? NH1 ? A ARG 300 NH1 22 1 Y 1 A ARG 299 ? NH2 ? A ARG 300 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 105.780 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7YAZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 129.976 _cell.length_a_esd ? _cell.length_b 48.608 _cell.length_b_esd ? _cell.length_c 42.881 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7YAZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7YAZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05 M Magnesium acetate, 0.05 M Sodium acetate pH 5.0, 28% PEG400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97853 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97853 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 37.180 _reflns.entry_id 7YAZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.54 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8584 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.107 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.55 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 829 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.252 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 118.560 _refine.B_iso_mean 42.8447 _refine.B_iso_min 12.830 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7YAZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5400 _refine.ls_d_res_low 31.2700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8564 _refine.ls_number_reflns_R_free 384 _refine.ls_number_reflns_R_work 8180 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7800 _refine.ls_percent_reflns_R_free 4.4800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1866 _refine.ls_R_factor_R_free 0.2518 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1835 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5X5O _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.1400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5400 _refine_hist.d_res_low 31.2700 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 2392 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 291 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 38.49 _refine_hist.pdbx_number_atoms_protein 2369 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5400 2.9100 . . 136 2632 97.0000 . . . 0.3266 0.0000 0.2147 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9100 3.6600 . . 113 2763 100.0000 . . . 0.2662 0.0000 0.1938 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6600 4.36 . . 135 2785 99.0000 . . . 