data_7YHD
# 
_entry.id   7YHD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.380 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7YHD         pdb_00007yhd 10.2210/pdb7yhd/pdb 
WWPDB D_1300030866 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7YHD 
_pdbx_database_status.recvd_initial_deposition_date   2022-07-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, G.-B.'  1 0000-0002-4915-6677 
'Yan, Y.-H.' 2 0000-0002-1331-1241 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   FR 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Eur.J.Med.Chem. 
_citation.journal_id_ASTM           EJMCA5 
_citation.journal_id_CSD            0493 
_citation.journal_id_ISSN           0223-5234 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            257 
_citation.language                  ? 
_citation.page_first                115473 
_citation.page_last                 115473 
_citation.title                     
'Metal binding pharmacophore click-derived discovery of new broad-spectrum metallo-beta-lactamase inhibitors.' 
_citation.year                      2023 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.ejmech.2023.115473 
_citation.pdbx_database_id_PubMed   37209449 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yan, Y.H.'   1  ? 
primary 'Ding, H.S.'  2  ? 
primary 'Zhu, K.R.'   3  ? 
primary 'Mu, B.S.'    4  ? 
primary 'Zheng, Y.'   5  ? 
primary 'Huang, M.Y.' 6  ? 
primary 'Zhou, C.'    7  ? 
primary 'Li, W.F.'    8  ? 
primary 'Wang, Z.'    9  ? 
primary 'Wu, Y.'      10 ? 
primary 'Li, G.B.'    11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7YHD 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     67.407 
_cell.length_a_esd                 ? 
_cell.length_b                     77.566 
_cell.length_b_esd                 ? 
_cell.length_c                     79.019 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         7YHD 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Beta-lactamase class B VIM-2'                                     24679.439 1  ? ? ? ? 
2 non-polymer syn 'ZINC ION'                                                         65.409    2  ? ? ? ? 
3 non-polymer syn '3-[4-[4-(2-azanylethoxy)phenyl]-1,2,3-triazol-1-yl]phthalic acid' 368.343   1  ? ? ? ? 
4 water       nat water                                                              18.015    44 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;BlaVIM-2,Metallo beta lactamase VIM-2,Metallo beta-lactamase,Metallo-beta lactamase protein,Metallo-beta-lactamase VIM-2,VIM-2 class B beta-lactamase,VIM-2 class B metallo b-lactamase,VIM-2 metallo beta-lactamase,VIM-2 type metallo-beta-lactamase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV
STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA
SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV
STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA
SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   TYR n 
1 3   PRO n 
1 4   THR n 
1 5   VAL n 
1 6   SER n 
1 7   GLU n 
1 8   ILE n 
1 9   PRO n 
1 10  VAL n 
1 11  GLY n 
1 12  GLU n 
1 13  VAL n 
1 14  ARG n 
1 15  LEU n 
1 16  TYR n 
1 17  GLN n 
1 18  ILE n 
1 19  ALA n 
1 20  ASP n 
1 21  GLY n 
1 22  VAL n 
1 23  TRP n 
1 24  SER n 
1 25  HIS n 
1 26  ILE n 
1 27  ALA n 
1 28  THR n 
1 29  GLN n 
1 30  SER n 
1 31  PHE n 
1 32  ASP n 
1 33  GLY n 
1 34  ALA n 
1 35  VAL n 
1 36  TYR n 
1 37  PRO n 
1 38  SER n 
1 39  ASN n 
1 40  GLY n 
1 41  LEU n 
1 42  ILE n 
1 43  VAL n 
1 44  ARG n 
1 45  ASP n 
1 46  GLY n 
1 47  ASP n 
1 48  GLU n 
1 49  LEU n 
1 50  LEU n 
1 51  LEU n 
1 52  ILE n 
1 53  ASP n 
1 54  THR n 
1 55  ALA n 
1 56  TRP n 
1 57  GLY n 
1 58  ALA n 
1 59  LYS n 
1 60  ASN n 
1 61  THR n 
1 62  ALA n 
1 63  ALA n 
1 64  LEU n 
1 65  LEU n 
1 66  ALA n 
1 67  GLU n 
1 68  ILE n 
1 69  GLU n 
1 70  LYS n 
1 71  GLN n 
1 72  ILE n 
1 73  GLY n 
1 74  LEU n 
1 75  PRO n 
1 76  VAL n 
1 77  THR n 
1 78  ARG n 
1 79  ALA n 
1 80  VAL n 
1 81  SER n 
1 82  THR n 
1 83  HIS n 
1 84  PHE n 
1 85  HIS n 
1 86  ASP n 
1 87  ASP n 
1 88  ARG n 
1 89  VAL n 
1 90  GLY n 
1 91  GLY n 
1 92  VAL n 
1 93  ASP n 
1 94  VAL n 
1 95  LEU n 
1 96  ARG n 
1 97  ALA n 
1 98  ALA n 
1 99  GLY n 
1 100 VAL n 
1 101 ALA n 
1 102 THR n 
1 103 TYR n 
1 104 ALA n 
1 105 SER n 
1 106 PRO n 
1 107 SER n 
1 108 THR n 
1 109 ARG n 
1 110 ARG n 
1 111 LEU n 
1 112 ALA n 
1 113 GLU n 
1 114 VAL n 
1 115 GLU n 
1 116 GLY n 
1 117 ASN n 
1 118 GLU n 
1 119 ILE n 
1 120 PRO n 
1 121 THR n 
1 122 HIS n 
1 123 SER n 
1 124 LEU n 
1 125 GLU n 
1 126 GLY n 
1 127 LEU n 
1 128 SER n 
1 129 SER n 
1 130 SER n 
1 131 GLY n 
1 132 ASP n 
1 133 ALA n 
1 134 VAL n 
1 135 ARG n 
1 136 PHE n 
1 137 GLY n 
1 138 PRO n 
1 139 VAL n 
1 140 GLU n 
1 141 LEU n 
1 142 PHE n 
1 143 TYR n 
1 144 PRO n 
1 145 GLY n 
1 146 ALA n 
1 147 ALA n 
1 148 HIS n 
1 149 SER n 
1 150 THR n 
1 151 ASP n 
1 152 ASN n 
1 153 LEU n 
1 154 VAL n 
1 155 VAL n 
1 156 TYR n 
1 157 VAL n 
1 158 PRO n 
1 159 SER n 
1 160 ALA n 
1 161 SER n 
1 162 VAL n 
1 163 LEU n 
1 164 TYR n 
1 165 GLY n 
1 166 GLY n 
1 167 CYS n 
1 168 ALA n 
1 169 ILE n 
1 170 TYR n 
1 171 GLU n 
1 172 LEU n 
1 173 SER n 
1 174 ARG n 
1 175 THR n 
1 176 SER n 
1 177 ALA n 
1 178 GLY n 
1 179 ASN n 
1 180 VAL n 
1 181 ALA n 
1 182 ASP n 
1 183 ALA n 
1 184 ASP n 
1 185 LEU n 
1 186 ALA n 
1 187 GLU n 
1 188 TRP n 
1 189 PRO n 
1 190 THR n 
1 191 SER n 
1 192 ILE n 
1 193 GLU n 
1 194 ARG n 
1 195 ILE n 
1 196 GLN n 
1 197 GLN n 
1 198 HIS n 
1 199 TYR n 
1 200 PRO n 
1 201 GLU n 
1 202 ALA n 
1 203 GLN n 
1 204 PHE n 
1 205 VAL n 
1 206 ILE n 
1 207 PRO n 
1 208 GLY n 
1 209 HIS n 
1 210 GLY n 
1 211 LEU n 
1 212 PRO n 
1 213 GLY n 
1 214 GLY n 
1 215 LEU n 
1 216 ASP n 
1 217 LEU n 
1 218 LEU n 
1 219 LYS n 
1 220 HIS n 
1 221 THR n 
1 222 THR n 
1 223 ASN n 
1 224 VAL n 
1 225 VAL n 
1 226 LYS n 
1 227 ALA n 
1 228 HIS n 
1 229 THR n 
1 230 ASN n 
1 231 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   231 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 
'blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'Pseudomonas aeruginosa' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9K2N0_PSEAI 
_struct_ref.pdbx_db_accession          Q9K2N0 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV
STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA
SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR
;
_struct_ref.pdbx_align_begin           32 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7YHD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 231 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9K2N0 
_struct_ref_seq.db_align_beg                  32 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  262 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       32 
_struct_ref_seq.pdbx_auth_seq_align_end       262 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                         ? 'C6 H13 N O2'    131.173 
IU7 non-polymer         . '3-[4-[4-(2-azanylethoxy)phenyl]-1,2,3-triazol-1-yl]phthalic acid' ? 'C18 H16 N4 O5'  368.343 
LEU 'L-peptide linking' y LEUCINE                                                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                             ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE                                                      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                             ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                                                         ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7YHD 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                       ? 
