data_7YL8 # _entry.id 7YL8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YL8 pdb_00007yl8 10.2210/pdb7yl8/pdb WWPDB D_1300031158 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7YL8 _pdbx_database_status.recvd_initial_deposition_date 2022-07-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email masaki.unno.19@vc.ibaraki.ac.jp _pdbx_contact_author.name_first Masaki _pdbx_contact_author.name_last Unno _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4975-5696 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Unno, M.' 1 ? 'Wada, K.' 2 ? 'Kobayashi, K.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Protonation/deprotonation-driven switch for the redox stability of the low-potential [4Fe-4S] ferredoxin' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wada, K.' 1 ? primary 'Kobayashi, K.' 2 ? primary 'Era, I.' 3 ? primary 'Isobe, Y.' 4 ? primary 'Kamimura, T.' 5 ? primary 'Murakawa, M.' 6 ? primary 'Sugishima, M.' 7 ? primary 'Kusaka, K.' 8 ? primary 'Yano, N.' 9 ? primary 'Fukuyama, K.' 10 ? primary 'Mishima, M.' 11 ? primary 'Kitagawa, Y.' 12 ? primary 'Unno, M.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Ferredoxin 8773.595 1 ? ? ? ? 2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 3 water nat water 18.015 66 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPNKF E ; _entity_poly.pdbx_seq_one_letter_code_can ;PKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPNKF E ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IRON/SULFUR CLUSTER' SF4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 LYS n 1 3 TYR n 1 4 THR n 1 5 ILE n 1 6 VAL n 1 7 ASP n 1 8 LYS n 1 9 GLU n 1 10 THR n 1 11 CYS n 1 12 ILE n 1 13 ALA n 1 14 CYS n 1 15 GLY n 1 16 ALA n 1 17 CYS n 1 18 GLY n 1 19 ALA n 1 20 ALA n 1 21 ALA n 1 22 PRO n 1 23 ASP n 1 24 ILE n 1 25 TYR n 1 26 ASP n 1 27 TYR n 1 28 ASP n 1 29 GLU n 1 30 ASP n 1 31 GLY n 1 32 ILE n 1 33 ALA n 1 34 TYR n 1 35 VAL n 1 36 THR n 1 37 LEU n 1 38 ASP n 1 39 ASP n 1 40 ASN n 1 41 GLN n 1 42 GLY n 1 43 ILE n 1 44 VAL n 1 45 GLU n 1 46 VAL n 1 47 PRO n 1 48 ASP n 1 49 ILE n 1 50 LEU n 1 51 ILE n 1 52 ASP n 1 53 ASP n 1 54 MET n 1 55 MET n 1 56 ASP n 1 57 ALA n 1 58 PHE n 1 59 GLU n 1 60 GLY n 1 61 CYS n 1 62 PRO n 1 63 THR n 1 64 ASP n 1 65 SER n 1 66 ILE n 1 67 LYS n 1 68 VAL n 1 69 ALA n 1 70 ASP n 1 71 GLU n 1 72 PRO n 1 73 PHE n 1 74 ASP n 1 75 GLY n 1 76 ASP n 1 77 PRO n 1 78 ASN n 1 79 LYS n 1 80 PHE n 1 81 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 81 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus thermoproteolyticus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1427 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU ALA A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLU 81 81 81 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SF4 1 101 82 SF4 SF4 A . C 3 HOH 1 201 42 HOH HOH A . C 3 HOH 2 202 75 HOH HOH A . C 3 HOH 3 203 39 HOH HOH A . C 3 HOH 4 204 71 HOH HOH A . C 3 HOH 5 205 23 HOH HOH A . C 3 HOH 6 206 61 HOH HOH A . C 3 HOH 7 207 53 HOH HOH A . C 3 HOH 8 208 30 HOH HOH A . C 3 HOH 9 209 74 HOH HOH A . C 3 HOH 10 210 37 HOH HOH A . C 3 HOH 11 211 34 HOH HOH A . C 3 HOH 12 212 64 HOH HOH A . C 3 HOH 13 213 52 HOH HOH A . C 3 HOH 14 214 16 HOH HOH A . C 3 HOH 15 215 60 HOH HOH A . C 3 HOH 16 216 35 HOH