0.2217 0.0000 0.1681 . . . . . . . . . . . # _struct.entry_id 7YAZ _struct.title 'Crystal structure of ZAK in complex with compound YH-186' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YAZ _struct_keywords.text 'ZAK, Inhibitor, YH-186, STRUCTURAL PROTEIN, STRUCTURAL PROTEIN-INHIBITOR complex' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MLTK_HUMAN _struct_ref.pdbx_db_accession Q9NYL2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEY ASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHM SLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWE ADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELK ; _struct_ref.pdbx_align_begin 5 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7YAZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 310 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NYL2 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 309 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 309 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7YAZ GLY A 1 ? UNP Q9NYL2 ? ? 'expression tag' 0 1 1 7YAZ ALA A 2 ? UNP Q9NYL2 ? ? 'expression tag' 1 2 1 7YAZ MET A 3 ? UNP Q9NYL2 ? ? 'expression tag' 2 3 1 7YAZ GLY A 4 ? UNP Q9NYL2 ? ? 'expression tag' 3 4 1 7YAZ SER A 5 ? UNP Q9NYL2 ? ? 'expression tag' 4 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 13 ? ASP A 15 ? LYS A 12 ASP A 14 5 ? 3 HELX_P HELX_P2 AA2 GLU A 52 ? LEU A 61 ? GLU A 51 LEU A 60 5 ? 10 HELX_P HELX_P3 AA3 SER A 90 ? ASN A 96 ? SER A 89 ASN A 95 1 ? 7 HELX_P HELX_P4 AA4 SER A 97 ? MET A 103 ? SER A 96 MET A 102 5 ? 7 HELX_P HELX_P5 AA5 ASP A 104 ? GLU A 125 ? ASP A 103 GLU A 124 1 ? 22 HELX_P HELX_P6 AA6 LYS A 136 ? ARG A 138 ? LYS A 135 ARG A 137 5 ? 3 HELX_P HELX_P7 AA7 THR A 170 ? MET A 174 ? THR A 169 MET A 173 5 ? 5 HELX_P HELX_P8 AA8 ALA A 175 ? GLN A 180 ? ALA A 174 GLN A 179 1 ? 6 HELX_P HELX_P9 AA9 THR A 187 ? ARG A 203 ? THR A 186 ARG A 202 1 ? 17 HELX_P HELX_P10 AB1 GLU A 211 ? LYS A 222 ? GLU A 210 LYS A 221 1 ? 12 HELX_P HELX_P11 AB2 PRO A 233 ? TRP A 244 ? PRO A 232 TRP A 243 1 ? 12 HELX_P HELX_P12 AB3 ASP A 247 ? ARG A 251 ? ASP A 246 ARG A 250 5 ? 5 HELX_P HELX_P13 AB4 SER A 253 ? ASP A 267 ? SER A 252 ASP A 266 1 ? 15 HELX_P HELX_P14 AB5 SER A 269 ? ASN A 280 ? SER A 268 ASN A 279 1 ? 12 HELX_P HELX_P15 AB6 ASN A 280 ? LYS A 297 ? ASN A 279 LYS A 296 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 23 SG A A ? 1_555 B IGV . C32 A ? A CYS 22 A IGV 401 1_555 ? ? ? ? ? ? ? 1.803 ? ? covale2 covale none ? A CYS 23 SG B A ? 1_555 B IGV . C32 B ? A CYS 22 A IGV 401 1_555 ? ? ? ? ? ? ? 1.811 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 IGV B . A CYS A 23 A IGV A 401 ? 1_555 CYS A 22 A 1_555 C32 SG CYS 1 IGV None 'Covalent chemical modification' 2 IGV B . B CYS A 23 B IGV A 401 ? 