_exptl_crystal.density_diffrn               ? 
_exptl_crystal.density_Matthews             2.09 
_exptl_crystal.density_method               ? 
_exptl_crystal.density_percent_sol          41.22 
_exptl_crystal.description                  ? 
_exptl_crystal.F_000                        ? 
_exptl_crystal.id                           1 
_exptl_crystal.preparation                  ? 
_exptl_crystal.size_max                     ? 
_exptl_crystal.size_mid                     ? 
_exptl_crystal.size_min                     ? 
_exptl_crystal.size_rad                     ? 
_exptl_crystal.colour_lustre                ? 
_exptl_crystal.colour_modifier              ? 
_exptl_crystal.colour_primary               ? 
_exptl_crystal.density_meas                 ? 
_exptl_crystal.density_meas_esd             ? 
_exptl_crystal.density_meas_gt              ? 
_exptl_crystal.density_meas_lt              ? 
_exptl_crystal.density_meas_temp            ? 
_exptl_crystal.density_meas_temp_esd        ? 
_exptl_crystal.density_meas_temp_gt         ? 
_exptl_crystal.density_meas_temp_lt         ? 
_exptl_crystal.pdbx_crystal_image_url       ? 
_exptl_crystal.pdbx_crystal_image_format    ? 
_exptl_crystal.pdbx_mosaicity               ? 
_exptl_crystal.pdbx_mosaicity_esd           ? 
_exptl_crystal.pdbx_mosaic_method           ? 
_exptl_crystal.pdbx_mosaic_block_size       ? 
_exptl_crystal.pdbx_mosaic_block_size_esd   ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M Magnesium Formate, 23-30% (v/v) Polyethylene glycol 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     195 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X CdTe 1M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-05-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate                          21.580 
_reflns.entry_id                                       7YHD 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              1.6960 
_reflns.d_resolution_low                               19.3920 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     22860 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           98.12 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                11.6 
_reflns.pdbx_Rmerge_I_obs                              0.134 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          10.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.998 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
_reflns.pdbx_CC_split_method                           ? 
# 
_reflns_shell.d_res_high                                    1.70 
_reflns_shell.d_res_low                                     1.76 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           ? 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             1854 
_reflns_shell.percent_possible_all                          ? 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  0.851 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               ? 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  ? 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                117.520 
_refine.B_iso_mean                               32.2407 
_refine.B_iso_min                                8.080 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7YHD 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.6960 
_refine.ls_d_res_low                             19.3920 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     22586 
_refine.ls_number_reflns_R_free                  2002 
_refine.ls_number_reflns_R_work                  20584 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.9400 
_refine.ls_percent_reflns_R_free                 8.8600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2788 
_refine.ls_R_factor_R_free                       0.3402 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2726 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.470 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6JN6 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 40.9300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3700 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.6960 
_refine_hist.d_res_low                        19.3920 
_refine_hist.number_atoms_solvent             44 
_refine_hist.number_atoms_total               1806 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       231 
_refine_hist.pdbx_B_iso_mean_ligand           44.48 
_refine_hist.pdbx_B_iso_mean_solvent          28.34 
_refine_hist.pdbx_number_atoms_protein        1733 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.024  ? 1813 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.333  ? 2469 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.062  ? 280  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.009  ? 324  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.308 ? 1043 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.6960 1.7384  . . 111 1071 73.0000  . . . 0.5181 0.0000 0.4444 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7384 1.7853  . . 140 1495 100.0000 . . . 0.3776 0.0000 0.3608 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7853 1.8378  . . 148 1507 100.0000 . . . 0.4478 0.0000 0.3624 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8378 1.8971  . . 146 1496 100.0000 . . . 0.4329 0.0000 0.3531 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8971 1.9648  . . 148 1499 100.0000 . . . 0.4168 0.0000 0.3424 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9648 2.0434  . . 134 1486 100.0000 . . . 0.3804 0.0000 0.3159 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0434 2.1363  . . 150 1496 100.0000 . . . 0.3515 0.0000 0.2974 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1363 2.2488  . . 154 1510 100.0000 . . . 0.3262 0.0000 0.2993 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2488 2.3894  . . 143 1510 99.0000  . . . 0.3638 0.0000 0.3065 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3894 2.5736  . . 146 1495 99.0000  . . . 0.3745 0.0000 0.3217 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5736 2.8318  . . 146 1489 98.0000  . . . 0.4194 0.0000 0.2978 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8318 3.2400  . . 146 1512 99.0000  . . . 0.3327 0.0000 0.2738 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2400 4.0758  . . 149 1516 98.0000  . . . 0.2985 0.0000 0.2264 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0758 19.3920 . . 141 1502 93.0000  . . . 0.2616 0.0000 0.1917 . . . . . . . . . . . 
# 
_struct.entry_id                     7YHD 
_struct.title                        
'Crystal structure of VIM-2 MBL in complex with 3-(4-(4-(2-aminoethoxy)phenyl)-1H-1,2,3-triazol-1-yl)phthalic acid' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7YHD 
_struct_keywords.text            'Metallo-beta-lactamase VIM-2, HYDROLASE, HYDROLASE-INHIBITOR complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/INHIBITOR 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 4   ? ILE A 8   ? THR A 35  ILE A 39  5 ? 5  
HELX_P HELX_P2 AA2 GLY A 57  ? ILE A 72  ? GLY A 88  ILE A 103 1 ? 16 
HELX_P HELX_P3 AA3 HIS A 85  ? GLY A 90  ? HIS A 116 GLY A 121 1 ? 6  
HELX_P HELX_P4 AA4 GLY A 91  ? ALA A 98  ? GLY A 122 ALA A 129 1 ? 8  
HELX_P HELX_P5 AA5 SER A 105 ? GLY A 116 ? SER A 136 GLY A 147 1 ? 12 
HELX_P HELX_P6 AA6 CYS A 167 ? ILE A 169 ? CYS A 198 ILE A 200 5 ? 3  
HELX_P HELX_P7 AA7 GLU A 187 ? TYR A 199 ? GLU A 218 TYR A 230 1 ? 13 
HELX_P HELX_P8 AA8 LEU A 215 ? ASN A 230 ? LEU A 246 ASN A 261 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A HIS 83  NE2 ? ? ? 1_555 C ZN  . ZN  ? ? A HIS 114 A ZN  302 1_555 ? ? ? ? ? ? ? 2.187 ? ? 