HOH A . C 3 HOH 17 217 1 HOH HOH A . C 3 HOH 18 218 6 HOH HOH A . C 3 HOH 19 219 18 HOH HOH A . C 3 HOH 20 220 24 HOH HOH A . C 3 HOH 21 221 7 HOH HOH A . C 3 HOH 22 222 11 HOH HOH A . C 3 HOH 23 223 25 HOH HOH A . C 3 HOH 24 224 67 HOH HOH A . C 3 HOH 25 225 70 HOH HOH A . C 3 HOH 26 226 63 HOH HOH A . C 3 HOH 27 227 83 HOH HOH A . C 3 HOH 28 228 12 HOH HOH A . C 3 HOH 29 229 29 HOH HOH A . C 3 HOH 30 230 36 HOH HOH A . C 3 HOH 31 231 3 HOH HOH A . C 3 HOH 32 232 54 HOH HOH A . C 3 HOH 33 233 78 HOH HOH A . C 3 HOH 34 234 15 HOH HOH A . C 3 HOH 35 235 59 HOH HOH A . C 3 HOH 36 236 5 HOH HOH A . C 3 HOH 37 237 9 HOH HOH A . C 3 HOH 38 238 4 HOH HOH A . C 3 HOH 39 239 68 HOH HOH A . C 3 HOH 40 240 58 HOH HOH A . C 3 HOH 41 241 43 HOH HOH A . C 3 HOH 42 242 45 HOH HOH A . C 3 HOH 43 243 20 HOH HOH A . C 3 HOH 44 244 2 HOH HOH A . C 3 HOH 45 245 41 HOH HOH A . C 3 HOH 46 246 72 HOH HOH A . C 3 HOH 47 247 10 HOH HOH A . C 3 HOH 48 248 8 HOH HOH A . C 3 HOH 49 249 40 HOH HOH A . C 3 HOH 50 250 33 HOH HOH A . C 3 HOH 51 251 46 HOH HOH A . C 3 HOH 52 252 80 HOH HOH A . C 3 HOH 53 253 62 HOH HOH A . C 3 HOH 54 254 66 HOH HOH A . C 3 HOH 55 255 14 HOH HOH A . C 3 HOH 56 256 73 HOH HOH A . C 3 HOH 57 257 17 HOH HOH A . C 3 HOH 58 258 69 HOH HOH A . C 3 HOH 59 259 26 HOH HOH A . C 3 HOH 60 260 55 HOH HOH A . C 3 HOH 61 261 57 HOH HOH A . C 3 HOH 62 262 76 HOH HOH A . C 3 HOH 63 263 79 HOH HOH A . C 3 HOH 64 264 19 HOH HOH A . C 3 HOH 65 265 22 HOH HOH A . C 3 HOH 66 266 21 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 29 ? CG ? A GLU 29 CG 2 1 Y 1 A GLU 29 ? CD ? A GLU 29 CD 3 1 Y 1 A GLU 29 ? OE1 ? A GLU 29 OE1 4 1 Y 1 A GLU 29 ? OE2 ? A GLU 29 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 105.960 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7YL8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.430 _cell.length_a_esd ? _cell.length_b 37.910 _cell.length_b_esd ? _cell.length_c 33.010 _cell.length_c_esd ? _cell.volume 84739.415 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7YL8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 7YL8 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 7YL8 ? ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICRODIALYSIS _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MES, ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 297 ? ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 297 ? ? 1 ? ? ? 2 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency ? CCD 1 'ADSC QUANTUM 270' ? ? ? ? 2018-12-10 ? ? DIFFRACTOMETER 2 iBIX ? ? ? ? 2018-11-02 ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 L ? ? LAUE ? neutron # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.0 1.0 2 1.5 1.0 3 4.5 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'PHOTON FACTORY BEAMLINE AR-NW12A' ? ? 1.0 ? AR-NW12A 'Photon Factory' ? ? 2 ? ? 'SPALLATION SOURCE' ? 'J-PARC MLF BEAMLINE BL-03' ? ? 