1_555 CYS A 22 A 1_555 C32 SG CYS 1 IGV None 'Covalent chemical modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 76 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 75 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 77 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 76 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.09 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 17 ? CYS A 23 A LEU A 16 CYS A 22 AA1 2 VAL A 31 ? TRP A 36 ? VAL A 30 TRP A 35 AA1 3 LYS A 41 ? LEU A 48 ? LYS A 40 LEU A 47 AA1 4 ASN A 78 ? GLU A 84 ? ASN A 77 GLU A 83 AA1 5 PHE A 69 ? GLU A 75 ? PHE A 68 GLU A 74 AA2 1 VAL A 140 ? ILE A 142 ? VAL A 139 ILE A 141 AA2 2 LEU A 148 ? ILE A 150 ? LEU A 147 ILE A 149 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 23 A N CYS A 22 O VAL A 31 ? O VAL A 30 AA1 2 3 N ALA A 34 ? N ALA A 33 O VAL A 43 ? O VAL A 42 AA1 3 4 N LEU A 48 ? N LEU A 47 O TYR A 79 ? O TYR A 78 AA1 4 5 O ASN A 78 ? O ASN A 77 N GLU A 75 ? N GLU A 74 AA2 1 2 N VAL A 141 ? N VAL A 140 O LYS A 149 ? O LYS A 148 # _pdbx_entry_details.entry_id 7YAZ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A CYS 22 A A N A GLY 23 ? ? 1.11 2 1 O A CYS 22 A B N A GLY 23 ? ? 1.13 3 1 C A CYS 22 A A CA A GLY 23 ? ? 1.49 4 1 C A CYS 22 A B CA A GLY 23 ? ? 1.49 5 1 CA A CYS 22 A A N A GLY 23 ? ? 1.59 6 1 CA A CYS 22 A B N A GLY 23 ? ? 1.60 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A GLY 23 ? ? 1_555 OE2 A GLU 292 ? ? 4_545 1.95 2 1 OG A SER 26 ? ? 1_555 O A GLN 179 ? ? 4_546 2.19 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A CYS 22 A A N A GLY 23 ? ? 0.157 1.336 -1.179 0.023 Y 2 1 C A CYS 22 A B N A GLY 23 ? ? 0.229 1.336 -1.107 0.023 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 O A CYS 22 A A C A CYS 22 A A N A GLY 23 ? ? 57.96 123.20 -65.24 1.70 Y 2 1 O A CYS 22 A B C A CYS 22 A B N A GLY 23 ? ? 71.80 123.20 -51.40 1.70 Y 3 1 C A CYS 22 A A N A GLY 23 ? ? CA A GLY 23 ? ? 90.66 122.30 -31.64 2.10 Y 4 1 C A CYS 22 A B N A GLY 23 ? ? CA A GLY 23 ? ? 89.30 122.30 -33.00 2.10 Y 5 1 CA A LEU 48 ? ? CB A LEU 48 ? ? CG A LEU 48 ? ? 131.16 115.30 15.86 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 95 ? ? -91.98 32.83 2 1 ARG A 132 ? ? 68.42 -12.20 3 1 PHE A 157 ? ? -106.93 -67.05 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 CYS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 22 _pdbx_validate_peptide_omega.PDB_ins_code_1 A _pdbx_validate_peptide_omega.label_alt_id_1 B _pdbx_validate_peptide_omega.auth_comp_id_2 GLY _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 23 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 147.91 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C25 _pdbx_validate_chiral.label_alt_id B _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id IGV _pdbx_validate_chiral.auth_seq_id 401 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 CYS A 22 A A 104.32 2 1 CYS A 22 A B 85.82 # loop_ _pdbx_validate_polymer_linkage.id _pdbx_validate_polymer_linkage.PDB_model_num _pdbx_validate_polymer_linkage.auth_atom_id_1 _pdbx_validate_polymer_linkage.auth_asym_id_1 _pdbx_validate_polymer_linkage.auth_comp_id_1 _pdbx_validate_polymer_linkage.auth_seq_id_1 _pdbx_validate_polymer_linkage.PDB_ins_code_1 _pdbx_validate_polymer_linkage.label_alt_id_1 _pdbx_validate_polymer_linkage.auth_atom_id_2 _pdbx_validate_polymer_linkage.auth_asym_id_2 _pdbx_validate_polymer_linkage.auth_comp_id_2 _pdbx_validate_polymer_linkage.auth_seq_id_2 _pdbx_validate_polymer_linkage.PDB_ins_code_2 _pdbx_validate_polymer_linkage.label_alt_id_2 _pdbx_validate_polymer_linkage.dist 1 1 C A CYS 22 A A N A GLY 23 ? ? 