metalc2 metalc ? ? A HIS 85  ND1 ? ? ? 1_555 C ZN  . ZN  ? ? A HIS 116 A ZN  302 1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc3 metalc ? ? A ASP 87  OD2 ? ? ? 1_555 B ZN  . ZN  ? ? A ASP 118 A ZN  301 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc4 metalc ? ? A HIS 148 NE2 ? ? ? 1_555 C ZN  . ZN  ? ? A HIS 179 A ZN  302 1_555 ? ? ? ? ? ? ? 1.977 ? ? 
metalc5 metalc ? ? A CYS 167 SG  ? ? ? 1_555 B ZN  . ZN  ? ? A CYS 198 A ZN  301 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc6 metalc ? ? A HIS 209 NE2 ? ? ? 1_555 B ZN  . ZN  ? ? A HIS 240 A ZN  301 1_555 ? ? ? ? ? ? ? 2.149 ? ? 
metalc7 metalc ? ? B ZN  .   ZN  ? ? ? 1_555 D IU7 . O03 ? ? A ZN  301 A IU7 303 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc8 metalc ? ? B ZN  .   ZN  ? ? ? 1_555 D IU7 . O08 ? ? A ZN  301 A IU7 303 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc9 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 D IU7 . O03 ? ? A ZN  302 A IU7 303 1_555 ? ? ? ? ? ? ? 1.872 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 14  ? ALA A 19  ? ARG A 45  ALA A 50  
AA1 2 VAL A 22  ? PHE A 31  ? VAL A 53  PHE A 62  
AA1 3 ALA A 34  ? ASP A 45  ? ALA A 65  ASP A 76  
AA1 4 GLU A 48  ? ILE A 52  ? GLU A 79  ILE A 83  
AA1 5 VAL A 76  ? VAL A 80  ? VAL A 107 VAL A 111 
AA1 6 ALA A 101 ? ALA A 104 ? ALA A 132 ALA A 135 
AA1 7 HIS A 122 ? SER A 123 ? HIS A 153 SER A 154 
AA2 1 ALA A 133 ? PHE A 136 ? ALA A 164 PHE A 167 
AA2 2 VAL A 139 ? PHE A 142 ? VAL A 170 PHE A 173 
AA2 3 VAL A 154 ? VAL A 157 ? VAL A 185 VAL A 188 
AA2 4 VAL A 162 ? GLY A 166 ? VAL A 193 GLY A 197 
AA2 5 PHE A 204 ? PRO A 207 ? PHE A 235 PRO A 238 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 18  ? N ILE A 49  O VAL A 22  ? O VAL A 53  
AA1 2 3 N TRP A 23  ? N TRP A 54  O ILE A 42  ? O ILE A 73  
AA1 3 4 N LEU A 41  ? N LEU A 72  O ILE A 52  ? O ILE A 83  
AA1 4 5 N LEU A 51  ? N LEU A 82  O ARG A 78  ? O ARG A 109 
AA1 5 6 N THR A 77  ? N THR A 108 O ALA A 101 ? O ALA A 132 
AA1 6 7 N THR A 102 ? N THR A 133 O HIS A 122 ? O HIS A 153 
AA2 1 2 N VAL A 134 ? N VAL A 165 O LEU A 141 ? O LEU A 172 
AA2 2 3 N PHE A 142 ? N PHE A 173 O VAL A 154 ? O VAL A 185 
AA2 3 4 N VAL A 155 ? N VAL A 186 O TYR A 164 ? O TYR A 195 
AA2 4 5 N LEU A 163 ? N LEU A 194 O PHE A 204 ? O PHE A 235 
# 
_atom_sites.entry_id                    7YHD 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.014835 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012892 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012655 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   32  32  GLU GLU A . n 
A 1 2   TYR 2   33  33  TYR TYR A . n 
A 1 3   PRO 3   34  34  PRO PRO A . n 
A 1 4   THR 4   35  35  THR THR A . n 
A 1 5   VAL 5   36  36  VAL VAL A . n 
A 1 6   SER 6   37  37  SER SER A . n 
A 1 7   GLU 7   38  38  GLU GLU A . n 
A 1 8   ILE 8   39  39  ILE ILE A . n 
A 1 9   PRO 9   40  40  PRO PRO A . n 
A 1 10  VAL 10  41  41  VAL VAL A . n 
A 1 11  GLY 11  42  42  GLY GLY A . n 
A 1 12  GLU 12  43  43  GLU GLU A . n 
A 1 13  VAL 13  44  44  VAL VAL A . n 
A 1 14  ARG 14  45  45  ARG ARG A . n 
A 1 15  LEU 15  46  46  LEU LEU A . n 
A 1 16  TYR 16  47  47  TYR TYR A . n 
A 1 17  GLN 17  48  48  GLN GLN A . n 
A 1 18  ILE 18  49  49  ILE ILE A . n 
A 1 19  ALA 19  50  50  ALA ALA A . n 
A 1 20  ASP 20  51  51  ASP ASP A . n 
A 1 21  GLY 21  52  52  GLY GLY A . n 
A 1 22  VAL 22  53  53  VAL VAL A . n 
A 1 23  TRP 23  54  54  TRP TRP A . n 
A 1 24  SER 24  55  55  SER SER A . n 
A 1 25  HIS 25  56  56  HIS HIS A . n 
A 1 26  ILE 26  57  57  ILE ILE A . n 
A 1 27  ALA 27  58  58  ALA ALA A . n 
A 1 28  THR 28  59  59  THR THR A . n 
A 1 29  GLN 29  60  60  GLN GLN A . n 
A 1 30  SER 30  61  61  SER SER A . n 
A 1 31  PHE 31  62  62  PHE PHE A . n 
A 1 32  ASP 32  63  63  ASP ASP A . n 
A 1 33  GLY 33  64  64  GLY GLY A . n 
A 1 34  ALA 34  65  65  ALA ALA A . n 
A 1 35  VAL 35  66  66  VAL VAL A . n 
A 1 36  TYR 36  67  67  TYR TYR A . n 
A 1 37  PRO 37  68  68  PRO PRO A . n 
A 1 38  SER 38  69  69  SER SER A . n 
A 1 39  ASN 39  70  70  ASN ASN A . n 
A 1 40  GLY 40  71  71  GLY GLY A . n 
A 1 41  LEU 41  72  72  LEU LEU A . n 
A 1 42  ILE 42  73  73  ILE ILE A . n 
A 1 43  VAL 43  74  74  VAL VAL A . n 
A 1 44  ARG 44  75  75  ARG ARG A . n 
A 1 45  ASP 45  76  76  ASP ASP A . n 
A 1 46  GLY 46  77  77  GLY GLY A . n 
A 1 47  ASP 47  78  78  ASP ASP A . n 
A 1 48  GLU 48  79  79  GLU GLU A . n 
A 1 49  LEU 49  80  80  LEU LEU A . n 
A 1 50  LEU 50  81  81  LEU LEU A . n 
A 1 51  LEU 51  82  82  LEU LEU A . n 
A 1 52  ILE 52  83  83  ILE ILE A . n 
A 1 53  ASP 53  84  84  ASP ASP A . n 
A 1 54  THR 54  85  85  THR THR A . n 
A 1 55  ALA 55  86  86  ALA ALA A . n 
A 1 56  TRP 56  87  87  TRP TRP A . n 
A 1 57  GLY 57  88  88  GLY GLY A . n 
A 1 58  ALA 58  89  89  ALA ALA A . n 
A 1 59  LYS 59  90  90  LYS LYS A . n 
A 1 60  ASN 60  91  91  ASN ASN A . n 
A 1 61  THR 61  92  92  THR THR A . n 
A 1 62  ALA 62  93  93  ALA ALA A . n 