1.5-4.5 ? BL-03 'JPARC MLF' # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_CC_star _reflns.pdbx_R_split _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] _reflns.pdbx_aniso_diffraction_limit_1 _reflns.pdbx_aniso_diffraction_limit_2 _reflns.pdbx_aniso_diffraction_limit_3 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvalue_1 _reflns.pdbx_aniso_B_tensor_eigenvalue_2 _reflns.pdbx_aniso_B_tensor_eigenvalue_3 _reflns.pdbx_orthogonalization_convention _reflns.pdbx_percent_possible_ellipsoidal _reflns.pdbx_percent_possible_spherical _reflns.pdbx_percent_possible_ellipsoidal_anomalous _reflns.pdbx_percent_possible_spherical_anomalous _reflns.pdbx_redundancy_anomalous _reflns.pdbx_CC_half_anomalous _reflns.pdbx_absDiff_over_sigma_anomalous _reflns.pdbx_percent_possible_anomalous _reflns.pdbx_observed_signal_threshold _reflns.pdbx_signal_type _reflns.pdbx_signal_details _reflns.pdbx_signal_software_id _reflns.pdbx_CC_split_method 16.15 7YL8 ? ? 1.45 50 ? ? ? ? ? ? ? ? 15007 ? ? ? ? ? ? ? 100 ? ? ? ? ? ? 6.7 ? ? ? ? 25.2 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 0.999 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16.15 7YL8 ? ? 1.60 15.87 ? ? ? ? ? ? ? ? 84041 ? ? ? ? ? ? ? 99.6 ? ? ? ? ? ? 7.5617 0.1976 ? 0.0685 ? 5.15 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.45 1.48 ? ? ? ? ? ? 748 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 0.894 ? ? ? ? ? ? ? ? ? ? 1.60 1.66 ? ? ? ? ? ? 6888 ? ? ? ? ? 0.4602 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.1926 ? 2 2 ? ? ? ? ? ? ? ? ? ? ? # loop_ _refine.aniso_B[1][1] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][2] _refine.aniso_B[2][3] _refine.aniso_B[3][3] _refine.B_iso_max _refine.B_iso_mean _refine.B_iso_min _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.details _refine.diff_density_max _refine.diff_density_max_esd _refine.diff_density_min _refine.diff_density_min_esd _refine.diff_density_rms _refine.diff_density_rms_esd _refine.entry_id _refine.pdbx_refine_id _refine.ls_abs_structure_details _refine.ls_abs_structure_Flack _refine.ls_abs_structure_Flack_esd _refine.ls_abs_structure_Rogers _refine.ls_abs_structure_Rogers_esd _refine.ls_d_res_high _refine.ls_d_res_low _refine.ls_extinction_coef _refine.ls_extinction_coef_esd _refine.ls_extinction_expression _refine.ls_extinction_method _refine.ls_goodness_of_fit_all _refine.ls_goodness_of_fit_all_esd _refine.ls_goodness_of_fit_obs _refine.ls_goodness_of_fit_obs_esd _refine.ls_hydrogen_treatment _refine.ls_matrix_type _refine.ls_number_constraints _refine.ls_number_parameters _refine.ls_number_reflns_all _refine.ls_number_reflns_obs _refine.ls_number_reflns_R_free _refine.ls_number_reflns_R_work _refine.ls_number_restraints _refine.ls_percent_reflns_obs _refine.ls_percent_reflns_R_free _refine.ls_R_factor_all _refine.ls_R_factor_obs _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_R_factor_R_work _refine.ls_R_Fsqd_factor_obs _refine.ls_R_I_factor_obs _refine.ls_redundancy_reflns_all _refine.ls_redundancy_reflns_obs _refine.ls_restrained_S_all _refine.ls_restrained_S_obs _refine.ls_shift_over_esd_max _refine.ls_shift_over_esd_mean _refine.ls_structure_factor_coef _refine.ls_weighting_details _refine.ls_weighting_scheme _refine.ls_wR_factor_all _refine.ls_wR_factor_obs _refine.ls_wR_factor_R_free _refine.ls_wR_factor_R_work _refine.occupancy_max _refine.occupancy_min _refine.solvent_model_details _refine.solvent_model_param_bsol _refine.solvent_model_param_ksol _refine.pdbx_R_complete _refine.ls_R_factor_gt _refine.ls_goodness_of_fit_gt _refine.ls_goodness_of_fit_ref _refine.ls_shift_over_su_max _refine.ls_shift_over_su_max_lt _refine.ls_shift_over_su_mean _refine.ls_shift_over_su_mean_lt _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_ls_sigma_Fsqd _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_isotropic_thermal_model _refine.pdbx_ls_cross_valid_method _refine.pdbx_method_to_determine_struct _refine.pdbx_starting_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_R_Free_selection_details _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_real_space_R _refine.pdbx_density_correlation _refine.pdbx_pd_number_of_powder_patterns _refine.pdbx_pd_number_of_points _refine.pdbx_pd_meas_number_of_points _refine.pdbx_pd_proc_ls_prof_R_factor _refine.pdbx_pd_proc_ls_prof_wR_factor _refine.pdbx_pd_Marquardt_correlation_coeff _refine.pdbx_pd_Fsqrd_R_factor _refine.pdbx_pd_ls_matrix_band_width _refine.pdbx_overall_phase_error _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_diffrn_id _refine.overall_SU_B _refine.overall_SU_ML _refine.overall_SU_R_Cruickshank_DPI _refine.overall_SU_R_free _refine.overall_FOM_free_R_set _refine.overall_FOM_work_R_set _refine.pdbx_average_fsc_overall _refine.pdbx_average_fsc_work _refine.pdbx_average_fsc_free ? ? ? ? ? ? ? 25.52 ? ? ? ? ? ? ? ? ? ? 7YL8 'X-RAY DIFFRACTION' ? ? ? ? ? 1.45 33.08 ? ? ? ? ? ? ? ? ? ? ? ? ? 14861 771 14090 ? 98.87 5.19 ? 0.1399 0.1572 ? ? 0.1390 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FLAT BULK SOLVENT MODEL' ? ? ? ? ? ? ? ? ? ? ? 1.38 ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' 1IQZ 'GeoStd + Monomer Library + CDL v1.2' ? ? ? ? 1.1100 ? 0.9000 ? ? ? ? ? ? ? ? ? ? 15.5429 ? ? ? ? 1 ? 0.1464 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7YL8 'NEUTRON DIFFRACTION' ? ? ? ? ? 1.60 15.12 ? ? ? ? ? ? ? ? ? ? ? ? ? 10500 ? ? ? 94.13 ? ? ? 0.1842 ? ? 0.1624 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FLAT BULK SOLVENT MODEL' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' 1IQZ 'GeoStd + Monomer Library + CDL v1.2' ? ? ? ? 1.1100 ? 0.9000 ? ? ? ? ? ? ? ? ? ? 15.5429 ? ? ? ? 2 ? 0.1464 ? ? ? ? ? ? ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 608 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 682 _refine_hist.d_res_high 1.45 _refine_hist.d_res_low 33.08 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0107 ? 698 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0652 ? 972 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.1093 ? 108 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0081 ? 139 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.2996 ? 262 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.45 1.54 . . 130 2300 97.94 . . . 0.2344 . 0.1943 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.54 1.66 . . 131 2344 99.24 . . . 0.1796 . 0.1595 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.66 1.82 . . 128 2343 99.44 . . . 0.1522 . 0.1459 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.82 2.09 . . 121 2371 99.92 . . . 0.1582 . 0.1281 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.09 2.63 . . 132 2370 99.52 . . . 0.1487 . 0.1375 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.63 33.08 . . 129 2362 97.23 . . . 0.1507 . 