0.16 2 1 C A CYS 22 A B N A GLY 23 ? ? 0.23 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 523 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A ALA 1 ? A ALA 2 3 1 Y 1 A MET 2 ? A MET 3 4 1 Y 1 A GLY 3 ? A GLY 4 5 1 Y 1 A SER 4 ? A SER 5 6 1 Y 1 A GLY 5 ? A GLY 6 7 1 Y 1 A ALA 6 ? A ALA 7 8 1 Y 1 A SER 7 ? A SER 8 9 1 Y 1 A MET 164 ? A MET 165 10 1 Y 1 A ASP 300 ? A ASP 301 11 1 Y 1 A LEU 301 ? A LEU 302 12 1 Y 1 A SER 302 ? A SER 303 13 1 Y 1 A PHE 303 ? A PHE 304 14 1 Y 1 A LYS 304 ? A LYS 305 15 1 Y 1 A GLU 305 ? A GLU 306 16 1 Y 1 A GLN 306 ? A GLN 307 17 1 Y 1 A GLU 307 ? A GLU 308 18 1 Y 1 A LEU 308 ? A LEU 309 19 1 Y 1 A LYS 309 ? A LYS 310 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 IGV C13 C Y N 161 IGV C14 C Y N 162 IGV C15 C Y N 163 IGV C16 C Y N 164 IGV C20 C Y N 165 IGV C27 C N N 166 IGV N29 N N N 167 IGV C30 C N N 168 IGV C31 C N N 169 IGV C32 C N N 170 IGV N12 N Y N 171 IGV C17 C Y N 172 IGV C26 C N N 173 IGV C28 C N N 174 IGV C04 C Y N 175 IGV C05 C Y N 176 IGV C06 C Y N 177 IGV C07 C Y N 178 IGV C09 C Y N 179 IGV C18 C Y N 180 IGV C23 C Y N 181 IGV C25 C N S 182 IGV C40 C Y N 183 IGV C42 C Y N 184 IGV C43 C Y N 185 IGV C44 C Y N 186 IGV C45 C Y N 187 IGV C46 C Y N 188 IGV C47 C Y N 189 IGV C48 C Y N 190 IGV C49 C Y N 191 IGV C50 C Y N 192 IGV C51 C Y N 193 IGV C52 C Y N 194 IGV C53 C Y N 195 IGV F08 F N N 196 IGV F41 F N N 197 IGV N03 N N N 198 IGV N10 N Y N 199 IGV N11 N Y N 200 IGV N19 N Y N 201 IGV N21 N Y N 202 IGV N22 N Y N 203 IGV O01 O N N 204 IGV O24 O N N 205 IGV O39 O N N 206 IGV O54 O N N 207 IGV S02 S N N 208 IGV H1 H N N 209 IGV H2 H N N 210 IGV H3 H N N 211 IGV H4 H N N 212 IGV H5 H N N 213 IGV H6 H N N 214 IGV H7 H N N 215 IGV H8 H N N 216 IGV H9 H N N 217 IGV H10 H N N 218 IGV H11 H N N 219 IGV H12 H N N 220 IGV H13 H N N 221 IGV H14 H N N 222 IGV H15 H N N 223 IGV H16 H N N 224 IGV H17 H N N 225 IGV H18 H N N 226 IGV H19 H N N 227 IGV H20 H N N 228 IGV H21 H N N 229 IGV H22 H N N 230 IGV H23 H N N 231 IGV H24 H N N 232 IGV H25 H N N 233 IGV H26 H N N 234 IGV H27 H N N 235 IGV H28 H N N 236 ILE N N N N 237 ILE CA C N S 238 ILE C C N N 239 ILE O O N N 240 ILE CB C N S 241 ILE CG1 C N N 242 ILE CG2 C N N 243 ILE CD1 C N N 244 ILE OXT O N N 245 ILE H H N N 246 ILE H2 H N N 247 ILE HA H N N 248 ILE HB H N N 249 ILE HG12 H N N 250 ILE HG13 H N N 251 ILE HG21 H N N 252 ILE HG22 H N N 253 ILE HG23 H N N 254 ILE HD11 H N N 255 ILE HD12 H N N 256 ILE HD13 H N N 257 ILE HXT H N N 258 