data_7YOH # _entry.id 7YOH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YOH pdb_00007yoh 10.2210/pdb7yoh/pdb WWPDB D_1300030756 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7YOH _pdbx_database_status.recvd_initial_deposition_date 2022-08-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumar, N.' 1 0000-0002-5086-0928 'Rahisuddin, R.' 2 0000-0001-9157-6336 'Saini, N.' 3 0000-0002-8497-785X 'Singh, A.K.' 4 0000-0002-2685-4018 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of I88L single mutant of O-acetylserine sulfhydrylase from Haemophilus influenzae in complex with high-affinity inhibitory peptide from serine acetyltransferase of Salmonella typhimurium at 2.14 A ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, N.' 1 0000-0002-5086-0928 primary 'Rahisuddin, R.' 2 0000-0001-9157-6336 primary 'Saini, N.' 3 0000-0002-8497-785X primary 'Singh, A.K.' 4 0000-0002-2685-4018 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7YOH _cell.details ? _cell.formula_units_Z ? _cell.length_a 112.750 _cell.length_a_esd ? _cell.length_b 112.750 _cell.length_b_esd ? _cell.length_c 44.460 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7YOH _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine synthase' 33651.465 1 2.5.1.47 I88L ? ? 2 polymer syn 'Peptide from Serine acetyltransferase' 775.872 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 17 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'CSase,O-acetylserine (thiol)-lyase,OAS-TL,O-acetylserine sulfhydrylase,O-acetyl-L-serine sulfhydrylase' 2 SAT # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSV(LLP)CRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIA LAYVAAARGYKLTLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRET TGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPK NLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALFEGIEG ; ;MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYV AAARGYKLTLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPE IWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDL SIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALFEGIEG ; A ? 2 'polypeptide(L)' no no DGMNLNI DGMNLNI P ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ILE n 1 4 TYR n 1 5 ALA n 1 6 ASP n 1 7 ASN n 1 8 SER n 1 9 TYR n 1 10 SER n 1 11 ILE n 1 12 GLY n 1 13 ASN n 1 14 THR n 1 15 PRO n 1 16 LEU n 1 17 VAL n 1 18 ARG n 1 19 LEU n 1 20 LYS n 1 21 HIS n 1 22 PHE n 1 23 GLY n 1 24 HIS n 1 25 ASN n 1 26 GLY n 1 27 ASN n 1 28 VAL n 1 29 VAL n 1 30 VAL n 1 31 LYS n 1 32 ILE n 1 33 GLU n 1 34 GLY n 1 35 ARG n 1 36 ASN n 1 37 PRO n 1 38 SER n 1 39 TYR n 1 40 SER n 1 41 VAL n 1 42 LLP n 1 43 CYS n 1 44 ARG n 1 45 ILE n 1 46 GLY n 1 47 ALA n 1 48 ASN n 1 49 MET n 1 50 VAL n 1 51 TRP n 1 52 GLN n 1 53 ALA n 1 54 GLU n 1 55 LYS n 1 56 ASP n 1 57 GLY n 1 58 THR n 1 59 LEU n 1 60 THR n 1 61 LYS n 1 62 GLY n 1 63 LYS n 1 64 GLU n 1 65 ILE n 1 66 VAL n 1 67 ASP n 1 68 ALA n 1 69 THR n 1 70 SER n 1 71 GLY n 1 72 ASN n 1 73 THR n 1 74 GLY n 1 75 ILE n 1 76 ALA n 1 77 LEU n 1 78 ALA n 1 79 TYR n 1 80 VAL n 1 81 ALA n 1 82 ALA n 1 83 ALA n 1 84 ARG n 1 85 GLY n 1 86 TYR n 1 87 LYS n 1 88 LEU n 1 89 THR n 1 90 LEU n 1 91 THR n 1 92 MET n 1 93 PRO n 1 94 GLU n 1 95 THR n 1 96 MET n 1 97 SER n 1 98 LEU n 1 99 GLU n 1 100 ARG n 1 101 LYS n 1 102 ARG n 1 103 LEU n 1 104 LEU n 1 105 CYS n 1 106 GLY n 1 107 LEU n 1 108 GLY n 1 109 VAL n 1 110 ASN n 