0.1331 . . . . . . . . . . . # _struct.entry_id 7YL8 _struct.title 'Neutron structure of Bacillus thermoproteolyticus Ferredoxin at room temperature' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YL8 _struct_keywords.text 'ferredoxin, hydrogen, hydrogen-bonding, hydrogen-bonding network, redox potential, iron-sulfur cluster, electron transport' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FER_BACTH _struct_ref.pdbx_db_accession P10245 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPNKF E ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7YL8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10245 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 81 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 360 ? 1 MORE -21 ? 1 'SSA (A^2)' 4350 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 15 ? ALA A 21 ? GLY A 15 ALA A 21 1 ? 7 HELX_P HELX_P2 AA2 PRO A 47 ? ILE A 49 ? PRO A 47 ILE A 49 5 ? 3 HELX_P HELX_P3 AA3 LEU A 50 ? CYS A 61 ? LEU A 50 CYS A 61 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 11 SG ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 11 A SF4 101 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc2 metalc ? ? A CYS 14 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 14 A SF4 101 1_555 ? ? ? ? ? ? ? 2.264 ? ? metalc3 metalc ? ? A CYS 17 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 17 A SF4 101 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc4 metalc ? ? A CYS 61 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 61 A SF4 101 1_555 ? ? ? ? ? ? ? 2.298 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 11 ? A CYS 11 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S1 ? B SF4 . ? A SF4 101 ? 1_555 105.7 ? 2 SG ? A CYS 11 ? A CYS 11 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 120.8 ? 3 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 103.7 ? 4 SG ? A CYS 11 ? A CYS 11 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 116.1 ? 5 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 104.8 ? 6 S3 ? B SF4 . ? A SF4 101 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 104.0 ? 7 SG ? A CYS 14 ? A CYS 14 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S1 ? B SF4 . ? A SF4 101 ? 1_555 121.9 ? 8 SG ? A CYS 14 ? A CYS 14 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 101.6 ? 9 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 103.3 ? 10 SG ? A CYS 14 ? A CYS 14 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 120.1 ? 11 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 102.9 ? 12 S2 ? B SF4 . ? A SF4 101 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 104.6 ? 13 SG ? A CYS 17 ? A CYS 17 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S1 ? B SF4 . ? A SF4 101 ? 1_555 111.4 ? 14 SG ? A CYS 17 ? A CYS 17 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 112.7 ? 15 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 102.6 ? 16 SG ? A CYS 17 ? A CYS 17 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 120.8 ? 17 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 104.1 ? 18 S2 ? B SF4 . ? A SF4 101 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 103.3 ? 19 SG ? A CYS 61 ? A CYS 61 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 112.1 ? 20 SG ? A CYS 61 ? A CYS 61 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 110.1 ? 21 S2 ? B SF4 . ? A SF4 101 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 105.4 ? 22 SG ? A CYS 61 ? A CYS 61 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 120.4 ? 