LEU N N N N 259 LEU CA C N S 260 LEU C C N N 261 LEU O O N N 262 LEU CB C N N 263 LEU CG C N N 264 LEU CD1 C N N 265 LEU CD2 C N N 266 LEU OXT O N N 267 LEU H H N N 268 LEU H2 H N N 269 LEU HA H N N 270 LEU HB2 H N N 271 LEU HB3 H N N 272 LEU HG H N N 273 LEU HD11 H N N 274 LEU HD12 H N N 275 LEU HD13 H N N 276 LEU HD21 H N N 277 LEU HD22 H N N 278 LEU HD23 H N N 279 LEU HXT H N N 280 LYS N N N N 281 LYS CA C N S 282 LYS C C N N 283 LYS O O N N 284 LYS CB C N N 285 LYS CG C N N 286 LYS CD C N N 287 LYS CE C N N 288 LYS NZ N N N 289 LYS OXT O N N 290 LYS H H N N 291 LYS H2 H N N 292 LYS HA H N N 293 LYS HB2 H N N 294 LYS HB3 H N N 295 LYS HG2 H N N 296 LYS HG3 H N N 297 LYS HD2 H N N 298 LYS HD3 H N N 299 LYS HE2 H N N 300 LYS HE3 H N N 301 LYS HZ1 H N N 302 LYS HZ2 H N N 303 LYS HZ3 H N N 304 LYS HXT H N N 305 MET N N N N 306 MET CA C N S 307 MET C C N N 308 MET O O N N 309 MET CB C N N 310 MET CG C N N 311 MET SD S N N 312 MET CE C N N 313 MET OXT O N N 314 MET H H N N 315 MET H2 H N N 316 MET HA H N N 317 MET HB2 H N N 318 MET HB3 H N N 319 MET HG2 H N N 320 MET HG3 H N N 321 MET HE1 H N N 322 MET HE2 H N N 323 MET HE3 H N N 324 MET HXT H N N 325 PHE N N N N 326 PHE CA C N S 327 PHE C C N N 328 PHE O O N N 329 PHE CB C N N 330 PHE CG C Y N 331 PHE CD1 C Y N 332 PHE CD2 C Y N 333 PHE CE1 C Y N 334 PHE CE2 C Y N 335 PHE CZ C Y N 336 PHE OXT O N N 337 PHE H H N N 338 PHE H2 H N N 339 PHE HA H N N 340 PHE HB2 H N N 341 PHE HB3 H N N 342 PHE HD1 H N N 343 PHE HD2 H N N 344 PHE HE1 H N N 345 PHE HE2 H N N 346 PHE HZ H N N 347 PHE HXT H N N 348 PRO N N N N 349 PRO CA C N S 350 PRO C C N N 351 PRO O O N N 352 PRO CB C N N 353 PRO CG C N N 354 PRO CD C N N 355 PRO OXT O N N 356 PRO H H N N 357 PRO HA H N N 358 PRO HB2 H N N 359 PRO HB3 H N N 360 PRO HG2 H N N 361 PRO HG3 H N N 362 PRO HD2 H N N 363 PRO HD3 H N N 364 PRO HXT H N N 365 SER N N N N 366 SER CA C N S 367 SER C C N N 368 SER O O N N 369 SER CB C N N 370 SER OG O N N 371 SER OXT O N N 372 SER H H N N 373 SER H2 H N N 374 SER HA H N N 375 SER HB2 H N N 376 SER HB3 H N N 377 SER HG H N N 378 SER HXT H N N 379 THR N N N N 380 THR CA C N S 381 THR C C N N 382 THR O O N N 383 THR CB C N R 384 THR OG1 O N N 385 THR CG2 C N N 386 THR OXT O N N 387 THR H H N N 388 THR H2 H N N 389 THR HA H N N 390 THR HB H N N 391 THR HG1 H N N 392 THR HG21 H N N 393 THR HG22 H N N 394 THR HG23 H N N 395 THR HXT H N N 396 TRP N N N N 397 TRP CA C N S 398 TRP C C N N 399 TRP O O N N 400 TRP CB C N N 401 TRP CG C Y N 402 TRP CD1 C Y N 403 TRP CD2 C Y N 404 TRP NE1 N Y N 405 TRP CE2 C Y N 406 TRP CE3 C Y N 407 TRP CZ2 C Y N 408 TRP CZ3 C Y N 409 TRP CH2 C Y N 410 TRP OXT O N N 411 TRP H H N N 412 TRP H2 H N N 413 TRP HA H N N 414 TRP HB2 H N N 415 TRP HB3 H N N 416 TRP HD1 H N N 417 TRP HE1 H N N 418 TRP HE3 H N N 419 TRP HZ2 H N N 420 TRP HZ3 H N N 421 TRP HH2 