1 111 LEU n 1 112 VAL n 1 113 LEU n 1 114 THR n 1 115 GLU n 1 116 GLY n 1 117 ALA n 1 118 LYS n 1 119 GLY n 1 120 MET n 1 121 LYS n 1 122 GLY n 1 123 ALA n 1 124 ILE n 1 125 ALA n 1 126 LYS n 1 127 ALA n 1 128 GLU n 1 129 GLU n 1 130 ILE n 1 131 VAL n 1 132 ALA n 1 133 SER n 1 134 ASP n 1 135 PRO n 1 136 SER n 1 137 ARG n 1 138 TYR n 1 139 VAL n 1 140 MET n 1 141 LEU n 1 142 LYS n 1 143 GLN n 1 144 PHE n 1 145 GLU n 1 146 ASN n 1 147 PRO n 1 148 ALA n 1 149 ASN n 1 150 PRO n 1 151 GLN n 1 152 ILE n 1 153 HIS n 1 154 ARG n 1 155 GLU n 1 156 THR n 1 157 THR n 1 158 GLY n 1 159 PRO n 1 160 GLU n 1 161 ILE n 1 162 TRP n 1 163 LYS n 1 164 ASP n 1 165 THR n 1 166 ASP n 1 167 GLY n 1 168 LYS n 1 169 VAL n 1 170 ASP n 1 171 VAL n 1 172 VAL n 1 173 VAL n 1 174 ALA n 1 175 GLY n 1 176 VAL n 1 177 GLY n 1 178 THR n 1 179 GLY n 1 180 GLY n 1 181 SER n 1 182 ILE n 1 183 THR n 1 184 GLY n 1 185 ILE n 1 186 SER n 1 187 ARG n 1 188 ALA n 1 189 ILE n 1 190 LYS n 1 191 LEU n 1 192 ASP n 1 193 PHE n 1 194 GLY n 1 195 LYS n 1 196 GLN n 1 197 ILE n 1 198 THR n 1 199 SER n 1 200 VAL n 1 201 ALA n 1 202 VAL n 1 203 GLU n 1 204 PRO n 1 205 VAL n 1 206 GLU n 1 207 SER n 1 208 PRO n 1 209 VAL n 1 210 ILE n 1 211 SER n 1 212 GLN n 1 213 THR n 1 214 LEU n 1 215 ALA n 1 216 GLY n 1 217 GLU n 1 218 GLU n 1 219 VAL n 1 220 LYS n 1 221 PRO n 1 222 GLY n 1 223 PRO n 1 224 HIS n 1 225 LYS n 1 226 ILE n 1 227 GLN n 1 228 GLY n 1 229 ILE n 1 230 GLY n 1 231 ALA n 1 232 GLY n 1 233 PHE n 1 234 ILE n 1 235 PRO n 1 236 LYS n 1 237 ASN n 1 238 LEU n 1 239 ASP n 1 240 LEU n 1 241 SER n 1 242 ILE n 1 243 ILE n 1 244 ASP n 1 245 ARG n 1 246 VAL n 1 247 GLU n 1 248 THR n 1 249 VAL n 1 250 ASP n 1 251 SER n 1 252 ASP n 1 253 THR n 1 254 ALA n 1 255 LEU n 1 256 ALA n 1 257 THR n 1 258 ALA n 1 259 ARG n 1 260 ARG n 1 261 LEU n 1 262 MET n 1 263 ALA n 1 264 GLU n 1 265 GLU n 1 266 GLY n 1 267 ILE n 1 268 LEU n 1 269 ALA n 1 270 GLY n 1 271 ILE n 1 272 SER n 1 273 SER n 1 274 GLY n 1 275 ALA n 1 276 ALA n 1 277 VAL n 1 278 ALA n 1 279 ALA n 1 280 ALA n 1 281 ASP n 1 282 ARG n 1 283 LEU n 1 284 ALA n 1 285 LYS n 1 286 LEU n 1 287 PRO n 1 288 GLU n 1 289 PHE n 1 290 ALA n 1 291 ASP n 1 292 LYS n 1 293 LEU n 1 294 ILE n 1 295 VAL n 1 296 VAL n 1 297 ILE n 1 298 LEU n 1 299 PRO n 1 300 SER n 1 301 ALA n 1 302 SER n 1 303 GLU n 1 304 ARG n 1 305 TYR n 1 306 LEU n 1 307 SER n 1 308 THR n 1 309 ALA n 1 310 LEU n 1 311 PHE n 1 312 GLU n 1 313 GLY n 1 314 ILE n 1 315 GLU n 1 316 GLY n 2 1 ASP n 2 2 GLY n 2 3 MET n 2 4 ASN n 2 5 LEU n 2 6 ASN n 2 7 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 316 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cysK, HI_1103' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Haemophilus influenzae Rd KW20' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 71421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 7 _pdbx_entity_src_syn.organism_scientific 'Haemophilus influenzae Rd KW20' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 71421 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP CYSK_HAEIN P45040 ? 1 ;MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYV AAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPE IWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDL SIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALFEGIEG ; 1 2 UNP CYSE_HAEIN P43886 ? 2 DGMNLNI 261 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7YOH A 1 ? 