A 1 63  ALA 63  94  94  ALA ALA A . n 
A 1 64  LEU 64  95  95  LEU LEU A . n 
A 1 65  LEU 65  96  96  LEU LEU A . n 
A 1 66  ALA 66  97  97  ALA ALA A . n 
A 1 67  GLU 67  98  98  GLU GLU A . n 
A 1 68  ILE 68  99  99  ILE ILE A . n 
A 1 69  GLU 69  100 100 GLU GLU A . n 
A 1 70  LYS 70  101 101 LYS LYS A . n 
A 1 71  GLN 71  102 102 GLN GLN A . n 
A 1 72  ILE 72  103 103 ILE ILE A . n 
A 1 73  GLY 73  104 104 GLY GLY A . n 
A 1 74  LEU 74  105 105 LEU LEU A . n 
A 1 75  PRO 75  106 106 PRO PRO A . n 
A 1 76  VAL 76  107 107 VAL VAL A . n 
A 1 77  THR 77  108 108 THR THR A . n 
A 1 78  ARG 78  109 109 ARG ARG A . n 
A 1 79  ALA 79  110 110 ALA ALA A . n 
A 1 80  VAL 80  111 111 VAL VAL A . n 
A 1 81  SER 81  112 112 SER SER A . n 
A 1 82  THR 82  113 113 THR THR A . n 
A 1 83  HIS 83  114 114 HIS HIS A . n 
A 1 84  PHE 84  115 115 PHE PHE A . n 
A 1 85  HIS 85  116 116 HIS HIS A . n 
A 1 86  ASP 86  117 117 ASP ASP A . n 
A 1 87  ASP 87  118 118 ASP ASP A . n 
A 1 88  ARG 88  119 119 ARG ARG A . n 
A 1 89  VAL 89  120 120 VAL VAL A . n 
A 1 90  GLY 90  121 121 GLY GLY A . n 
A 1 91  GLY 91  122 122 GLY GLY A . n 
A 1 92  VAL 92  123 123 VAL VAL A . n 
A 1 93  ASP 93  124 124 ASP ASP A . n 
A 1 94  VAL 94  125 125 VAL VAL A . n 
A 1 95  LEU 95  126 126 LEU LEU A . n 
A 1 96  ARG 96  127 127 ARG ARG A . n 
A 1 97  ALA 97  128 128 ALA ALA A . n 
A 1 98  ALA 98  129 129 ALA ALA A . n 
A 1 99  GLY 99  130 130 GLY GLY A . n 
A 1 100 VAL 100 131 131 VAL VAL A . n 
A 1 101 ALA 101 132 132 ALA ALA A . n 
A 1 102 THR 102 133 133 THR THR A . n 
A 1 103 TYR 103 134 134 TYR TYR A . n 
A 1 104 ALA 104 135 135 ALA ALA A . n 
A 1 105 SER 105 136 136 SER SER A . n 
A 1 106 PRO 106 137 137 PRO PRO A . n 
A 1 107 SER 107 138 138 SER SER A . n 
A 1 108 THR 108 139 139 THR THR A . n 
A 1 109 ARG 109 140 140 ARG ARG A . n 
A 1 110 ARG 110 141 141 ARG ARG A . n 
A 1 111 LEU 111 142 142 LEU LEU A . n 
A 1 112 ALA 112 143 143 ALA ALA A . n 
A 1 113 GLU 113 144 144 GLU GLU A . n 
A 1 114 VAL 114 145 145 VAL VAL A . n 
A 1 115 GLU 115 146 146 GLU GLU A . n 
A 1 116 GLY 116 147 147 GLY GLY A . n 
A 1 117 ASN 117 148 148 ASN ASN A . n 
A 1 118 GLU 118 149 149 GLU GLU A . n 
A 1 119 ILE 119 150 150 ILE ILE A . n 
A 1 120 PRO 120 151 151 PRO PRO A . n 
A 1 121 THR 121 152 152 THR THR A . n 
A 1 122 HIS 122 153 153 HIS HIS A . n 
A 1 123 SER 123 154 154 SER SER A . n 
A 1 124 LEU 124 155 155 LEU LEU A . n 
A 1 125 GLU 125 156 156 GLU GLU A . n 
A 1 126 GLY 126 157 157 GLY GLY A . n 
A 1 127 LEU 127 158 158 LEU LEU A . n 
A 1 128 SER 128 159 159 SER SER A . n 
A 1 129 SER 129 160 160 SER SER A . n 
A 1 130 SER 130 161 161 SER SER A . n 
A 1 131 GLY 131 162 162 GLY GLY A . n 
A 1 132 ASP 132 163 163 ASP ASP A . n 
A 1 133 ALA 133 164 164 ALA ALA A . n 
A 1 134 VAL 134 165 165 VAL VAL A . n 
A 1 135 ARG 135 166 166 ARG ARG A . n 
A 1 136 PHE 136 167 167 PHE PHE A . n 
A 1 137 GLY 137 168 168 GLY GLY A . n 
A 1 138 PRO 138 169 169 PRO PRO A . n 
A 1 139 VAL 139 170 170 VAL VAL A . n 
A 1 140 GLU 140 171 171 GLU GLU A . n 
A 1 141 LEU 141 172 172 LEU LEU A . n 
A 1 142 PHE 142 173 173 PHE PHE A . n 
A 1 143 TYR 143 174 174 TYR TYR A . n 
A 1 144 PRO 144 175 175 PRO PRO A . n 
A 1 145 GLY 145 176 176 GLY GLY A . n 
A 1 146 ALA 146 177 177 ALA ALA A . n 
A 1 147 ALA 147 178 178 ALA ALA A . n 
A 1 148 HIS 148 179 179 HIS HIS A . n 
A 1 149 SER 149 180 180 SER SER A . n 
A 1 150 THR 150 181 181 THR THR A . n 
A 1 151 ASP 151 182 182 ASP ASP A . n 
A 1 152 ASN 152 183 183 ASN ASN A . n 
A 1 153 LEU 153 184 184 LEU LEU A . n 
A 1 154 VAL 154 185 185 VAL VAL A . n 
A 1 155 VAL 155 186 186 VAL VAL A . n 
A 1 156 TYR 156 187 187 TYR TYR A . n 
A 1 157 VAL 157 188 188 VAL VAL A . n 
A 1 158 PRO 158 189 189 PRO PRO A . n 
A 1 159 SER 159 190 190 SER SER A . n 
A 1 160 ALA 160 191 191 ALA ALA A . n 
A 1 161 SER 161 192 192 SER SER A . n 
A 1 162 VAL 162 193 193 VAL VAL A . n 
A 1 163 LEU 163 194 194 LEU LEU A . n 
A 1 164 TYR 164 195 195 TYR TYR A . n 
A 1 165 GLY 165 196 196 GLY GLY A . n 
A 1 166 GLY 166 197 197 GLY GLY A . n 
A 1 167 CYS 167 198 198 CYS CYS A . n 
A 1 168 ALA 168 199 199 ALA ALA A . n 
A 1 169 ILE 169 200 200 ILE ILE A . n 
A 1 170 TYR 170 201 201 TYR TYR A . n 
A 1 171 GLU 171 202 202 GLU GLU A . n 
A 1 172 LEU 172 203 203 LEU LEU A . n 
A 1 173 SER 173 204 204 SER SER A . n 
A 1 174 ARG 174 205 205 ARG ARG A . n 
A 1 175 THR 175 206 206 THR THR A . n 
A 1 176 SER 176 207 207 SER SER A . n 
A 1 177 ALA 177 208 208 ALA ALA A . n 
A 1 178 GLY 178 209 209 GLY GLY A . n 
A 1 179 ASN 179 210 210 ASN ASN A . n 
A 1 180 VAL 180 211 211 VAL VAL A . n 
A 1 181 ALA 181 212 212 ALA ALA A . n 
A 1 182 ASP 182 213 213 ASP ASP A . n 
A 1 183 ALA 183 214 214 ALA ALA A . n 
A 1 184 ASP 184 215 215 ASP ASP A . n 
A 1 185 LEU 185 216 216 LEU LEU A . n 
A 1 186 ALA 186 217 217 ALA ALA A . n 
A 1 187 GLU 187 218 218 GLU GLU A . n 
A 1 188 TRP 188 219 219 TRP TRP A . n 
A 1 189 PRO 189 220 220 PRO PRO A . n 
A 1 190 THR 190 221 221 THR THR A . n 