H N N 422 TRP HXT H N N 423 TYR N N N N 424 TYR CA C N S 425 TYR C C N N 426 TYR O O N N 427 TYR CB C N N 428 TYR CG C Y N 429 TYR CD1 C Y N 430 TYR CD2 C Y N 431 TYR CE1 C Y N 432 TYR CE2 C Y N 433 TYR CZ C Y N 434 TYR OH O N N 435 TYR OXT O N N 436 TYR H H N N 437 TYR H2 H N N 438 TYR HA H N N 439 TYR HB2 H N N 440 TYR HB3 H N N 441 TYR HD1 H N N 442 TYR HD2 H N N 443 TYR HE1 H N N 444 TYR HE2 H N N 445 TYR HH H N N 446 TYR HXT H N N 447 VAL N N N N 448 VAL CA C N S 449 VAL C C N N 450 VAL O O N N 451 VAL CB C N N 452 VAL CG1 C N N 453 VAL CG2 C N N 454 VAL OXT O N N 455 VAL H H N N 456 VAL H2 H N N 457 VAL HA H N N 458 VAL HB H N N 459 VAL HG11 H N N 460 VAL HG12 H N N 461 VAL HG13 H N N 462 VAL HG21 H N N 463 VAL HG22 H N N 464 VAL HG23 H N N 465 VAL HXT H N N 466 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 IGV C27 C25 sing N N 152 IGV C27 C28 sing N N 153 IGV C25 C26 sing N N 154 IGV C25 O24 sing N N 155 IGV N22 N21 sing Y N 156 IGV N22 C23 doub Y N 157 IGV C26 N29 sing N N 158 IGV C28 N29 sing N N 159 IGV N21 C20 sing Y N 160 IGV N29 C30 sing N N 161 IGV C23 O24 sing N N 162 IGV C23 C17 sing Y N 163 IGV C30 O39 doub N N 164 IGV C30 C31 sing N N 165 IGV C31 C32 sing N N 166 IGV C20 C17 doub Y N 167 IGV C20 N19 sing Y N 168 IGV C17 C16 sing Y N 169 IGV N19 C18 doub Y N 170 IGV C16 C15 doub Y N 171 IGV C18 C15 sing Y N 172 IGV C15 C14 sing N N 173 IGV C14 N12 sing Y N 174 IGV C14 C13 doub Y N 175 IGV N12 N11 doub Y N 176 IGV C13 N10 sing Y N 177 IGV N11 N10 sing Y N 178 IGV N10 C09 sing N N 179 IGV F41 C40 sing N N 180 IGV C09 C40 doub Y N 181 IGV C09 C07 sing Y N 182 IGV F08 C07 sing N N 183 IGV C40 C04 sing Y N 184 IGV C07 C06 doub Y N 185 IGV C04 N03 sing N N 186 IGV C04 C05 doub Y N 187 IGV N03 S02 sing N N 188 IGV C06 C05 sing Y N 189 IGV C43 C44 doub Y N 190 IGV C43 C42 sing Y N 191 IGV S02 O54 doub N N 192 IGV S02 C42 sing N N 193 IGV S02 O01 doub N N 194 IGV C44 C45 sing Y N 195 IGV C42 C53 doub Y N 196 IGV C45 C46 doub Y N 197 IGV C53 C46 sing Y N 198 IGV C46 C47 sing N N 199 IGV C47 C52 doub Y N 200 IGV C47 C48 sing Y N 201 IGV C52 C51 sing Y N 202 IGV C48 C49 doub Y N 203 IGV C51 C50 doub Y N 204 IGV C49 C50 sing Y N 205 IGV C13 H1 sing N N 206 IGV C16 H2 sing N N 207 IGV C27 H3 sing N N 208 IGV C27 H4 sing N N 209 IGV C31 H5 sing N N 210 IGV C31 H6 sing N N 211 IGV C32 H7 sing N N 212 IGV C32 H8 sing N N 213 IGV C32 H9 sing N N 214 IGV C26 H10 sing N N 215 IGV C26 H11 sing N N 216 IGV C28 H12 sing N N 217 IGV C28 H13 sing N N 218 IGV C05 H14 sing N N 219 IGV C06 H15 sing N N 220 IGV C18 H16 sing N N 221 IGV C25 H17 sing N N 222 IGV C43 H18 sing N N 223 IGV C44 H19 sing N N 224 IGV C45 H20 sing N N 225 IGV C48 H21 sing N N 226 IGV C49 H22 sing N N 227 IGV C50 H23 sing N N 228 IGV C51 H24 sing N N 229 IGV C52 H25 sing N N 230 IGV C53 H26 sing N N 231 IGV N03 H27 