316 ? P45040 1 ? 316 ? 1 316 2 2 7YOH P 1 ? 7 ? P43886 261 ? 267 ? 261 267 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7YOH _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 88 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P45040 _struct_ref_seq_dif.db_mon_id ILE _struct_ref_seq_dif.pdbx_seq_db_seq_num 88 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 88 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LLP 'L-peptide linking' n '(2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid' "N'-PYRIDOXYL-LYSINE-5'-MONOPHOSPHATE" 'C14 H22 N3 O7 P' 375.314 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7YOH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 278 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES, 1.3M Sodium citrate' _exptl_crystal_grow.pdbx_pH_range 7.3-7.9 # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-09-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Mirrors _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54179 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type RIGAKU _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54179 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 35.63 _reflns.entry_id 7YOH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 41.36 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9865 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.54 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 126.45 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.886 _reflns.pdbx_CC_star 0.969 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.581 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 970 _reflns_shell.percent_possible_all 99.69 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.7904 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.835 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -4.548 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -4.548 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 9.096 _refine.B_iso_max ? _refine.B_iso_mean 38.395 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.909 _refine.correlation_coeff_Fo_to_Fc_free 0.863 _refine.details 'Hydrogens have been used if present in the input file' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7YOH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 41.36 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9828 _refine.ls_number_reflns_R_free 515 _refine.ls_number_reflns_R_work 9313 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.585 _refine.ls_percent_reflns_R_free 5.240 _refine.ls_R_factor_all 0.246 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2949 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2435 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1Y7L _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.374 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.799 _refine.overall_SU_ML 0.368 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2286 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 2304 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 41.36 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.012 2318 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.546 1.631 3149 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 7.682 5.000 313 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.807 22.660 94 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.363 