23 S2 ? B SF4 . ? A SF4 101 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 104.1 ? 24 S3 ? B SF4 . ? A SF4 101 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 103.5 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 3 ? VAL A 6 ? TYR A 3 VAL A 6 AA1 2 ILE A 66 ? ALA A 69 ? ILE A 66 ALA A 69 AA2 1 TYR A 25 ? TYR A 27 ? TYR A 25 TYR A 27 AA2 2 ALA A 33 ? VAL A 35 ? ALA A 33 VAL A 35 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 5 ? N ILE A 5 O LYS A 67 ? O LYS A 67 AA2 1 2 N ASP A 26 ? N ASP A 26 O TYR A 34 ? O TYR A 34 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 53 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 263 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 263 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_654 _pdbx_validate_symm_contact.dist 1.98 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 38 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -154.19 _pdbx_validate_torsion.psi 24.09 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 253 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # _pdbx_entry_details.entry_id 7YL8 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HOH O O N N 110 HOH H1 H N N 111 HOH H2 H N N 112 ILE N N N N 113 ILE CA C N S 114 ILE C C N N 115 ILE O O N N 116 ILE CB C N S 117 ILE CG1 C N N 118 ILE CG2 C N N 119 ILE CD1 C N N 120 ILE OXT O N N 121 ILE H H N N 122 ILE H2 H N N 123 ILE HA H N N 124 ILE HB H N N 125 ILE HG12 H N N 126 ILE HG13 H N N 127 ILE HG21 H N N 128 ILE HG22 H N N 129 ILE HG23 H N N 130 ILE HD11 H N N 131 ILE HD12 H N N 132 ILE HD13 H N N 133 ILE HXT H N N 134 LEU N N N N 135 LEU CA C N S 136 LEU C C N N 137 LEU O O N N 138 LEU CB C N N 139 LEU CG C N N 140 LEU CD1 C N N 141 LEU CD2 C N N 142 LEU OXT O N N 143 LEU H H N N 144 LEU H2 H N N 145 LEU HA H N N 146 LEU HB2 H N N 147 LEU HB3 H N N 148 LEU HG H N N 149 LEU HD11 H N N 150 LEU HD12 H N N 151 LEU HD13 H N N 152 LEU HD21 H N N 153 LEU HD22 H N N 154 LEU HD23 H N N 155 LEU HXT H N N 156 LYS N N N N 157 LYS CA C N S 158 LYS C C N N 159 LYS O O N N 160 LYS CB C N N 161 LYS CG C N N 162 LYS CD C N N 163 LYS CE C N N 164 LYS NZ N N N 165 LYS OXT O N N 166 LYS H H N N 167 LYS H2 H N N 168 LYS HA H N N 169 LYS HB2 H N N 170 LYS HB3 H N N 171 LYS HG2 H N N 172 LYS HG3 H N N 173 LYS HD2 H N N 174 LYS HD3 H N N 175 LYS HE2 H N N 176 LYS HE3 H N N 177 LYS HZ1 H N N 178 LYS HZ2 H N N 179 LYS HZ3 H N N 180 LYS HXT H N N 181 MET N N N N 182 MET CA C N S 183 MET C C N N 184 MET O O N N 185 MET CB C N N 186 MET CG C N N 187 MET SD S N N 188 MET CE C N N 189 MET OXT O N N 190 MET H H N N 191 MET H2 H N N 192 MET HA H N N 193 MET HB2 H N N 194 MET HB3 H N N 195 MET HG2 H N N 196 MET HG3 H N N 197 MET HE1 H N N 198 MET HE2 H N N 199 MET HE3 H N N 200 MET HXT H N N 201 PHE N N N N 202 PHE CA C N S 203 PHE C C N N 204 PHE O O N N 205 PHE CB C N N 206 PHE CG C Y N 207 PHE CD1 C Y N 208 PHE CD2 C Y N 209 PHE CE1 C Y N 210 PHE CE2 C Y N 211 PHE CZ C Y N 212 PHE OXT O N N 213 PHE H H N N 214 PHE H2 H N N 215 PHE HA H N N 216 PHE HB2 H N N 217 PHE HB3 H N N 218 PHE HD1 H N N 219 PHE HD2 H N N 220 PHE HE1 H N N 221 PHE HE2 H N N 222 PHE HZ H N N 223 PHE HXT H N N 224 PRO N N N N 225 PRO CA C N S 226 PRO C C N N 227 PRO O O N N 228 PRO CB C N N 229 PRO CG C N N 230 PRO CD C N N 231 PRO OXT O N N 232 PRO H H N N 233 PRO HA H N N 234 PRO HB2 H N N 235 PRO HB3 H N N 236 PRO HG2 H N N 237 PRO HG3 H N N 238 PRO HD2 H N N 239 PRO HD3 H N N 240 PRO HXT H N N 241 SER N N N N 242 SER CA C N S 243 SER C C N N 244 SER O O N N 245 SER CB C N N 246 SER OG O N N 247 SER OXT O N N 248 SER H H N N 249 SER H2 H N N 250 SER HA H N N 251 SER HB2 H N N 252 SER HB3 H N N 253 SER HG H N N 254 SER HXT H N N 255 SF4 FE1 FE N N 256 SF4 FE2 FE N N 257 SF4 FE3 FE N N 258 SF4 FE4 FE N N 259 SF4 S1 S N N 260 SF4 S2 S N N 261 SF4 S3 S N N 262 SF4 S4 S N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HOH O H1 sing N N 103 HOH O H2 sing N N 104 ILE N CA sing N N 105 ILE N H sing N N 106 ILE N H2 sing N N 107 ILE CA C sing N N 108 ILE CA CB sing N N 109 ILE CA HA sing N N 110 ILE C O doub N N 111 ILE C OXT sing N N 112 ILE CB CG1 sing N N 113 ILE CB CG2 sing N N 114 ILE CB HB sing N N 115 ILE CG1 CD1 sing N N 116 ILE CG1 HG12 sing N N 117 ILE CG1 HG13 sing N N 118 ILE CG2 HG21 sing N N 119 ILE CG2 HG22 sing N N 120 ILE CG2 HG23 sing N N 121 ILE CD1 HD11 sing N N 122 ILE CD1 HD12 sing N N 123 ILE CD1 HD13 sing N N 124 ILE OXT HXT sing N N 125 LEU N CA sing N N 126 LEU N H sing N N 127 LEU N H2 sing N N 128 LEU CA C sing N N 129 LEU CA CB sing N N 130 LEU CA HA sing N N 131 LEU C O doub N N 132 LEU C OXT sing N N 133 LEU CB CG sing N N 134 LEU CB HB2 sing N N 135 LEU CB HB3 sing N N 136 LEU CG CD1 sing N N 137 LEU CG CD2 sing N N 138 LEU CG HG sing N N 139 LEU CD1 HD11 sing N N 140 LEU CD1 HD12 sing N N 141 LEU CD1 HD13 sing N N 142 LEU CD2 HD21 sing N N 143 LEU CD2 HD22 sing N N 144 LEU CD2 HD23 sing N N 145 LEU OXT HXT sing N N 146 LYS N CA sing N N 147 LYS N H sing N N 148 LYS N H2 sing N N 149 LYS CA C sing N N 150 LYS CA CB sing N N 151 LYS CA HA sing N N 152 LYS C O doub N N 153 LYS C OXT sing N N 154 LYS CB CG sing N N 155 LYS CB HB2 sing N N 156 LYS CB HB3 sing N N 157 LYS CG CD sing N N 158 LYS CG HG2 sing N N 159 LYS CG HG3 sing N N 160 LYS CD CE sing N N 161 LYS CD HD2 sing N N 162 LYS CD HD3 sing N N 163 LYS CE NZ sing N N 164 LYS CE HE2 sing N N 165 LYS CE HE3 sing N N 166 LYS NZ HZ1 sing N N 167 LYS NZ HZ2 sing N N 168 LYS NZ HZ3 sing N N 169 LYS OXT HXT sing N N 170 MET N CA sing N N 171 MET N H sing N N 172 MET N H2 sing N N 173 MET CA C sing N N 174 MET CA CB sing N N 175 MET CA HA sing N N 176 MET C O doub N N 177 MET C OXT sing N N 178 MET CB CG sing N N 179 MET CB HB2 sing N N 180 MET CB HB3 sing N N 181 MET CG SD sing N N 182 MET CG HG2 sing N N 183 MET CG HG3 sing N N 184 MET SD CE sing N N 185 MET CE HE1 sing N N 186 MET CE HE2 sing N N 187 MET CE HE3 sing N N 188 MET OXT HXT sing N N 189 PHE N CA sing N N 190 PHE N H sing N N 191 PHE N H2 sing N N 192 PHE CA C sing N N 193 PHE CA CB sing N N 194 PHE CA HA sing N N 195 PHE C O doub N N 196 PHE C OXT sing N N 197 PHE CB CG sing N N 198 PHE CB HB2 sing N N 199 PHE CB HB3 sing N N 200 PHE CG CD1 doub Y N 201 PHE CG CD2 sing Y N 202 PHE CD1 CE1 sing Y N 203 PHE CD1 HD1 sing N N 204 PHE CD2 CE2 doub Y N 205 PHE CD2 HD2 sing N N 206 PHE CE1 CZ doub Y N 207 PHE CE1 HE1 sing N N 208 PHE CE2 CZ sing Y N 209 PHE CE2 HE2 sing N N 210 PHE CZ HZ sing N N 211 PHE OXT HXT sing N N 212 PRO N CA sing N N 213 PRO N CD sing N N 214 PRO N H sing N N 