A 1 191 SER 191 222 222 SER SER A . n 
A 1 192 ILE 192 223 223 ILE ILE A . n 
A 1 193 GLU 193 224 224 GLU GLU A . n 
A 1 194 ARG 194 225 225 ARG ARG A . n 
A 1 195 ILE 195 226 226 ILE ILE A . n 
A 1 196 GLN 196 227 227 GLN GLN A . n 
A 1 197 GLN 197 228 228 GLN GLN A . n 
A 1 198 HIS 198 229 229 HIS HIS A . n 
A 1 199 TYR 199 230 230 TYR TYR A . n 
A 1 200 PRO 200 231 231 PRO PRO A . n 
A 1 201 GLU 201 232 232 GLU GLU A . n 
A 1 202 ALA 202 233 233 ALA ALA A . n 
A 1 203 GLN 203 234 234 GLN GLN A . n 
A 1 204 PHE 204 235 235 PHE PHE A . n 
A 1 205 VAL 205 236 236 VAL VAL A . n 
A 1 206 ILE 206 237 237 ILE ILE A . n 
A 1 207 PRO 207 238 238 PRO PRO A . n 
A 1 208 GLY 208 239 239 GLY GLY A . n 
A 1 209 HIS 209 240 240 HIS HIS A . n 
A 1 210 GLY 210 241 241 GLY GLY A . n 
A 1 211 LEU 211 242 242 LEU LEU A . n 
A 1 212 PRO 212 243 243 PRO PRO A . n 
A 1 213 GLY 213 244 244 GLY GLY A . n 
A 1 214 GLY 214 245 245 GLY GLY A . n 
A 1 215 LEU 215 246 246 LEU LEU A . n 
A 1 216 ASP 216 247 247 ASP ASP A . n 
A 1 217 LEU 217 248 248 LEU LEU A . n 
A 1 218 LEU 218 249 249 LEU LEU A . n 
A 1 219 LYS 219 250 250 LYS LYS A . n 
A 1 220 HIS 220 251 251 HIS HIS A . n 
A 1 221 THR 221 252 252 THR THR A . n 
A 1 222 THR 222 253 253 THR THR A . n 
A 1 223 ASN 223 254 254 ASN ASN A . n 
A 1 224 VAL 224 255 255 VAL VAL A . n 
A 1 225 VAL 225 256 256 VAL VAL A . n 
A 1 226 LYS 226 257 257 LYS LYS A . n 
A 1 227 ALA 227 258 258 ALA ALA A . n 
A 1 228 HIS 228 259 259 HIS HIS A . n 
A 1 229 THR 229 260 260 THR THR A . n 
A 1 230 ASN 230 261 261 ASN ASN A . n 
A 1 231 ARG 231 262 262 ARG ARG A . n 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              liguobo@scu.edu.cn 
_pdbx_contact_author.name_first         Guo-Bo 
_pdbx_contact_author.name_last          Li 
_pdbx_contact_author.name_mi            ? 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0002-4915-6677 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  301 301 ZN  ZN  A . 
C 2 ZN  1  302 302 ZN  ZN  A . 
D 3 IU7 1  303 401 IU7 112 A . 
E 4 HOH 1  401 14  HOH HOH A . 
E 4 HOH 2  402 1   HOH HOH A . 
E 4 HOH 3  403 29  HOH HOH A . 
E 4 HOH 4  404 46  HOH HOH A . 
E 4 HOH 5  405 35  HOH HOH A . 
E 4 HOH 6  406 10  HOH HOH A . 
E 4 HOH 7  407 26  HOH HOH A . 
E 4 HOH 8  408 30  HOH HOH A . 
E 4 HOH 9  409 19  HOH HOH A . 
E 4 HOH 10 410 12  HOH HOH A . 
E 4 HOH 11 411 4   HOH HOH A . 
E 4 HOH 12 412 15  HOH HOH A . 
E 4 HOH 13 413 37  HOH HOH A . 
E 4 HOH 14 414 25  HOH HOH A . 
E 4 HOH 15 415 3   HOH HOH A . 
E 4 HOH 16 416 38  HOH HOH A . 
E 4 HOH 17 417 6   HOH HOH A . 
E 4 HOH 18 418 13  HOH HOH A . 
E 4 HOH 19 419 21  HOH HOH A . 
E 4 HOH 20 420 5   HOH HOH A . 
E 4 HOH 21 421 18  HOH HOH A . 
E 4 HOH 22 422 32  HOH HOH A . 
E 4 HOH 23 423 24  HOH HOH A . 
E 4 HOH 24 424 7   HOH HOH A . 
E 4 HOH 25 425 33  HOH HOH A . 
E 4 HOH 26 426 34  HOH HOH A . 
E 4 HOH 27 427 22  HOH HOH A . 
E 4 HOH 28 428 8   HOH HOH A . 
E 4 HOH 29 429 20  HOH HOH A . 
E 4 HOH 30 430 44  HOH HOH A . 
E 4 HOH 31 431 42  HOH HOH A . 
E 4 HOH 32 432 47  HOH HOH A . 
E 4 HOH 33 433 27  HOH HOH A . 
E 4 HOH 34 434 9   HOH HOH A . 
E 4 HOH 35 435 28  HOH HOH A . 
E 4 HOH 36 436 45  HOH HOH A . 
E 4 HOH 37 437 11  HOH HOH A . 
E 4 HOH 38 438 40  HOH HOH A . 
E 4 HOH 39 439 16  HOH HOH A . 
E 4 HOH 40 440 31  HOH HOH A . 
E 4 HOH 41 441 23  HOH HOH A . 
E 4 HOH 42 442 41  HOH HOH A . 
E 4 HOH 43 443 43  HOH HOH A . 
E 4 HOH 44 444 36  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 83  ? A HIS 114 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 ND1 ? A HIS 85  ? A HIS 116 ? 1_555 89.3  ? 
2  NE2 ? A HIS 83  ? A HIS 114 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 98.8  ? 
3  ND1 ? A HIS 85  ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 102.0 ? 
4  NE2 ? A HIS 83  ? A HIS 114 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O03 ? D IU7 .   ? A IU7 303 ? 1_555 127.5 ? 
5  ND1 ? A HIS 85  ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O03 ? D IU7 .   ? A IU7 303 ? 1_555 120.1 ? 
6  NE2 ? A HIS 148 ? A HIS 179 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O03 ? D IU7 .   ? A IU7 303 ? 1_555 113.9 ? 
7  OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG  ? A CYS 167 ? A CYS 198 ? 1_555 99.1  ? 
8  OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 94.1  ? 
9  SG  ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 103.1 ? 
10 OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O03 ? D IU7 .   ? A IU7 303 ? 1_555 85.6  ? 
11 SG  ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O03 ? D IU7 .   ? A IU7 303 ? 1_555 114.8 ? 
12 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O03 ? D IU7 .   ? A IU7 303 ? 1_555 141.6 ? 
13 OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O08 ? D IU7 .   ? A IU7 303 ? 1_555 162.0 ? 
14 SG  ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O08 ? D IU7 .   ? A IU7 303 ? 1_555 98.7  ? 
15 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O08 ? D IU7 .   ? A IU7 303 ? 1_555 79.3  ? 