15.000 371 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.740 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.116 0.200 325 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1722 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.236 0.200 1074 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.304 0.200 1579 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 85 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.195 0.200 37 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.294 0.200 5 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 3.177 4.020 1258 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.043 6.014 1569 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.175 3.845 1060 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.799 5.731 1580 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.982 73.404 9816 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.500 2.565 . . 49 662 99.7195 . . . 0.329 . 0.318 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.565 2.635 . . 33 661 97.4719 . . . 0.365 . 0.285 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.635 2.711 . . 49 605 100.0000 . . . 0.384 . 0.266 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.711 2.795 . . 46 634 98.2659 . . . 0.328 . 0.250 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.795 2.886 . . 31 619 100.0000 . . . 0.330 . 0.210 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.886 2.987 . . 25 583 100.0000 . . . 0.225 . 0.206 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.987 3.100 . . 25 585 100.0000 . . . 0.276 . 0.209 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.100 3.226 . . 29 550 100.0000 . . . 0.232 . 0.216 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.226 3.370 . . 21 540 100.0000 . . . 0.357 . 0.236 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.370 3.534 . . 27 498 99.6205 . . . 0.321 . 0.266 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.534 3.725 . . 34 481 99.8062 . . . 0.305 . 0.295 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.725 3.950 . . 29 455 99.3840 . . . 0.345 . 0.275 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.950 4.222 . . 11 436 99.7768 . . . 0.256 . 0.245 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.222 4.559 . . 29 395 100.0000 . . . 0.255 . 0.209 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.559 4.993 . . 17 385 100.0000 . . . 0.253 . 0.197 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.993 5.579 . . 30 328 100.0000 . . . 0.346 . 0.222 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.579 6.437 . . 10 302 100.0000 . . . 0.364 . 0.244 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.437 7.871 . . 4 265 100.0000 . . . 0.431 . 0.241 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.871 11.077 . . 12 206 100.0000 . . . 0.115 . 0.158 . . . . . . . . . . . 'X-RAY DIFFRACTION' 11.077 41.36 . . 4 123 99.2188 . . . 0.139 . 0.173 . . . . . . . . . . . # _struct.entry_id 7YOH _struct.title ;Crystal structure of I88L single mutant of O-acetylserine sulfhydrylase from Haemophilus influenzae in complex with high-affinity inhibitory peptide from serine acetyltransferase of Haemophilus influenzae at 2.5 A ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YOH _struct_keywords.text ;I88L, single mutant, O-acetylserine sulfhydrylase, Haemophilus influenzae, high-affinity inhibitory peptide from serine acetyltransferase, TRANSFERASE-TRANSFERASE INHIBITOR complex ; _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 6 ? ILE A 11 ? ASP A 6 ILE A 11 5 ? 