sing N N 232 IGV N21 H28 sing N N 233 ILE N CA sing N N 234 ILE N H sing N N 235 ILE N H2 sing N N 236 ILE CA C sing N N 237 ILE CA CB sing N N 238 ILE CA HA sing N N 239 ILE C O doub N N 240 ILE C OXT sing N N 241 ILE CB CG1 sing N N 242 ILE CB CG2 sing N N 243 ILE CB HB sing N N 244 ILE CG1 CD1 sing N N 245 ILE CG1 HG12 sing N N 246 ILE CG1 HG13 sing N N 247 ILE CG2 HG21 sing N N 248 ILE CG2 HG22 sing N N 249 ILE CG2 HG23 sing N N 250 ILE CD1 HD11 sing N N 251 ILE CD1 HD12 sing N N 252 ILE CD1 HD13 sing N N 253 ILE OXT HXT sing N N 254 LEU N CA sing N N 255 LEU N H sing N N 256 LEU N H2 sing N N 257 LEU CA C sing N N 258 LEU CA CB sing N N 259 LEU CA HA sing N N 260 LEU C O doub N N 261 LEU C OXT sing N N 262 LEU CB CG sing N N 263 LEU CB HB2 sing N N 264 LEU CB HB3 sing N N 265 LEU CG CD1 sing N N 266 LEU CG CD2 sing N N 267 LEU CG HG sing N N 268 LEU CD1 HD11 sing N N 269 LEU CD1 HD12 sing N N 270 LEU CD1 HD13 sing N N 271 LEU CD2 HD21 sing N N 272 LEU CD2 HD22 sing N N 273 LEU CD2 HD23 sing N N 274 LEU OXT HXT sing N N 275 LYS N CA sing N N 276 LYS N H sing N N 277 LYS N H2 sing N N 278 LYS CA C sing N N 279 LYS CA CB sing N N 280 LYS CA HA sing N N 281 LYS C O doub N N 282 LYS C OXT sing N N 283 LYS CB CG sing N N 284 LYS CB HB2 sing N N 285 LYS CB HB3 sing N N 286 LYS CG CD sing N N 287 LYS CG HG2 sing N N 288 LYS CG HG3 sing N N 289 LYS CD CE sing N N 290 LYS CD HD2 sing N N 291 LYS CD HD3 sing N N 292 LYS CE NZ sing N N 293 LYS CE HE2 sing N N 294 LYS CE HE3 sing N N 295 LYS NZ HZ1 sing N N 296 LYS NZ HZ2 sing N N 297 LYS NZ HZ3 sing N N 298 LYS OXT HXT sing N N 299 MET N CA sing N N 300 MET N H sing N N 301 MET N H2 sing N N 302 MET CA C sing N N 303 MET CA CB sing N N 304 MET CA HA sing N N 305 MET C O doub N N 306 MET C OXT sing N N 307 MET CB CG sing N N 308 MET CB HB2 sing N N 309 MET CB HB3 sing N N 310 MET CG SD sing N N 311 MET CG HG2 sing N N 312 MET CG HG3 sing N N 313 MET SD CE sing N N 314 MET CE HE1 sing N N 315 MET CE HE2 sing N N 316 MET CE HE3 sing N N 317 MET OXT HXT sing N N 318 PHE N CA sing N N 319 PHE N H sing N N 320 PHE N H2 sing N N 321 PHE CA C sing N N 322 PHE CA CB sing N N 323 PHE CA HA sing N N 324 PHE C O doub N N 325 PHE C OXT sing N N 326 PHE CB CG sing N N 327 PHE CB HB2 sing N N 328 PHE CB HB3 sing N N 329 PHE CG CD1 doub Y N 330 PHE CG CD2 sing Y N 331 PHE CD1 CE1 sing Y N 332 PHE CD1 HD1 sing N N 333 PHE CD2 CE2 doub Y N 334 PHE CD2 HD2 sing N N 335 PHE CE1 CZ doub Y N 336 PHE CE1 HE1 sing N N 337 PHE CE2 CZ sing Y N 338 PHE CE2 HE2 sing N N 339 PHE CZ HZ sing N N 340 PHE OXT HXT sing N N 341 PRO N CA sing N N 342 PRO N CD sing N N 343 PRO N H sing N N 344 PRO CA C sing N N 345 PRO CA CB sing N N 346 PRO CA HA sing N N 347 PRO C O doub N N 348 PRO C OXT sing N N 349 PRO CB CG sing N N 350 PRO CB HB2 sing N N 351 PRO CB HB3 sing N N 352 PRO CG