16 O03 ? D IU7 .   ? A IU7 303 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O08 ? D IU7 .   ? A IU7 303 ? 1_555 89.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2023-06-07 
2 'Structure model' 1 1 2023-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' pdbx_initial_refinement_model 
# 
_pdbx_phasing_MR.entry_id                     7YHD 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          5.780 
_pdbx_phasing_MR.d_res_low_rotation           19.390 
_pdbx_phasing_MR.d_res_high_translation       5.780 
_pdbx_phasing_MR.d_res_low_translation        19.390 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .      1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.6.0  2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.10.1 3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27   4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .      5 
# 
_pdbx_entry_details.entry_id                 7YHD 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 402 ? ? O A HOH 432 ? ? 1.36 
2 1 O   A HOH 404 ? ? O A HOH 436 ? ? 1.53 
3 1 O   A ARG 262 ? ? O A HOH 401 ? ? 1.89 
4 1 NE2 A HIS 153 ? ? O A HOH 402 ? ? 1.89 
5 1 O   A TYR 33  ? ? O A HOH 403 ? ? 2.04 
6 1 OE1 A GLU 202 ? ? O A HOH 405 ? ? 2.15 
7 1 ND1 A HIS 251 ? ? O A HOH 404 ? ? 2.15 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 402 ? ? 1_555 O  A HOH 404 ? ? 6_555 1.35 
2 1 OD1 A ASP 63  ? ? 1_555 OG A SER 207 ? ? 3_555 2.00 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 37  ? ? -67.40  1.07    
2  1 PRO A 40  ? ? -43.12  170.52  
3  1 ALA A 50  ? ? 173.95  172.54  
4  1 ASP A 84  ? ? 73.55   156.13  
5  1 TRP A 87  ? ? 68.28   75.18   
6  1 ILE A 99  ? ? -21.25  -63.73  
7  1 HIS A 114 ? ? -172.92 -178.57 
8  1 ALA A 129 ? ? -68.51  7.32    
9  1 ALA A 135 ? ? -173.92 141.67  
10 1 SER A 136 ? ? -49.04  150.69  
11 1 LEU A 155 ? ? -102.42 70.64   
12 1 GLU A 156 ? ? -49.21  158.10  
13 1 LEU A 158 ? ? -143.73 34.82   
14 1 SER A 161 ? ? -42.12  150.22  
15 1 ALA A 178 ? ? -158.86 -109.48 
16 1 ALA A 208 ? ? -34.16  -70.58  
17 1 ASN A 210 ? ? -7.44   97.30   
18 1 SER A 222 ? ? -34.78  -34.53  
19 1 TYR A 230 ? ? -142.53 52.78   
20 1 ASN A 261 ? ? -82.69  37.48   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 32  ? CG  ? A GLU 1   CG  
2  1 Y 1 A GLU 32  ? CD  ? A GLU 1   CD  
3  1 Y 1 A GLU 32  ? OE1 ? A GLU 1   OE1 
4  1 Y 1 A GLU 32  ? OE2 ? A GLU 1   OE2 
5  1 Y 1 A ARG 262 ? CG  ? A ARG 231 CG  
6  1 Y 1 A ARG 262 ? CD  ? A ARG 231 CD  
7  1 Y 1 A ARG 262 ? NE  ? A ARG 231 NE  
8  1 Y 1 A ARG 262 ? CZ  ? A ARG 231 CZ  
9  1 Y 1 A ARG 262 ? NH1 ? A ARG 231 NH1 
10 1 Y 1 A ARG 262 ? NH2 ? A ARG 231 NH2 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
HOH O    O  N N 158 
HOH H1   H  N N 159 
HOH H2   H  N N 160 
ILE N    N  N N 161 
ILE CA   C  N S 162 
ILE C    C  N N 163 
ILE O    O  N N 164 
ILE CB   C  N S 165 
ILE CG1  C  N N 166 
ILE CG2  C  N N 167 
ILE CD1  C  N N 168 
ILE OXT  O  N N 169 
ILE H    H  N N 170 
ILE H2   H  N N 171 
ILE HA   H  N N 172 
ILE HB   H  N N 173 
ILE HG12 H  N N 174 
ILE HG13 H  N N 175 
ILE HG21 H  N N 176 
ILE HG22 H  N N 177 
ILE HG23 H  N N 178 
ILE HD11 H  N N 179 
ILE HD12 H  N N 180 
ILE HD13 H  N N 181 
ILE HXT  H  N N 182 
IU7 O01  O  N N 183 
IU7 C02  C  N N 184 
IU7 O03  O  N N 185 
IU7 C04  C  Y N 186 
IU7 C05  C  Y N 187 
IU7 C06  C  N N 188 
IU7 O07  O  N N 189 
IU7 O08  O  N N 190 
IU7 C09  C  Y N 191 
IU7 C10  C  Y N 192 
IU7 C11  C  Y N 193 
IU7 C12  C  Y N 194 
IU7 N13  N  Y N 195 
IU7 N14  N  Y N 196 
IU7 N15  N  Y N 197 
IU7 C16  C  Y N 198 
IU7 C17  C  Y N 199 
IU7 C18  C  Y N 200 
IU7 C19  C  Y N 201 
IU7 C20  C  Y N 202 
IU7 O21  O  N N 203 
IU7 C22  C  N N 204 
IU7 C23  C  N N 205 
IU7 N24  N  N N 206 
IU7 C25  C  Y N 207 
IU7 C26  C  Y N 208 
IU7 C27  C  Y N 209 
IU7 H1   H  N N 210 
IU7 H2   H  N N 211 
IU7 H3   H  N N 212 
IU7 H4   H  N N 213 
IU7 H5   H  N N 214 
IU7 H6   H  N N 215 
IU7 H7   H  N N 216 
IU7 H8   H  N N 217 
IU7 H9   H  N N 218 
IU7 H10  H  N N 219 
IU7 H11  H  N N 220 
IU7 H12  H  N N 221 
IU7 H13  H  N N 222 
IU7 H15  H  N N 223 
IU7 H16  H  N N 224 
IU7 H17  H  N N 225 
LEU N    N  N N 226 
LEU CA   C  N S 227 
LEU C    C  N N 228 
LEU O    O  N N 229 
LEU CB   C  N N 230 
LEU CG   C  N N 231 
LEU CD1  C  N N 232 
LEU CD2  C  N N 233 
LEU OXT  O  N N 234 
LEU H    H  N N 235 
LEU H2   H  N N 236 
LEU HA   H  N N 237 
LEU HB2  H  N N 238 
LEU HB3  H  N N 239 
LEU HG   H  N N 240 
LEU HD11 H  N N 241 
LEU HD12 H  N N 242 
LEU HD13 H  N N 243 
LEU HD21 H  N N 244 
LEU HD22 H  N N 245 
LEU HD23 H  N N 246 
LEU HXT  H  N N 247 
LYS N    N  N N 248 
LYS CA   C  N S 249 
LYS C    C  N N 250 
LYS O    O  N N 251 
LYS CB   C  N N 252 
LYS CG   C  N N 253 
LYS CD   C  N N 254 
LYS CE   C  N N 255 
LYS NZ   N  N N 256 
LYS OXT  O  N N 257 
LYS H    H  N N 258 
LYS H2   H  N N 259 
LYS HA   H  N N 260 
LYS HB2  H  N N 261 
LYS HB3  H  N N 262 
LYS HG2  H  N N 263 
LYS HG3  H  N N 264 
LYS HD2  H  N N 265 
LYS HD3  H  N N 266 
LYS HE2  H  N N 267 
LYS HE3  H  N N 268 
LYS HZ1  H  N N 269 
LYS HZ2  H  N N 270 
LYS HZ3  H  N N 271 
LYS HXT  H  N N 272 
PHE N    N  N N 273 
PHE CA   C  N S 274 
PHE C    C  N N 275 
PHE O    O  N N 276 
PHE CB   C  N N 277 
PHE CG   C  Y N 278 
PHE CD1  C  Y N 279 
PHE CD2  C  Y N 280 
PHE CE1  C  Y N 281 
PHE CE2  C  Y N 282 
PHE CZ   C  Y N 283 
PHE OXT  O  N N 284 
PHE H    H  N N 285 
PHE H2   H  N N 286 
PHE HA   H  N N 287 
PHE HB2  H  N N 288 
PHE HB3  H  N N 289 
PHE HD1  H  N N 290 
PHE HD2  H  N N 291 
PHE HE1  H  N N 292 
PHE HE2  H  N N 293 
PHE HZ   H  N N 294 
PHE HXT  H  N N 295 
PRO N    N  N N 296 
PRO CA   C  N S 297 
PRO C    C  N N 298 
PRO O    O  N N 299 
PRO CB   C  N N 300 
PRO CG   C  N N 301 
PRO CD   C  N N 302 
PRO OXT  O  N N 303 
PRO H    H  N N 304 
PRO HA   H  N N 305 
PRO HB2  H  N N 306 
PRO HB3  H  N N 307 
PRO HG2  H  N N 308 
PRO HG3  H  N N 309 
PRO HD2  H  N N 310 
PRO HD3  H  N N 311 
PRO HXT  H  N N 312 
SER N    N  N N 313 
SER CA   C  N S 314 
SER C    C  N N 315 
SER O    O  N N 316 
SER CB   C  N N 317 
SER OG   O  N N 318 
SER OXT  O  N N 319 
SER H    H  N N 320 
SER H2   H  N N 321 
SER HA   H  N N 322 
SER HB2  H  N N 323 
SER HB3  H  N N 324 
SER HG   H  N N 325 
SER HXT  H  N N 326 
THR N    N  N N 327 
THR CA   C  N S 328 
THR C    C  N N 329 
THR O    O  N N 330 
THR CB   C  N R 331 
THR OG1  O  N N 332 
THR CG2  C  N N 333 
THR OXT  O  N N 334 
THR H    H  N N 335 
THR H2   H  N N 336 
THR HA   H  N N 337 
THR HB   H  N N 338 
THR HG1  H  N N 339 
THR HG21 H  N N 340 
THR HG22 H  N N 341 
THR HG23 H  N N 342 
THR HXT  H  N N 343 
TRP N    N  N N 344 
TRP CA   C  N S 345 
TRP C    C  N N 346 
TRP O    O  N N 347 
TRP CB   C  N N 348 
TRP CG   C  Y N 349 
TRP CD1  C  Y N 350 
TRP CD2  C  Y N 351 
TRP NE1  N  Y N 352 
TRP CE2  C  Y N 353 
TRP CE3  C  Y N 354 
TRP CZ2  C  Y N 355 
TRP CZ3  C  Y N 356 
TRP CH2  C  Y N 357 
TRP OXT  O  N N 358 
TRP H    H  N N 359 
TRP H2   H  N N 360 
TRP HA   H  N N 361 
TRP HB2  H  N N 362 
TRP HB3  H  N N 363 
TRP HD1  H  N N 364 
TRP HE1  H  N N 365 
TRP HE3  H  N N 366 
TRP HZ2  H  N N 367 
TRP HZ3  H  N N 368 
TRP HH2  H  N N 369 
TRP HXT  H  N N 370 
TYR N    N  N N 371 
TYR CA   C  N S 372 
TYR C    C  N N 373 
TYR O    O  N N 374 
TYR CB   C  N N 375 
TYR CG   C  Y N 376 
TYR CD1  C  Y N 377 
TYR CD2  C  Y N 378 
TYR CE1  C  Y N 379 
TYR CE2  C  Y N 380 
TYR CZ   C  Y N 381 
TYR OH   O  N N 382 
TYR OXT  O  N N 383 
TYR H    H  N N 384 
TYR H2   H  N N 385 
TYR HA   H  N N 386 
TYR HB2  H  N N 387 
TYR HB3  H  N N 388 
TYR HD1  H  N N 389 
TYR HD2  H  N N 390 
TYR HE1  H  N N 391 
TYR HE2  H  N N 392 
TYR HH   H  N N 393 
TYR HXT  H  N N 394 
VAL N    N  N N 395 
VAL CA   C  N S 396 
VAL C    C  N N 397 
VAL O    O  N N 398 
VAL CB   C  N N 399 
VAL CG1  C  N N 400 
VAL CG2  C  N N 401 
VAL OXT  O  N N 402 
VAL H    H  N N 403 
VAL H2   H  N N 404 
VAL HA   H  N N 405 
VAL HB   H  N N 406 
VAL HG11 H  N N 407 
VAL HG12 H  N N 408 
VAL HG13 H  N N 409 
VAL HG21 H  N N 410 
VAL HG22 H  N N 411 
VAL HG23 H  N N 412 
VAL HXT  H  N N 413 
ZN  ZN   ZN N N 414 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
IU7 O07 C06  doub N N 173 
IU7 C09 C10  doub Y N 174 
IU7 C09 C05  sing Y N 175 
IU7 C06 O08  sing N N 176 
IU7 C06 C05  sing N N 177 
IU7 C10 C11  sing Y N 178 
IU7 C05 C04  doub Y N 179 
IU7 C11 C12  doub Y N 180 
IU7 C04 C12  sing Y N 181 
IU7 C04 C02  sing N N 182 
IU7 C12 N13  sing N N 183 
IU7 O01 C02  doub N N 184 
IU7 C02 O03  sing N N 185 
IU7 N13 C27  sing Y N 186 
IU7 N13 N14  sing Y N 187 
IU7 C27 C16  doub Y N 188 
IU7 N14 N15  doub Y N 189 
IU7 C16 N15  sing Y N 190 
IU7 C16 C17  sing N N 191 
IU7 C17 C26  doub Y N 192 
IU7 C17 C18  sing Y N 193 
IU7 C26 C25  sing Y N 194 
IU7 C18 C19  doub Y N 195 
IU7 C25 C20  doub Y N 196 
IU7 C19 C20  sing Y N 197 
IU7 C20 O21  sing N N 198 
IU7 C22 O21  sing N N 199 
IU7 C22 C23  sing N N 200 
IU7 C23 N24  sing N N 201 
IU7 O03 H1   sing N N 202 
IU7 O08 H2   sing N N 203 
IU7 C09 H3   sing N N 204 
IU7 C10 H4   sing N N 205 
IU7 C11 H5   sing N N 206 
IU7 C18 H6   sing N N 207 
IU7 C19 H7   sing N N 208 
IU7 C22 H8   sing N N 209 
IU7 C22 H9   sing N N 210 
IU7 C23 H10  sing N N 211 
IU7 C23 H11  sing N N 212 
IU7 N24 H12  sing N N 213 
IU7 N24 H13  sing N N 214 
IU7 C25 H15  sing N N 215 
IU7 C26 H16  sing N N 216 
IU7 C27 H17  sing N N 217 
LEU N   CA   sing N N 218 
LEU N   H    sing N N 219 
LEU N   H2   sing N N 220 
LEU CA  C    sing N N 221 
LEU CA  CB   sing N N 222 
LEU CA  HA   sing N N 223 
LEU C   O    doub N N 224 
LEU C   OXT  sing N N 225 
LEU CB  CG   sing N N 226 
LEU CB  HB2  sing N N 227 
LEU CB  HB3  sing N N 228 
LEU CG  CD1  sing N N 229 
LEU CG  CD2  sing N N 230 
LEU CG  HG   sing N N 231 
LEU CD1 HD11 sing N N 232 
LEU CD1 HD12 sing N N 233 
LEU CD1 HD13 sing N N 234 
LEU CD2 HD21 sing N N 235 
LEU CD2 HD22 sing N N 236 
LEU CD2 HD23 sing N N 237 
LEU OXT HXT  sing N N 238 
LYS N   CA   sing N N 239 
LYS N   H    sing N N 240 
LYS N   H2   sing N N 241 
LYS CA  C    sing N N 242 
LYS CA  CB   sing N N 243 
LYS CA  HA   sing N N 244 
LYS C   O    doub N N 245 
LYS C   OXT  sing N N 246 
LYS CB  CG   sing N N 247 
LYS CB  HB2  sing N N 248 
LYS CB  HB3  sing N N 249 
LYS CG  CD   sing N N 250 
LYS CG  HG2  sing N N 251 
LYS CG  HG3  sing N N 252 
LYS CD  CE   sing N N 253 
LYS CD  HD2  sing N N 254 
LYS CD  HD3  sing N N 255 
LYS CE  NZ   sing N N 256 
LYS CE  HE2  sing N N 257 
LYS CE  HE3  sing N N 258 
LYS NZ  HZ1  sing N N 259 
LYS NZ  HZ2  sing N N 260 
LYS NZ  HZ3  sing N N 261 
LYS OXT HXT  sing N N 262 
PHE N   CA   sing N N 263 
PHE N   H    sing N N 264 
PHE N   H2   sing N N 265 
PHE CA  C    sing N N 266 
PHE CA  CB   sing N N 267 
PHE CA  HA   sing N N 268 
PHE C   O    doub N N 269 
PHE C   OXT  sing N N 270 
PHE CB  CG   sing N N 271 
PHE CB  HB2  sing N N 272 
PHE CB  HB3  sing N N 273 
PHE CG  CD1  doub Y N 274 
PHE CG  CD2  sing Y N 275 
PHE CD1 CE1  sing Y N 276 
PHE CD1 HD1  sing N N 277 
PHE CD2 CE2  doub Y N 278 
PHE CD2 HD2  sing N N 279 
PHE CE1 CZ   doub Y N 280 
PHE CE1 HE1  sing N N 281 
PHE CE2 CZ   sing Y N 282 
PHE CE2 HE2  sing N N 283 
PHE CZ  HZ   sing N N 284 
PHE OXT HXT  sing N N 285 
PRO N   CA   sing N N 286 
PRO N   CD   sing N N 287 
PRO N   H    sing N N 288 
PRO CA  C    sing N N 289 
PRO CA  CB   sing N N 290 
PRO CA  HA   sing N N 291 
PRO C   O    doub N N 292 
PRO C   OXT  sing N N 293 
PRO CB  CG   sing N N 294 
PRO CB  HB2  sing N N 295 
PRO CB  HB3  sing N N 296 
PRO CG  CD   sing N N 297 
PRO CG  HG2  sing N N 298 
PRO CG  HG3  sing N N 299 
PRO CD  HD2  sing N N 300 
PRO CD  HD3  sing N N 301 
PRO OXT HXT  sing N N 302 
SER N   CA   sing N N 303 
SER N   H    sing N N 304 
SER N   H2   sing N N 305 
SER CA  C    sing N N 306 
SER CA  CB   sing N N 307 
SER CA  HA   sing N N 308 
SER C   O    doub N N 309 
SER C   OXT  sing N N 310 
SER CB  OG   sing N N 311 
SER CB  HB2  sing N N 312 
SER CB  HB3  sing N N 313 
SER OG  HG   sing N N 314 
SER OXT HXT  sing N N 315 
THR N   CA   sing N N 316 
THR N   H    sing N N 317 
THR N   H2   sing N N 318 
THR CA  C    sing N N 319 
THR CA  CB   sing N N 320 
THR CA  HA   sing N N 321 
THR C   O    doub N N 322 
THR C   OXT  sing N N 323 
THR CB  OG1  sing N N 324 
THR CB  CG2  sing N N 325 
THR CB  HB   sing N N 326 
THR OG1 HG1  sing N N 327 
THR CG2 HG21 sing N N 328 
THR CG2 HG22 sing N N 329 
THR CG2 HG23 sing N N 330 
THR OXT HXT  sing N N 331 
TRP N   CA   sing N N 332 
TRP N   H    sing N N 333 
TRP N   H2   sing N N 334 
TRP CA  C    sing N N 335 
TRP CA  CB   sing N N 336 
TRP CA  HA   sing N N 337 
TRP C   O    doub N N 338 
TRP C   OXT  sing N N 339 
TRP CB  CG   sing N N 340 
TRP CB  HB2  sing N N 341 
TRP CB  HB3  sing N N 342 
TRP CG  CD1  doub Y N 343 
TRP CG  CD2  sing Y N 344 
TRP CD1 NE1  sing Y N 345 
TRP CD1 HD1  sing N N 346 
TRP CD2 CE2  doub Y N 347 
TRP CD2 CE3  sing Y N 348 
TRP NE1 CE2  sing Y N 349 
TRP NE1 HE1  sing N N 350 
TRP CE2 CZ2  sing Y N 351 
TRP CE3 CZ3  doub Y N 352 
TRP CE3 HE3  sing N N 353 
TRP CZ2 CH2  doub Y N 354 
TRP CZ2 HZ2  sing N N 355 
TRP CZ3 CH2  sing Y N 356 
TRP CZ3 HZ3  sing N N 357 
TRP CH2 HH2  sing N N 358 
TRP OXT HXT  sing N N 359 
TYR N   CA   sing N N 360 
TYR N   H    sing N N 361 
TYR N   H2   sing N N 362 
TYR CA  C    sing N N 363 
TYR CA  CB   sing N N 364 
TYR CA  HA   sing N N 365 
TYR C   O    doub N N 366 
TYR C   OXT  sing N N 367 
TYR CB  CG   sing N N 368 
TYR CB  HB2  sing N N 369 
TYR CB  HB3  sing N N 370 
TYR CG  CD1  doub Y N 371 
TYR CG  CD2  sing Y N 372 
TYR CD1 CE1  sing Y N 373 
TYR CD1 HD1  sing N N 374 
TYR CD2 CE2  doub Y N 375 
TYR CD2 HD2  sing N N 376 
TYR CE1 CZ   doub Y N 377 
TYR CE1 HE1  sing N N 378 
TYR CE2 CZ   sing Y N 379 
TYR CE2 HE2  sing N N 380 
TYR CZ  OH   sing N N 381 
TYR OH  HH   sing N N 382 
TYR OXT HXT  sing N N 383 
VAL N   CA   sing N N 384 
VAL N   H    sing N N 385 
VAL N   H2   sing N N 386 
VAL CA  C    sing N N 387 
VAL CA  CB   sing N N 388 
VAL CA  HA   sing N N 389 
VAL C   O    doub N N 390 
VAL C   OXT  sing N N 391 
VAL CB  CG1  sing N N 392 
VAL CB  CG2  sing N N 393 
VAL CB  HB   sing N N 394 
VAL CG1 HG11 sing N N 395 
VAL CG1 HG12 sing N N 396 
VAL CG1 HG13 sing N N 397 
VAL CG2 HG21 sing N N 398 
VAL CG2 HG22 sing N N 399 
VAL CG2 HG23 sing N N 400 
VAL OXT HXT  sing N N 401 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Natural Science Foundation of China (NSFC)' China 82122065 1 
'National Natural Science Foundation of China (NSFC)' China 82073698 2 
'National Natural Science Foundation of China (NSFC)' China 81874291 3 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        IU7 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   IU7 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                                                         ZN  
3 '3-[4-[4-(2-azanylethoxy)phenyl]-1,2,3-triazol-1-yl]phthalic acid' IU7 
4 water                                                              HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   6JN6 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#