6 HELX_P HELX_P2 AA2 ASN A 36 ? VAL A 41 ? ASN A 36 VAL A 41 5 ? 6 HELX_P HELX_P3 AA3 LLP A 42 ? ASP A 56 ? LLP A 42 ASP A 56 1 ? 15 HELX_P HELX_P4 AA4 GLY A 71 ? GLY A 85 ? GLY A 71 GLY A 85 1 ? 15 HELX_P HELX_P5 AA5 SER A 97 ? LEU A 107 ? SER A 97 LEU A 107 1 ? 11 HELX_P HELX_P6 AA6 MET A 120 ? SER A 133 ? MET A 120 SER A 133 1 ? 14 HELX_P HELX_P7 AA7 PRO A 147 ? THR A 156 ? PRO A 147 THR A 156 1 ? 10 HELX_P HELX_P8 AA8 THR A 156 ? THR A 165 ? THR A 156 THR A 165 1 ? 10 HELX_P HELX_P9 AA9 GLY A 179 ? ASP A 192 ? GLY A 179 ASP A 192 1 ? 14 HELX_P HELX_P10 AB1 PRO A 208 ? ALA A 215 ? PRO A 208 ALA A 215 1 ? 8 HELX_P HELX_P11 AB2 ASP A 239 ? ILE A 243 ? ASP A 239 ILE A 243 5 ? 5 HELX_P HELX_P12 AB3 ASP A 250 ? GLY A 266 ? ASP A 250 GLY A 266 1 ? 17 HELX_P HELX_P13 AB4 GLY A 270 ? LYS A 285 ? GLY A 270 LYS A 285 1 ? 16 HELX_P HELX_P14 AB5 LEU A 286 ? ALA A 290 ? LEU A 286 ALA A 290 5 ? 5 HELX_P HELX_P15 AB6 GLY B 2 ? ASN B 6 ? GLY P 262 ASN P 266 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 41 C ? ? ? 1_555 A LLP 42 N ? ? A VAL 41 A LLP 42 1_555 ? ? ? ? ? ? ? 1.348 ? ? covale2 covale both ? A LLP 42 C ? ? ? 1_555 A CYS 43 N ? ? A LLP 42 A CYS 43 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 16 ? ARG A 18 ? LEU A 16 ARG A 18 AA1 2 VAL A 28 ? ILE A 32 ? VAL A 28 ILE A 32 AA1 3 ILE A 294 ? LEU A 298 ? ILE A 294 LEU A 298 AA1 4 VAL A 171 ? GLY A 175 ? VAL A 171 GLY A 175 AA1 5 THR A 198 ? PRO A 204 ? THR A 198 PRO A 204 AA1 6 ARG A 245 ? VAL A 249 ? ARG A 245 VAL A 249 AA2 1 ASN A 110 ? LEU A 113 ? ASN A 110 LEU A 113 AA2 2 LEU A 88 ? MET A 92 ? LEU A 88 MET A 92 AA2 3 GLU A 64 ? ASP A 67 ? GLU A 64 ASP A 67 AA2 4 TYR A 138 ? MET A 140 ? TYR A 138 MET A 140 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 17 ? N VAL A 17 O VAL A 30 ? O VAL A 30 AA1 2 3 N LYS A 31 ? N LYS A 31 O VAL A 296 ? O VAL A 296 AA1 3 4 O VAL A 295 ? O VAL A 295 N VAL A 173 ? N VAL A 173 AA1 4 5 N VAL A 172 ? N VAL A 172 O VAL A 200 ? O VAL A 200 AA1 5 6 N SER A 199 ? N SER A 199 O ARG A 245 ? O ARG A 245 AA2 1 2 O ASN A 110 ? O ASN A 110 N LEU A 88 ? N LEU A 88 AA2 2 3 O THR A 89 ? O THR A 89 N ILE A 65 ? N ILE A 65 AA2 3 4 N VAL A 66 ? N VAL A 66 O VAL A 139 ? O VAL A 139 # _atom_sites.entry_id 7YOH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008869 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008869 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022492 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 CL 17 17 11.460 0.010 7.196 1.166 6.255 18.519 1.645 47.778 -9.212 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 P 15 15 6.435 1.907 4.179 27.157 1.780 0.526 1.491 68.164 1.397 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.184 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LLP 42 42 42 LLP LLP A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 GLN 212 212 212 GLN GLN A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 HIS 224 224 224 HIS HIS A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 GLN 227 227 227 GLN GLN A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 ASN 237 237 237 ASN ASN A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 SER 241 241 241 SER SER A . n A 1 242 ILE 242 242 242 ILE ILE A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 