CD sing N N 353 PRO CG HG2 sing N N 354 PRO CG HG3 sing N N 355 PRO CD HD2 sing N N 356 PRO CD HD3 sing N N 357 PRO OXT HXT sing N N 358 SER N CA sing N N 359 SER N H sing N N 360 SER N H2 sing N N 361 SER CA C sing N N 362 SER CA CB sing N N 363 SER CA HA sing N N 364 SER C O doub N N 365 SER C OXT sing N N 366 SER CB OG sing N N 367 SER CB HB2 sing N N 368 SER CB HB3 sing N N 369 SER OG HG sing N N 370 SER OXT HXT sing N N 371 THR N CA sing N N 372 THR N H sing N N 373 THR N H2 sing N N 374 THR CA C sing N N 375 THR CA CB sing N N 376 THR CA HA sing N N 377 THR C O doub N N 378 THR C OXT sing N N 379 THR CB OG1 sing N N 380 THR CB CG2 sing N N 381 THR CB HB sing N N 382 THR OG1 HG1 sing N N 383 THR CG2 HG21 sing N N 384 THR CG2 HG22 sing N N 385 THR CG2 HG23 sing N N 386 THR OXT HXT sing N N 387 TRP N CA sing N N 388 TRP N H sing N N 389 TRP N H2 sing N N 390 TRP CA C sing N N 391 TRP CA CB sing N N 392 TRP CA HA sing N N 393 TRP C O doub N N 394 TRP C OXT sing N N 395 TRP CB CG sing N N 396 TRP CB HB2 sing N N 397 TRP CB HB3 sing N N 398 TRP CG CD1 doub Y N 399 TRP CG CD2 sing Y N 400 TRP CD1 NE1 sing Y N 401 TRP CD1 HD1 sing N N 402 TRP CD2 CE2 doub Y N 403 TRP CD2 CE3 sing Y N 404 TRP NE1 CE2 sing Y N 405 TRP NE1 HE1 sing N N 406 TRP CE2 CZ2 sing Y N 407 TRP CE3 CZ3 doub Y N 408 TRP CE3 HE3 sing N N 409 TRP CZ2 CH2 doub Y N 410 TRP CZ2 HZ2 sing N N 411 TRP CZ3 CH2 sing Y N 412 TRP CZ3 HZ3 sing N N 413 TRP CH2 HH2 sing N N 414 TRP OXT HXT sing N N 415 TYR N CA sing N N 416 TYR N H sing N N 417 TYR N H2 sing N N 418 TYR CA C sing N N 419 TYR CA CB sing N N 420 TYR CA HA sing N N 421 TYR C O doub N N 422 TYR C OXT sing N N 423 TYR CB CG sing N N 424 TYR CB HB2 sing N N 425 TYR CB HB3 sing N N 426 TYR CG CD1 doub Y N 427 TYR CG CD2 sing Y N 428 TYR CD1 CE1 sing Y N 429 TYR CD1 HD1 sing N N 430 TYR CD2 CE2 doub Y N 431 TYR CD2 HD2 sing N N 432 TYR CE1 CZ doub Y N 433 TYR CE1 HE1 sing N N 434 TYR CE2 CZ sing Y N 435 TYR CE2 HE2 sing N N 436 TYR CZ OH sing N N 437 TYR OH HH sing N N 438 TYR OXT HXT sing N N 439 VAL N CA sing N N 440 VAL N H sing N N 441 VAL N H2 sing N N 442 VAL CA C sing N N 443 VAL CA CB sing N N 444 VAL CA HA sing N N 445 VAL C O doub N N 446 VAL C OXT sing N N 447 VAL CB CG1 sing N N 448 VAL CB CG2 sing N N 449 VAL CB HB sing N N 450 VAL CG1 HG11 sing N N 451 VAL CG1 HG12 sing N N 452 VAL CG1 HG13 sing N N 453 VAL CG2 HG21 sing N N 454 VAL CG2 HG22 sing N N 455 VAL CG2 HG23 sing N N 456 VAL OXT HXT sing N N 457 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 7YAZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007694 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002174 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020573 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024233 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S # loop_ #