215 PRO CA C sing N N 216 PRO CA CB sing N N 217 PRO CA HA sing N N 218 PRO C O doub N N 219 PRO C OXT sing N N 220 PRO CB CG sing N N 221 PRO CB HB2 sing N N 222 PRO CB HB3 sing N N 223 PRO CG CD sing N N 224 PRO CG HG2 sing N N 225 PRO CG HG3 sing N N 226 PRO CD HD2 sing N N 227 PRO CD HD3 sing N N 228 PRO OXT HXT sing N N 229 SER N CA sing N N 230 SER N H sing N N 231 SER N H2 sing N N 232 SER CA C sing N N 233 SER CA CB sing N N 234 SER CA HA sing N N 235 SER C O doub N N 236 SER C OXT sing N N 237 SER CB OG sing N N 238 SER CB HB2 sing N N 239 SER CB HB3 sing N N 240 SER OG HG sing N N 241 SER OXT HXT sing N N 242 SF4 FE1 S2 sing N N 243 SF4 FE1 S3 sing N N 244 SF4 FE1 S4 sing N N 245 SF4 FE2 S1 sing N N 246 SF4 FE2 S3 sing N N 247 SF4 FE2 S4 sing N N 248 SF4 FE3 S1 sing N N 249 SF4 FE3 S2 sing N N 250 SF4 FE3 S4 sing N N 251 SF4 FE4 S1 sing N N 252 SF4 FE4 S2 sing N N 253 SF4 FE4 S3 sing N N 254 THR N CA sing N N 255 THR N H sing N N 256 THR N H2 sing N N 257 THR CA C sing N N 258 THR CA CB sing N N 259 THR CA HA sing N N 260 THR C O doub N N 261 THR C OXT sing N N 262 THR CB OG1 sing N N 263 THR CB CG2 sing N N 264 THR CB HB sing N N 265 THR OG1 HG1 sing N N 266 THR CG2 HG21 sing N N 267 THR CG2 HG22 sing N N 268 THR CG2 HG23 sing N N 269 THR OXT HXT sing N N 270 TYR N CA sing N N 271 TYR N H sing N N 272 TYR N H2 sing N N 273 TYR CA C sing N N 274 TYR CA CB sing N N 275 TYR CA HA sing N N 276 TYR C O doub N N 277 TYR C OXT sing N N 278 TYR CB CG sing N N 279 TYR CB HB2 sing N N 280 TYR CB HB3 sing N N 281 TYR CG CD1 doub Y N 282 TYR CG CD2 sing Y N 283 TYR CD1 CE1 sing Y N 284 TYR CD1 HD1 sing N N 285 TYR CD2 CE2 doub Y N 286 TYR CD2 HD2 sing N N 287 TYR CE1 CZ doub Y N 288 TYR CE1 HE1 sing N N 289 TYR CE2 CZ sing Y N 290 TYR CE2 HE2 sing N N 291 TYR CZ OH sing N N 292 TYR OH HH sing N N 293 TYR OXT HXT sing N N 294 VAL N CA sing N N 295 VAL N H sing N N 296 VAL N H2 sing N N 297 VAL CA C sing N N 298 VAL CA CB sing N N 299 VAL CA HA sing N N 300 VAL C O doub N N 301 VAL C OXT sing N N 302 VAL CB CG1 sing N N 303 VAL CB CG2 sing N N 304 VAL CB HB sing N N 305 VAL CG1 HG11 sing N N 306 VAL CG1 HG12 sing N N 307 VAL CG1 HG13 sing N N 308 VAL CG2 HG21 sing N N 309 VAL CG2 HG22 sing N N 310 VAL CG2 HG23 sing N N 311 VAL OXT HXT sing N N 312 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 24570122 1 'Japan Society for the Promotion of Science (JSPS)' Japan 20H03196 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SF4 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SF4 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 7YL8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014198 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004061 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026378 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031508 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? ? ? ? ? ? ? ? ? 6.64599990845 'Custom 0-Gaussian' ? D ? ? ? ? ? ? ? ? ? ? 6.67100000381 'Custom 0-Gaussian' ? FE ? ? ? ? ? ? ? ? ? ? 9.44999980927 'Custom 0-Gaussian' ? H ? ? ? ? ? ? ? ? ? ? -3.73900008202 'Custom 0-Gaussian' ? N ? ? ? ? ? ? ? ? ? ? 9.35999965668 'Custom 0-Gaussian' ? O ? ? ? ? ? ? ? ? ? ? 5.8029999733 'Custom 0-Gaussian' ? S ? ? ? ? ? ? ? ? ? ? 2.84699988365 'Custom 0-Gaussian' ? # loop_