THR 248 248 248 THR THR A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 THR 253 253 253 THR THR A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 ALA 258 258 258 ALA ALA A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 ARG 260 260 260 ARG ARG A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 MET 262 262 262 MET MET A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 GLY 266 266 266 GLY GLY A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 GLY 270 270 270 GLY GLY A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 GLY 274 274 274 GLY GLY A . n A 1 275 ALA 275 275 275 ALA ALA A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 LYS 285 285 285 LYS LYS A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 PRO 287 287 287 PRO PRO A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 PHE 289 289 289 PHE PHE A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 ASP 291 291 291 ASP ASP A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 ILE 294 294 294 ILE ILE A . n A 1 295 VAL 295 295 295 VAL VAL A . n A 1 296 VAL 296 296 296 VAL VAL A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 LEU 298 298 298 LEU LEU A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 SER 302 302 302 SER SER A . n A 1 303 GLU 303 303 303 GLU GLU A . n A 1 304 ARG 304 304 304 ARG ARG A . n A 1 305 TYR 305 305 305 TYR TYR A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 SER 307 307 307 SER SER A . n A 1 308 THR 308 308 308 THR THR A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 LEU 310 310 ? ? ? A . n A 1 311 PHE 311 311 ? ? ? A . n A 1 312 GLU 312 312 ? ? ? A . n A 1 313 GLY 313 313 ? ? ? A . n A 1 314 ILE 314 314 ? ? ? A . n A 1 315 GLU 315 315 ? ? ? A . n A 1 316 GLY 316 316 ? ? ? A . n B 2 1 ASP 1 261 261 ASP ASP P . n B 2 2 GLY 2 262 262 GLY GLY P . n B 2 3 MET 3 263 263 MET MET P . n B 2 4 ASN 4 264 264 ASN ASN P . n B 2 5 LEU 5 265 265 LEU LEU P . n B 2 6 ASN 6 266 266 ASN ASN P . n B 2 7 ILE 7 267 267 ILE ILE P . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email skumaran@imtech.res.in _pdbx_contact_author.name_first Sangharalingam _pdbx_contact_author.name_last Kumaran _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7972-1032 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CL 1 401 1 CL CL A . D 4 HOH 1 501 6 HOH HOH A . D 4 HOH 2 502 5 HOH HOH A . D 4 HOH 3 503 3 HOH HOH A . D 4 HOH 4 504 12 HOH HOH A . D 4 HOH 5 505 4 HOH HOH A . D 4 HOH 6 506 13 HOH HOH A . D 4 HOH 7 507 9 HOH HOH A . D 4 HOH 8 508 2 HOH HOH A . D 4 HOH 9 509 7 HOH HOH A . D 4 HOH 10 510 8 HOH HOH A . D 4 HOH 11 511 1 HOH HOH A . D 4 HOH 12 512 15 HOH HOH A . D 4 HOH 13 513 16 HOH HOH A . D 4 HOH 14 514 11 HOH HOH A . D 4 HOH 15 515 17 HOH HOH A . D 4 HOH 16 516 14 HOH HOH A . E 4 HOH 1 301 10 HOH HOH P . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id LLP _pdbx_struct_mod_residue.label_seq_id 42 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id LLP _pdbx_struct_mod_residue.auth_seq_id 42 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6180 ? 1 MORE -43 ? 1 'SSA (A^2)' 22770 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7YOH _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 38 ? ? 56.79 -24.37 2 1 TYR A 39 ? ? 84.38 24.83 3 1 LYS A 61 ? ? -50.85 106.70 4 1 MET A 92 ? ? 176.87 124.12 5 1 THR A 114 ? ? -104.98 -111.68 6 1 LYS A 118 ? ? -138.47 -37.95 7 1 ALA A 123 ? ? -102.87 -71.59 8 1 ASP A 134 ? ? -166.10 85.46 9 1 ARG A 137 ? ? -95.49 -73.60 10 1 LYS A 142 ? ? 56.76 83.55 11 1 THR A 156 ? ? -134.79 -66.39 12 1 VAL A 169 ? ? -30.78 129.23 13 1 SER A 302 ? ? -44.63 -175.43 14 1 GLU A 303 ? ? 79.96 -36.53 15 1 LEU A 306 ? ? -152.57 42.44 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 61 ? CG ? A LYS 61 CG 2 1 Y 1 A LYS 61 ? CD ? A LYS 61 CD 3 1 Y 1 A LYS 61 ? CE ? A LYS 61 CE 4 1 Y 1 A LYS 61 ? NZ ? A LYS 61 NZ 5 1 Y 1 A LYS 63 ? CG ? A LYS 63 CG 6 1 Y 1 A LYS 63 ? CD ? A LYS 63 CD 7 1 Y 1 A LYS 63 ? CE ? A LYS 63 CE 8 1 Y 1 A LYS 63 ? NZ ? A LYS 63 NZ 9 1 Y 1 A GLU 64 ? CG ? A GLU 64 CG 10 1 Y 1 A GLU 64 ? CD ? A GLU 64 CD 11 1 Y 1 A GLU 64 ? OE1 ? A GLU 64 OE1 12 1 Y 1 A GLU 64 ? OE2 ? A GLU 64 OE2 13 1 Y 1 A THR 91 ? OG1 ? A THR 91 OG1 14 1 Y 1 A THR 91 ? CG2 ? A THR 91 CG2 15 1 Y 1 A LEU 111 ? CG ? A LEU 111 CG 16 1 Y 1 A LEU 111 ? CD1 ? A LEU 111 CD1 17 1 Y 1 A LEU 111 ? CD2 ? A LEU 111 CD2 18 1 Y 1 A VAL 112 ? CG1 ? A VAL 112 CG1 19 1 Y 1 A VAL 112 ? CG2 ? A VAL 112 CG2 20 1 Y 1 A LEU 113 ? CG ? A LEU 113 CG 21 1 Y 1 A LEU 113 ? CD1 ? A LEU 113 CD1 22 1 Y 1 A LEU 113 ? CD2 ? A LEU 113 CD2 23 1 Y 1 A THR 114 ? OG1 ? A THR 114 OG1 24 1 Y 1 A THR 114 ? CG2 ? A THR 114 CG2 25 1 Y 1 A GLU 115 ? CG ? A GLU 115 CG 26 1 Y 1 A GLU 115 ? CD ? A GLU 115 CD 27 1 Y 1 A GLU 115 ? OE1 ? A GLU 115 OE1 28 1 Y 1 A GLU 115 ? OE2 ? A GLU 115 OE2 29 1 Y 1 A LYS 118 ? CG ? A LYS 118 CG 30 1 Y 1 A LYS 118 ? CD ? A LYS 118 CD 31 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 32 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 33 1 Y 1 A LYS 121 ? CG ? A LYS 121 CG 34 1 Y 1 A LYS 121 ? CD ? A LYS 121 CD 35 1 Y 1 A LYS 121 ? CE ? A LYS 121 CE 36 1 Y 1 A LYS 121 ? NZ ? A LYS 121 NZ 37 1 Y 1 A ILE 124 ? CG1 ? A ILE 124 CG1 38 1 Y 1 A ILE 124 ? CG2 ? A ILE 124 CG2 39 1 Y 1 A ILE 124 ? CD1 ? A ILE 124 CD1 40 1 Y 1 A LYS 126 ? CG ? A LYS 126 CG 41 1 Y 1 A LYS 126 ? CD ? A LYS 126 CD 42 1 Y 1 A LYS 126 ? CE ? A LYS 126 CE 43 1 Y 1 A LYS 126 ? NZ ? A LYS 126 NZ 44 1 Y 1 A VAL 131 ? CG1 ? A VAL 131 CG1 45 1 Y 1 A VAL 131 ? CG2 ? A VAL 131 CG2 46 1 Y 1 A ARG 137 ? CG ? A ARG 137 CG 47 1 Y 1 A ARG 137 ? CD ? A ARG 137 CD 48 1 Y 1 A ARG 137 ? NE ? A ARG 137 NE 49 1 Y 1 A ARG 137 ? CZ ? A ARG 137 CZ 50 1 Y 1 A ARG 137 ? NH1 ? A ARG 137 NH1 51 1 Y 1 A ARG 137 ? NH2 ? A ARG 137 NH2 52 1 Y 1 A TYR 138 ? CG ? A TYR 138 CG 53 1 Y 1 A TYR 138 ? CD1 ? A TYR 138 CD1 54 1 Y 1 A TYR 138 ? CD2 ? A TYR 138 CD2 55 1 Y 1 A TYR 138 ? CE1 ? A TYR 138 CE1 56 1 Y 1 A TYR 138 ? CE2 ? A TYR 138 CE2 57 1 Y 1 A TYR 138 ? CZ ? A TYR 138 CZ 58 1 Y 1 A TYR 138 ? OH ? A TYR 138 OH 59 1 Y 1 P ASP 261 ? CG ? B ASP 1 CG 60 1 Y 1 P ASP 261 ? OD1 ? B ASP 1 OD1 61 1 Y 1 P ASP 261 ? OD2 ? B ASP 1 OD2 62 1 Y 1 P LEU 265 ? CG ? B LEU 5 CG 63 1 Y 1 P LEU 265 ? CD1 ? B LEU 5 CD1 64 1 Y 1 P LEU 265 ? CD2 ? B LEU 5 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LEU 310 ? A LEU 310 3 1 Y 1 A PHE 311 ? A PHE 311 4 1 Y 1 A GLU 312 ? A GLU 312 5 1 Y 1 A GLY 313 ? A GLY 313 6 1 Y 1 A ILE 314 ? A ILE 314 7 1 Y 1 A GLU 315 ? A GLU 315 8 1 Y 1 A GLY 316 ? A GLY 316 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number BT/PR5236/MED/29/504/2012 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CL ? ? CL ? ? 'SUBJECT OF INVESTIGATION' ? 2 LLP ? ? LLP ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CHLORIDE ION' CL 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #