data_7Z8U # _entry.id 7Z8U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Z8U pdb_00007z8u 10.2210/pdb7z8u/pdb WWPDB D_1292121751 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-30 2 'Structure model' 1 1 2023-04-05 3 'Structure model' 1 2 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Z8U _pdbx_database_status.recvd_initial_deposition_date 2022-03-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email rgds@st-andrews.ac.uk _pdbx_contact_author.name_first Rafael _pdbx_contact_author.name_last 'da Silva' _pdbx_contact_author.name_mi G. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1308-8190 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Alphey, M.S.' 1 0000-0002-9353-3716 'Fisher, G.' 2 0000-0002-6169-4718 'da Silva, R.G.' 3 0000-0002-1308-8190 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 7607 _citation.page_last 7607 _citation.title ;Allosteric rescue of catalytically impaired ATP phosphoribosyltransferase variants links protein dynamics to active-site electrostatic preorganisation. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-022-34960-9 _citation.pdbx_database_id_PubMed 36494361 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fisher, G.' 1 ? primary 'Corbella, M.' 2 0000-0001-9209-868X primary 'Alphey, M.S.' 3 ? primary 'Nicholson, J.' 4 ? primary 'Read, B.J.' 5 ? primary 'Kamerlin, S.C.L.' 6 0000-0002-3190-1173 primary 'da Silva, R.G.' 7 0000-0002-1308-8190 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATP phosphoribosyltransferase' 25154.850 1 2.4.2.17 R56A ? 'The glycine prior to the initiating methionine remains after his-tag cleavage. R56A mutation' 2 non-polymer syn 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose 390.070 1 ? ? ? ? 3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ATP-PRT,ATP-PRTase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMTEVTNSLPTSGLLNEANDEFLGLTLALSKGRILEETMPLLRAAGVELLEDPEASAKLIFPTSNPNVRVLILRASDVPT YVEHGAADFGVAGKDVLLEHGANHVYELLDLKIAQCKLMTAGVKDAPLPNRRLRIATKYVNVARAYFASQGQQVDVIKLY GSMELAPLVGLGDLIVDVVDTGNTLRANGLEARDHICDVSSRLIVNQVSYKRKFALLEPILDSFKNSINSTS ; _entity_poly.pdbx_seq_one_letter_code_can ;GMTEVTNSLPTSGLLNEANDEFLGLTLALSKGRILEETMPLLRAAGVELLEDPEASAKLIFPTSNPNVRVLILRASDVPT YVEHGAADFGVAGKDVLLEHGANHVYELLDLKIAQCKLMTAGVKDAPLPNRRLRIATKYVNVARAYFASQGQQVDVIKLY GSMELAPLVGLGDLIVDVVDTGNTLRANGLEARDHICDVSSRLIVNQVSYKRKFALLEPILDSFKNSINSTS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose PRP 3 "ADENOSINE-5'-TRIPHOSPHATE" ATP 4 'MAGNESIUM ION' MG 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 THR n 1 4 GLU n 1 5 VAL n 1 6 THR n 1 7 ASN n 1 8 SER n 1 9 LEU n 1 10 PRO n 1 11 THR n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 LEU n 1 16 ASN n 1 17 GLU n 1 18 ALA n 1 19 ASN n 1 20 ASP n 1 21 GLU n 1 22 PHE n 1 23 LEU n 1 24 GLY n 1 25 LEU n 1 26 THR n 1 27 LEU n 1 28 ALA n 1 29 LEU n 1 30 SER n 1 31 LYS n 1 32 GLY n 1 33 ARG n 1 34 ILE n 1 35 LEU n 1 36 GLU n 1 37 GLU n 1 38 THR n 1 39 MET n 1 40 PRO n 1 41 LEU n 1 42 LEU n 1 43 ARG n 1 44 ALA n 1 45 ALA n 1 46 GLY n 1 47 VAL n 1 48 GLU n 1 49 LEU n 1 50 LEU n 1 51 GLU n 1 52 ASP n 1 53 PRO n 1 54 GLU n 1 55 ALA n 1 56 SER n 1 57 ALA n 1 58 LYS n 1 59 LEU n 1 60 ILE n 1 61 PHE n 1 62 PRO n 1 63 THR n 1 64 SER n 1 65 ASN n 1 66 PRO n 1 67 ASN n 1 68 VAL n 1 69 ARG n 1 70 VAL n 1 71 LEU n 1 72 ILE n 1 73 LEU n 1 74 ARG n 1 75 ALA n 1 76 SER n 1 77 ASP n 1 78 VAL n 1 79 PRO n 1 80 THR n 1 81 TYR n 1 82 VAL n 1 83 GLU n 1 84 HIS n 1 85 GLY n 1 86 ALA n 1 87 ALA n 1 88 ASP n 1 89 PHE n 1 90 GLY n 1 91 VAL n 1 92 ALA n 1 93 GLY n 1 94 LYS n 1 95 ASP n 1 96 VAL n 1 97 LEU n 1 98 LEU n 1 99 GLU n 1 100 HIS n 1 101 GLY n 1 102 ALA n 1 103 ASN n 1 104 HIS n 1 105 VAL n 1 106 TYR n 1 107 GLU n 1 108 LEU n 1 109 LEU n 1 110 ASP n 1 111 LEU n 1 112 LYS n 1 113 ILE n 1 114 ALA n 1 115 GLN n 1 116 CYS n 1 117 LYS n 1 118 LEU n 1 119 MET n 1 120 THR n 1 121 ALA n 1 122 GLY n 1 123 VAL n 1 124 LYS n 1 125 ASP n 1 126 ALA n 1 127 PRO n 1 128 LEU n 1 129 PRO n 1 130 ASN n 1 131 ARG n 1 132 ARG n 1 133 LEU n 1 134 ARG n 1 135 ILE n 1 136 ALA n 1 137 THR n 1 138 LYS n 1 139 TYR n 1 140 VAL n 1 141 ASN n 1 142 VAL n 1 143 ALA n 1 144 ARG n 1 145 ALA n 1 146 TYR n 1 147 PHE n 1 148 ALA n 1 149 SER n 1 150 GLN n 1 151 GLY n 1 152 GLN n 1 153 GLN n 1 154 VAL n 1 155 ASP n 1 156 VAL n 1 157 ILE n 1 158 LYS n 1 159 LEU n 1 160 TYR n 1 161 GLY n 1 162 SER n 1 163 MET n 1 164 GLU n 1 165 LEU n 1 166 ALA n 1 167 PRO n 1 168 LEU n 1 169 VAL n 1 170 GLY n 1 171 LEU n 1 172 GLY n 1 173 ASP n 1 174 LEU n 1 175 ILE n 1 176 VAL n 1 177 ASP n 1 178 VAL n 1 179 VAL n 1 180 ASP n 1 181 THR n 1 182 GLY n 1 183 ASN n 1 184 THR n 1 185 LEU n 1 186 ARG n 1 187 ALA n 1 188 ASN n 1 189 GLY n 1 190 LEU n 1 191 GLU n 1 192 ALA n 1 193 ARG n 1 194 ASP n 1 195 HIS n 1 196 ILE n 1 197 CYS n 1 198 ASP n 1 199 VAL n 1 200 SER n 1 201 SER n 1 202 ARG n 1 203 LEU n 1 204 ILE n 1 205 VAL n 1 206 ASN n 1 207 GLN n 1 208 VAL n 1 209 SER n 1 210 TYR n 1 211 LYS n 1 212 ARG n 1 213 LYS n 1 214 PHE n 1 215 ALA n 1 216 LEU n 1 217 LEU n 1 218 GLU n 1 219 PRO n 1 220 ILE n 1 221 LEU n 1 222 ASP n 1 223 SER n 1 224 PHE n 1 225 LYS n 1 226 ASN n 1 227 SER n 1 228 ILE n 1 229 ASN n 1 230 SER n 1 231 THR n 1 232 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 232 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'hisG, Psyc_1903' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 17307 / VKM B-2377 / 273-4' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Psychrobacter arcticus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 334543 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PRP D-saccharide n 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose ;ALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID; 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribose; 1-O-pyrophosphono-5-O-phosphono-D-ribose; 1-O-pyrophosphono-5-O-phosphono-ribose ; 'C5 H13 O14 P3' 390.070 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_chem_comp_identifier.comp_id PRP _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier a-D-Ribf1PO35PO3 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 THR 3 2 ? ? ? A . n A 1 4 GLU 4 3 ? ? ? A . n A 1 5 VAL 5 4 ? ? ? A . n A 1 6 THR 6 5 ? ? ? A . n A 1 7 ASN 7 6 ? ? ? A . n A 1 8 SER 8 7 ? ? ? A . n A 1 9 LEU 9 8 ? ? ? A . n A 1 10 PRO 10 9 ? ? ? A . n A 1 11 THR 11 10 ? ? ? A . n A 1 12 SER 12 11 ? ? ? A . n A 1 13 GLY 13 12 ? ? ? A . n A 1 14 LEU 14 13 ? ? ? A . n A 1 15 LEU 15 14 ? ? ? A . n A 1 16 ASN 16 15 ? ? ? A . n A 1 17 GLU 17 16 ? ? ? A . n A 1 18 ALA 18 17 ? ? ? A . n A 1 19 ASN 19 18 ? ? ? A . n A 1 20 ASP 20 19 ? ? ? A . n A 1 21 GLU 21 20 ? ? ? A . n A 1 22 PHE 22 21 ? ? ? A . n A 1 23 LEU 23 22 ? ? ? A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 THR 26 25 25 THR THR A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 ALA 28 27 27 ALA ALA A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 SER 30 29 29 SER SER A . n A 1 31 LYS 31 30 30 LYS LYS A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 ARG 33 32 32 ARG ARG A . n A 1 34 ILE 34 33 33 ILE ILE A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 GLU 37 36 36 GLU GLU A . n A 1 38 THR 38 37 37 THR THR A . n A 1 39 MET 39 38 38 MET MET A . n A 1 40 PRO 40 39 39 PRO PRO A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 LEU 42 41 41 LEU LEU A . n A 1 43 ARG 43 42 42 ARG ARG A . n A 1 44 ALA 44 43 43 ALA ALA A . n A 1 45 ALA 45 44 44 ALA ALA A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 GLU 51 50 50 GLU GLU A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 ALA 55 54 54 ALA ALA A . n A 1 56 SER 56 55 55 SER SER A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 LYS 58 57 57 LYS LYS A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 ILE 60 59 59 ILE ILE A . n A 1 61 PHE 61 60 60 PHE PHE A . n A 1 62 PRO 62 61 61 PRO PRO A . n A 1 63 THR 63 62 62 THR THR A . n A 1 64 SER 64 63 63 SER SER A . n A 1 65 ASN 65 64 64 ASN ASN A . n A 1 66 PRO 66 65 65 PRO PRO A . n A 1 67 ASN 67 66 66 ASN ASN A . n A 1 68 VAL 68 67 67 VAL VAL A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 ILE 72 71 71 ILE ILE A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 PRO 79 78 78 PRO PRO A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 TYR 81 80 80 TYR TYR A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 GLU 83 82 82 GLU GLU A . n A 1 84 HIS 84 83 83 HIS HIS A . n A 1 85 GLY 85 84 84 GLY GLY A . n A 1 86 ALA 86 85 85 ALA ALA A . n A 1 87 ALA 87 86 86 ALA ALA A . n A 1 88 ASP 88 87 87 ASP ASP A . n A 1 89 PHE 89 88 88 PHE PHE A . n A 1 90 GLY 90 89 89 GLY GLY A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 LYS 94 93 93 LYS LYS A . n A 1 95 ASP 95 94 94 ASP ASP A . n A 1 96 VAL 96 95 95 VAL VAL A . n A 1 97 LEU 97 96 96 LEU LEU A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 GLU 99 98 98 GLU GLU A . n A 1 100 HIS 100 99 99 HIS HIS A . n A 1 101 GLY 101 100 100 GLY GLY A . n A 1 102 ALA 102 101 101 ALA ALA A . n A 1 103 ASN 103 102 102 ASN ASN A . n A 1 104 HIS 104 103 103 HIS HIS A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 TYR 106 105 105 TYR TYR A . n A 1 107 GLU 107 106 106 GLU GLU A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 ASP 110 109 109 ASP ASP A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 LYS 112 111 111 LYS LYS A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 ALA 114 113 113 ALA ALA A . n A 1 115 GLN 115 114 114 GLN GLN A . n A 1 116 CYS 116 115 115 CYS CYS A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 LEU 118 117 117 LEU LEU A . n A 1 119 MET 119 118 118 MET MET A . n A 1 120 THR 120 119 119 THR THR A . n A 1 121 ALA 121 120 120 ALA ALA A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 LYS 124 123 123 LYS LYS A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 PRO 127 126 126 PRO PRO A . n A 1 128 LEU 128 127 127 LEU LEU A . n A 1 129 PRO 129 128 128 PRO PRO A . n A 1 130 ASN 130 129 129 ASN ASN A . n A 1 131 ARG 131 130 130 ARG ARG A . n A 1 132 ARG 132 131 131 ARG ARG A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 ARG 134 133 133 ARG ARG A . n A 1 135 ILE 135 134 134 ILE ILE A . n A 1 136 ALA 136 135 135 ALA ALA A . n A 1 137 THR 137 136 136 THR THR A . n A 1 138 LYS 138 137 137 LYS LYS A . n A 1 139 TYR 139 138 138 TYR TYR A . n A 1 140 VAL 140 139 139 VAL VAL A . n A 1 141 ASN 141 140 140 ASN ASN A . n A 1 142 VAL 142 141 141 VAL VAL A . n A 1 143 ALA 143 142 142 ALA ALA A . n A 1 144 ARG 144 143 143 ARG ARG A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 TYR 146 145 145 TYR TYR A . n A 1 147 PHE 147 146 146 PHE PHE A . n A 1 148 ALA 148 147 147 ALA ALA A . n A 1 149 SER 149 148 148 SER SER A . n A 1 150 GLN 150 149 149 GLN GLN A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 GLN 152 151 151 GLN GLN A . n A 1 153 GLN 153 152 152 GLN GLN A . n A 1 154 VAL 154 153 153 VAL VAL A . n A 1 155 ASP 155 154 154 ASP ASP A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 ILE 157 156 156 ILE ILE A . n A 1 158 LYS 158 157 157 LYS LYS A . n A 1 159 LEU 159 158 158 LEU LEU A . n A 1 160 TYR 160 159 159 TYR TYR A . n A 1 161 GLY 161 160 160 GLY GLY A . n A 1 162 SER 162 161 161 SER SER A . n A 1 163 MET 163 162 162 MET MET A . n A 1 164 GLU 164 163 163 GLU GLU A . n A 1 165 LEU 165 164 164 LEU LEU A . n A 1 166 ALA 166 165 165 ALA ALA A . n A 1 167 PRO 167 166 166 PRO PRO A . n A 1 168 LEU 168 167 167 LEU LEU A . n A 1 169 VAL 169 168 168 VAL VAL A . n A 1 170 GLY 170 169 169 GLY GLY A . n A 1 171 LEU 171 170 170 LEU LEU A . n A 1 172 GLY 172 171 171 GLY GLY A . n A 1 173 ASP 173 172 172 ASP ASP A . n A 1 174 LEU 174 173 173 LEU LEU A . n A 1 175 ILE 175 174 174 ILE ILE A . n A 1 176 VAL 176 175 175 VAL VAL A . n A 1 177 ASP 177 176 176 ASP ASP A . n A 1 178 VAL 178 177 177 VAL VAL A . n A 1 179 VAL 179 178 178 VAL VAL A . n A 1 180 ASP 180 179 179 ASP ASP A . n A 1 181 THR 181 180 180 THR THR A . n A 1 182 GLY 182 181 181 GLY GLY A . n A 1 183 ASN 183 182 182 ASN ASN A . n A 1 184 THR 184 183 183 THR THR A . n A 1 185 LEU 185 184 184 LEU LEU A . n A 1 186 ARG 186 185 185 ARG ARG A . n A 1 187 ALA 187 186 186 ALA ALA A . n A 1 188 ASN 188 187 187 ASN ASN A . n A 1 189 GLY 189 188 188 GLY GLY A . n A 1 190 LEU 190 189 189 LEU LEU A . n A 1 191 GLU 191 190 190 GLU GLU A . n A 1 192 ALA 192 191 191 ALA ALA A . n A 1 193 ARG 193 192 192 ARG ARG A . n A 1 194 ASP 194 193 193 ASP ASP A . n A 1 195 HIS 195 194 194 HIS HIS A . n A 1 196 ILE 196 195 195 ILE ILE A . n A 1 197 CYS 197 196 196 CYS CYS A . n A 1 198 ASP 198 197 197 ASP ASP A . n A 1 199 VAL 199 198 198 VAL VAL A . n A 1 200 SER 200 199 199 SER SER A . n A 1 201 SER 201 200 200 SER SER A . n A 1 202 ARG 202 201 201 ARG ARG A . n A 1 203 LEU 203 202 202 LEU LEU A . n A 1 204 ILE 204 203 203 ILE ILE A . n A 1 205 VAL 205 204 204 VAL VAL A . n A 1 206 ASN 206 205 205 ASN ASN A . n A 1 207 GLN 207 206 206 GLN GLN A . n A 1 208 VAL 208 207 207 VAL VAL A . n A 1 209 SER 209 208 208 SER SER A . n A 1 210 TYR 210 209 209 TYR TYR A . n A 1 211 LYS 211 210 210 LYS LYS A . n A 1 212 ARG 212 211 211 ARG ARG A . n A 1 213 LYS 213 212 212 LYS LYS A . n A 1 214 PHE 214 213 213 PHE PHE A . n A 1 215 ALA 215 214 214 ALA ALA A . n A 1 216 LEU 216 215 215 LEU LEU A . n A 1 217 LEU 217 216 216 LEU LEU A . n A 1 218 GLU 218 217 217 GLU GLU A . n A 1 219 PRO 219 218 218 PRO PRO A . n A 1 220 ILE 220 219 219 ILE ILE A . n A 1 221 LEU 221 220 220 LEU LEU A . n A 1 222 ASP 222 221 221 ASP ASP A . n A 1 223 SER 223 222 222 SER SER A . n A 1 224 PHE 224 223 223 PHE PHE A . n A 1 225 LYS 225 224 224 LYS LYS A . n A 1 226 ASN 226 225 225 ASN ASN A . n A 1 227 SER 227 226 226 SER SER A . n A 1 228 ILE 228 227 227 ILE ILE A . n A 1 229 ASN 229 228 228 ASN ASN A . n A 1 230 SER 230 229 229 SER SER A . n A 1 231 THR 231 230 ? ? ? A . n A 1 232 SER 232 231 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PRP 1 301 301 PRP PRP A . C 3 ATP 1 302 401 ATP ATP A . D 4 MG 1 303 1 MG MG A . E 5 HOH 1 401 52 HOH HOH A . E 5 HOH 2 402 28 HOH HOH A . E 5 HOH 3 403 20 HOH HOH A . E 5 HOH 4 404 15 HOH HOH A . E 5 HOH 5 405 10 HOH HOH A . E 5 HOH 6 406 17 HOH HOH A . E 5 HOH 7 407 9 HOH HOH A . E 5 HOH 8 408 51 HOH HOH A . E 5 HOH 9 409 1 HOH HOH A . E 5 HOH 10 410 40 HOH HOH A . E 5 HOH 11 411 12 HOH HOH A . E 5 HOH 12 412 29 HOH HOH A . E 5 HOH 13 413 22 HOH HOH A . E 5 HOH 14 414 2 HOH HOH A . E 5 HOH 15 415 7 HOH HOH A . E 5 HOH 16 416 4 HOH HOH A . E 5 HOH 17 417 43 HOH HOH A . E 5 HOH 18 418 13 HOH HOH A . E 5 HOH 19 419 27 HOH HOH A . E 5 HOH 20 420 6 HOH HOH A . E 5 HOH 21 421 18 HOH HOH A . E 5 HOH 22 422 46 HOH HOH A . E 5 HOH 23 423 34 HOH HOH A . E 5 HOH 24 424 37 HOH HOH A . E 5 HOH 25 425 48 HOH HOH A . E 5 HOH 26 426 14 HOH HOH A . E 5 HOH 27 427 24 HOH HOH A . E 5 HOH 28 428 21 HOH HOH A . E 5 HOH 29 429 47 HOH HOH A . E 5 HOH 30 430 58 HOH HOH A . E 5 HOH 31 431 56 HOH HOH A . E 5 HOH 32 432 55 HOH HOH A . E 5 HOH 33 433 30 HOH HOH A . E 5 HOH 34 434 57 HOH HOH A . E 5 HOH 35 435 39 HOH HOH A . E 5 HOH 36 436 25 HOH HOH A . E 5 HOH 37 437 45 HOH HOH A . E 5 HOH 38 438 35 HOH HOH A . E 5 HOH 39 439 32 HOH HOH A . E 5 HOH 40 440 11 HOH HOH A . E 5 HOH 41 441 23 HOH HOH A . E 5 HOH 42 442 26 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 129 ? CG ? A ASN 130 CG 2 1 Y 1 A ASN 129 ? OD1 ? A ASN 130 OD1 3 1 Y 1 A ASN 129 ? ND2 ? A ASN 130 ND2 4 1 Y 1 A ARG 211 ? CG ? A ARG 212 CG 5 1 Y 1 A ARG 211 ? CD ? A ARG 212 CD 6 1 Y 1 A ARG 211 ? NE ? A ARG 212 NE 7 1 Y 1 A ARG 211 ? CZ ? A ARG 212 CZ 8 1 Y 1 A ARG 211 ? NH1 ? A ARG 212 NH1 9 1 Y 1 A ARG 211 ? NH2 ? A ARG 212 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk ? ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? MOSFLM ? ? package . 1 ? 'data scaling' ? ? 'Phil Evans' ? 13/12/18 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.7.4 2 ? phasing ? ? 'Alexei Vaguine' alexei@ysbl.york.ac.uk ? ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/molrep.html ? MOLREP ? ? program . 3 ? refinement ? ? 'Garib N. Murshudov' garib@ysbl.york.ac.uk ? ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/refmac5.html ? REFMAC ? ? program 5.8.0238 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Oct. 31, 2020' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 103.520 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7Z8U _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.090 _cell.length_a_esd ? _cell.length_b 33.900 _cell.length_b_esd ? _cell.length_c 89.265 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7Z8U _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Z8U _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;10mg/ml protein in 20mM Tris HCl pH8.0, 50mM KCl, 10mM MgCl2, 2mM DTT mixed 1:1 with 32% PEG 3350, 0.1M MOPS pH6.0, 0.1M K/Na tartrate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details mirrors _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7Z8U _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 22.020 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13035 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.000 _reflns.pdbx_Rmerge_I_obs 0.108 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.130 _reflns.pdbx_Rpim_I_all 0.072 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.989 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.000 2.050 ? ? 2336 ? ? ? 894 88.200 ? ? ? ? 0.364 ? ? ? ? ? ? ? ? 2.600 ? ? ? 2.500 0.453 0.267 ? 1 1 0.843 ? ? ? ? ? ? ? ? ? ? 8.940 22.010 ? ? 411 ? ? ? 128 81.300 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 3.200 ? ? ? 16.000 0.065 0.034 ? 2 1 0.995 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -1.8400 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.7600 _refine.aniso_B[2][2] -2.5200 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 4.2300 _refine.B_iso_max 68.660 _refine.B_iso_mean 19.8090 _refine.B_iso_min 8.470 _refine.correlation_coeff_Fo_to_Fc 0.9270 _refine.correlation_coeff_Fo_to_Fc_free 0.8970 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Z8U _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0000 _refine.ls_d_res_low 22.0200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12411 _refine.ls_number_reflns_R_free 623 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.4300 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2239 _refine.ls_R_factor_R_free 0.2682 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2216 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6FCT _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2500 _refine.pdbx_overall_ESU_R_Free 0.2050 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 7.5390 _refine.overall_SU_ML 0.1950 _refine.overall_SU_R_Cruickshank_DPI 0.2495 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0000 _refine_hist.d_res_low 22.0200 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1669 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 207 _refine_hist.pdbx_B_iso_mean_ligand 37.18 _refine_hist.pdbx_B_iso_mean_solvent 20.24 _refine_hist.pdbx_number_atoms_protein 1573 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 54 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 1651 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1581 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.623 1.658 2253 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.244 1.582 3658 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.929 5.000 206 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.525 22.133 75 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.552 15.000 279 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.093 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.067 0.200 222 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1793 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 311 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0000 _refine_ls_shell.d_res_low 2.0520 _refine_ls_shell.number_reflns_all 893 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 853 _refine_ls_shell.percent_reflns_obs 87.3800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2800 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2950 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7Z8U _struct.title 'Catalytic subunit HisG R56A mutant from Psychrobacter arcticus ATPPRT (HisGZ) in complex with ATP and PRPP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Z8U _struct_keywords.text 'ATP, phosphoribosyltransferase, ATPPRT, PRPP, HisG, HisGZ, histidine, biosynthesis, allosteric, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HIS1_PSYA2 _struct_ref.pdbx_db_accession Q4FQF7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTEVTNSLPTSGLLNEANDEFLGLTLALSKGRILEETMPLLRAAGVELLEDPEASRKLIFPTSNPNVRVLILRASDVPTY VEHGAADFGVAGKDVLLEHGANHVYELLDLKIAQCKLMTAGVKDAPLPNRRLRIATKYVNVARAYFASQGQQVDVIKLYG SMELAPLVGLGDLIVDVVDTGNTLRANGLEARDHICDVSSRLIVNQVSYKRKFALLEPILDSFKNSINSTS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Z8U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 232 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4FQF7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 231 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Z8U GLY A 1 ? UNP Q4FQF7 ? ? 'expression tag' 0 1 1 7Z8U ALA A 57 ? UNP Q4FQF7 ARG 56 'engineered mutation' 56 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5750 ? 1 MORE -57 ? 1 'SSA (A^2)' 17800 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 70.0900000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 32 ? ALA A 45 ? GLY A 31 ALA A 44 1 ? 14 HELX_P HELX_P2 AA2 ASP A 52 ? SER A 56 ? ASP A 51 SER A 55 5 ? 5 HELX_P HELX_P3 AA3 ARG A 74 ? SER A 76 ? ARG A 73 SER A 75 5 ? 3 HELX_P HELX_P4 AA4 ASP A 77 ? HIS A 84 ? ASP A 76 HIS A 83 1 ? 8 HELX_P HELX_P5 AA5 LYS A 94 ? GLY A 101 ? LYS A 93 GLY A 100 1 ? 8 HELX_P HELX_P6 AA6 TYR A 139 ? GLN A 150 ? TYR A 138 GLN A 149 1 ? 12 HELX_P HELX_P7 AA7 SER A 162 ? GLY A 170 ? SER A 161 GLY A 169 5 ? 9 HELX_P HELX_P8 AA8 GLY A 182 ? ASN A 188 ? GLY A 181 ASN A 187 1 ? 7 HELX_P HELX_P9 AA9 VAL A 208 ? LYS A 213 ? VAL A 207 LYS A 212 1 ? 6 HELX_P HELX_P10 AB1 LYS A 213 ? SER A 230 ? LYS A 212 SER A 229 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B PRP . O2A ? ? ? 1_555 D MG . MG ? ? A PRP 301 A MG 303 1_555 ? ? ? ? ? ? ? 2.519 ? ? metalc2 metalc ? ? B PRP . O2B ? ? ? 1_555 D MG . MG ? ? A PRP 301 A MG 303 1_555 ? ? ? ? ? ? ? 1.826 ? ? metalc3 metalc ? ? C ATP . O1B ? ? ? 1_555 D MG . MG ? ? A ATP 302 A MG 303 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc4 metalc ? ? C ATP . O1A ? ? ? 1_555 D MG . MG ? ? A ATP 302 A MG 303 1_555 ? ? ? ? ? ? ? 1.943 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O2A ? B PRP . ? A PRP 301 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O2B ? B PRP . ? A PRP 301 ? 1_555 63.9 ? 2 O2A ? B PRP . ? A PRP 301 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O1B ? C ATP . ? A ATP 302 ? 1_555 146.6 ? 3 O2B ? B PRP . ? A PRP 301 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O1B ? C ATP . ? A ATP 302 ? 1_555 93.9 ? 4 O2A ? B PRP . ? A PRP 301 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O1A ? C ATP . ? A ATP 302 ? 1_555 76.8 ? 5 O2B ? B PRP . ? A PRP 301 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O1A ? C ATP . ? A ATP 302 ? 1_555 134.2 ? 6 O1B ? C ATP . ? A ATP 302 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O1A ? C ATP . ? A ATP 302 ? 1_555 108.2 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 60 ? PRO A 62 ? ILE A 59 PRO A 61 AA1 2 VAL A 68 ? ILE A 72 ? VAL A 67 ILE A 71 AA1 3 LEU A 25 ? LEU A 29 ? LEU A 24 LEU A 28 AA1 4 PHE A 89 ? GLY A 93 ? PHE A 88 GLY A 92 AA1 5 SER A 201 ? ASN A 206 ? SER A 200 ASN A 205 AA1 6 VAL A 105 ? ASP A 110 ? VAL A 104 ASP A 109 AA2 1 ASP A 155 ? LYS A 158 ? ASP A 154 LYS A 157 AA2 2 ARG A 134 ? THR A 137 ? ARG A 133 THR A 136 AA2 3 LEU A 174 ? VAL A 179 ? LEU A 173 VAL A 178 AA2 4 CYS A 116 ? VAL A 123 ? CYS A 115 VAL A 122 AA2 5 LEU A 190 ? VAL A 199 ? LEU A 189 VAL A 198 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 61 ? N PHE A 60 O VAL A 70 ? O VAL A 69 AA1 2 3 O LEU A 71 ? O LEU A 70 N LEU A 27 ? N LEU A 26 AA1 3 4 N ALA A 28 ? N ALA A 27 O PHE A 89 ? O PHE A 88 AA1 4 5 N ALA A 92 ? N ALA A 91 O ARG A 202 ? O ARG A 201 AA1 5 6 O LEU A 203 ? O LEU A 202 N LEU A 108 ? N LEU A 107 AA2 1 2 O ASP A 155 ? O ASP A 154 N ILE A 135 ? N ILE A 134 AA2 2 3 N ALA A 136 ? N ALA A 135 O LEU A 174 ? O LEU A 173 AA2 3 4 O VAL A 179 ? O VAL A 178 N LYS A 117 ? N LYS A 116 AA2 4 5 N CYS A 116 ? N CYS A 115 O VAL A 199 ? O VAL A 198 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 129 ? ? -85.04 36.17 2 1 ASP A 179 ? ? -111.22 -85.81 # _pdbx_phasing_MR.entry_id 7Z8U _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body 0.425 _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 22.010 _pdbx_phasing_MR.d_res_low_rotation 2.070 _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 7Z8U _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A THR 2 ? A THR 3 4 1 Y 1 A GLU 3 ? A GLU 4 5 1 Y 1 A VAL 4 ? A VAL 5 6 1 Y 1 A THR 5 ? A THR 6 7 1 Y 1 A ASN 6 ? A ASN 7 8 1 Y 1 A SER 7 ? A SER 8 9 1 Y 1 A LEU 8 ? A LEU 9 10 1 Y 1 A PRO 9 ? A PRO 10 11 1 Y 1 A THR 10 ? A THR 11 12 1 Y 1 A SER 11 ? A SER 12 13 1 Y 1 A GLY 12 ? A GLY 13 14 1 Y 1 A LEU 13 ? A LEU 14 15 1 Y 1 A LEU 14 ? A LEU 15 16 1 Y 1 A ASN 15 ? A ASN 16 17 1 Y 1 A GLU 16 ? A GLU 17 18 1 Y 1 A ALA 17 ? A ALA 18 19 1 Y 1 A ASN 18 ? A ASN 19 20 1 Y 1 A ASP 19 ? A ASP 20 21 1 Y 1 A GLU 20 ? A GLU 21 22 1 Y 1 A PHE 21 ? A PHE 22 23 1 Y 1 A LEU 22 ? A LEU 23 24 1 Y 1 A THR 230 ? A THR 231 25 1 Y 1 A SER 231 ? A SER 232 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 ATP PG P N N 74 ATP O1G O N N 75 ATP O2G O N N 76 ATP O3G O N N 77 ATP PB P N R 78 ATP O1B O N N 79 ATP O2B O N N 80 ATP O3B O N N 81 ATP PA P N R 82 ATP O1A O N N 83 ATP O2A O N N 84 ATP O3A O N N 85 ATP "O5'" O N N 86 ATP "C5'" C N N 87 ATP "C4'" C N R 88 ATP "O4'" O N N 89 ATP "C3'" C N S 90 ATP "O3'" O N N 91 ATP "C2'" C N R 92 ATP "O2'" O N N 93 ATP "C1'" C N R 94 ATP N9 N Y N 95 ATP C8 C Y N 96 ATP N7 N Y N 97 ATP C5 C Y N 98 ATP C6 C Y N 99 ATP N6 N N N 100 ATP N1 N Y N 101 ATP C2 C Y N 102 ATP N3 N Y N 103 ATP C4 C Y N 104 ATP HOG2 H N N 105 ATP HOG3 H N N 106 ATP HOB2 H N N 107 ATP HOA2 H N N 108 ATP "H5'1" H N N 109 ATP "H5'2" H N N 110 ATP "H4'" H N N 111 ATP "H3'" H N N 112 ATP "HO3'" H N N 113 ATP "H2'" H N N 114 ATP "HO2'" H N N 115 ATP "H1'" H N N 116 ATP H8 H N N 117 ATP HN61 H N N 118 ATP HN62 H N N 119 ATP H2 H N N 120 CYS N N N N 121 CYS CA C N R 122 CYS C C N N 123 CYS O O N N 124 CYS CB C N N 125 CYS SG S N N 126 CYS OXT O N N 127 CYS H H N N 128 CYS H2 H N N 129 CYS HA H N N 130 CYS HB2 H N N 131 CYS HB3 H N N 132 CYS HG H N N 133 CYS HXT H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 MG MG MG N N 297 PHE N N N N 298 PHE CA C N S 299 PHE C C N N 300 PHE O O N N 301 PHE CB C N N 302 PHE CG C Y N 303 PHE CD1 C Y N 304 PHE CD2 C Y N 305 PHE CE1 C Y N 306 PHE CE2 C Y N 307 PHE CZ C Y N 308 PHE OXT O N N 309 PHE H H N N 310 PHE H2 H N N 311 PHE HA H N N 312 PHE HB2 H N N 313 PHE HB3 H N N 314 PHE HD1 H N N 315 PHE HD2 H N N 316 PHE HE1 H N N 317 PHE HE2 H N N 318 PHE HZ H N N 319 PHE HXT H N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 PRP C1 C N R 338 PRP C2 C N R 339 PRP C3 C N S 340 PRP C4 C N R 341 PRP C5 C N N 342 PRP O1 O N N 343 PRP O2 O N N 344 PRP O3 O N N 345 PRP O4 O N N 346 PRP O5 O N N 347 PRP P P N N 348 PRP O1P O N N 349 PRP O2P O N N 350 PRP O3P O N N 351 PRP PA P N R 352 PRP O1A O N N 353 PRP O2A O N N 354 PRP O3A O N N 355 PRP PB P N N 356 PRP O1B O N N 357 PRP O2B O N N 358 PRP O3B O N N 359 PRP H1 H N N 360 PRP H2 H N N 361 PRP H3 H N N 362 PRP H4 H N N 363 PRP H51 H N N 364 PRP H52 H N N 365 PRP HO2 H N N 366 PRP HO3 H N N 367 PRP HOP2 H N N 368 PRP HOP3 H N N 369 PRP HOA2 H N N 370 PRP HOB2 H N N 371 PRP HOB3 H N N 372 SER N N N N 373 SER CA C N S 374 SER C C N N 375 SER O O N N 376 SER CB C N N 377 SER OG O N N 378 SER OXT O N N 379 SER H H N N 380 SER H2 H N N 381 SER HA H N N 382 SER HB2 H N N 383 SER HB3 H N N 384 SER HG H N N 385 SER HXT H N N 386 THR N N N N 387 THR CA C N S 388 THR C C N N 389 THR O O N N 390 THR CB C N R 391 THR OG1 O N N 392 THR CG2 C N N 393 THR OXT O N N 394 THR H H N N 395 THR H2 H N N 396 THR HA H N N 397 THR HB H N N 398 THR HG1 H N N 399 THR HG21 H N N 400 THR HG22 H N N 401 THR HG23 H N N 402 THR HXT H N N 403 TYR N N N N 404 TYR CA C N S 405 TYR C C N N 406 TYR O O N N 407 TYR CB C N N 408 TYR CG C Y N 409 TYR CD1 C Y N 410 TYR CD2 C Y N 411 TYR CE1 C Y N 412 TYR CE2 C Y N 413 TYR CZ C Y N 414 TYR OH O N N 415 TYR OXT O N N 416 TYR H H N N 417 TYR H2 H N N 418 TYR HA H N N 419 TYR HB2 H N N 420 TYR HB3 H N N 421 TYR HD1 H N N 422 TYR HD2 H N N 423 TYR HE1 H N N 424 TYR HE2 H N N 425 TYR HH H N N 426 TYR HXT H N N 427 VAL N N N N 428 VAL CA C N S 429 VAL C C N N 430 VAL O O N N 431 VAL CB C N N 432 VAL CG1 C N N 433 VAL CG2 C N N 434 VAL OXT O N N 435 VAL H H N N 436 VAL H2 H N N 437 VAL HA H N N 438 VAL HB H N N 439 VAL HG11 H N N 440 VAL HG12 H N N 441 VAL HG13 H N N 442 VAL HG21 H N N 443 VAL HG22 H N N 444 VAL HG23 H N N 445 VAL HXT H N N 446 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 ATP PG O1G doub N N 70 ATP PG O2G sing N N 71 ATP PG O3G sing N N 72 ATP PG O3B sing N N 73 ATP O2G HOG2 sing N N 74 ATP O3G HOG3 sing N N 75 ATP PB O1B doub N N 76 ATP PB O2B sing N N 77 ATP PB O3B sing N N 78 ATP PB O3A sing N N 79 ATP O2B HOB2 sing N N 80 ATP PA O1A doub N N 81 ATP PA O2A sing N N 82 ATP PA O3A sing N N 83 ATP PA "O5'" sing N N 84 ATP O2A HOA2 sing N N 85 ATP "O5'" "C5'" sing N N 86 ATP "C5'" "C4'" sing N N 87 ATP "C5'" "H5'1" sing N N 88 ATP "C5'" "H5'2" sing N N 89 ATP "C4'" "O4'" sing N N 90 ATP "C4'" "C3'" sing N N 91 ATP "C4'" "H4'" sing N N 92 ATP "O4'" "C1'" sing N N 93 ATP "C3'" "O3'" sing N N 94 ATP "C3'" "C2'" sing N N 95 ATP "C3'" "H3'" sing N N 96 ATP "O3'" "HO3'" sing N N 97 ATP "C2'" "O2'" sing N N 98 ATP "C2'" "C1'" sing N N 99 ATP "C2'" "H2'" sing N N 100 ATP "O2'" "HO2'" sing N N 101 ATP "C1'" N9 sing N N 102 ATP "C1'" "H1'" sing N N 103 ATP N9 C8 sing Y N 104 ATP N9 C4 sing Y N 105 ATP C8 N7 doub Y N 106 ATP C8 H8 sing N N 107 ATP N7 C5 sing Y N 108 ATP C5 C6 sing Y N 109 ATP C5 C4 doub Y N 110 ATP C6 N6 sing N N 111 ATP C6 N1 doub Y N 112 ATP N6 HN61 sing N N 113 ATP N6 HN62 sing N N 114 ATP N1 C2 sing Y N 115 ATP C2 N3 doub Y N 116 ATP C2 H2 sing N N 117 ATP N3 C4 sing Y N 118 CYS N CA sing N N 119 CYS N H sing N N 120 CYS N H2 sing N N 121 CYS CA C sing N N 122 CYS CA CB sing N N 123 CYS CA HA sing N N 124 CYS C O doub N N 125 CYS C OXT sing N N 126 CYS CB SG sing N N 127 CYS CB HB2 sing N N 128 CYS CB HB3 sing N N 129 CYS SG HG sing N N 130 CYS OXT HXT sing N N 131 GLN N CA sing N N 132 GLN N H sing N N 133 GLN N H2 sing N N 134 GLN CA C sing N N 135 GLN CA CB sing N N 136 GLN CA HA sing N N 137 GLN C O doub N N 138 GLN C OXT sing N N 139 GLN CB CG sing N N 140 GLN CB HB2 sing N N 141 GLN CB HB3 sing N N 142 GLN CG CD sing N N 143 GLN CG HG2 sing N N 144 GLN CG HG3 sing N N 145 GLN CD OE1 doub N N 146 GLN CD NE2 sing N N 147 GLN NE2 HE21 sing N N 148 GLN NE2 HE22 sing N N 149 GLN OXT HXT sing N N 150 GLU N CA sing N N 151 GLU N H sing N N 152 GLU N H2 sing N N 153 GLU CA C sing N N 154 GLU CA CB sing N N 155 GLU CA HA sing N N 156 GLU C O doub N N 157 GLU C OXT sing N N 158 GLU CB CG sing N N 159 GLU CB HB2 sing N N 160 GLU CB HB3 sing N N 161 GLU CG CD sing N N 162 GLU CG HG2 sing N N 163 GLU CG HG3 sing N N 164 GLU CD OE1 doub N N 165 GLU CD OE2 sing N N 166 GLU OE2 HE2 sing N N 167 GLU OXT HXT sing N N 168 GLY N CA sing N N 169 GLY N H sing N N 170 GLY N H2 sing N N 171 GLY CA C sing N N 172 GLY CA HA2 sing N N 173 GLY CA HA3 sing N N 174 GLY C O doub N N 175 GLY C OXT sing N N 176 GLY OXT HXT sing N N 177 HIS N CA sing N N 178 HIS N H sing N N 179 HIS N H2 sing N N 180 HIS CA C sing N N 181 HIS CA CB sing N N 182 HIS CA HA sing N N 183 HIS C O doub N N 184 HIS C OXT sing N N 185 HIS CB CG sing N N 186 HIS CB HB2 sing N N 187 HIS CB HB3 sing N N 188 HIS CG ND1 sing Y N 189 HIS CG CD2 doub Y N 190 HIS ND1 CE1 doub Y N 191 HIS ND1 HD1 sing N N 192 HIS CD2 NE2 sing Y N 193 HIS CD2 HD2 sing N N 194 HIS CE1 NE2 sing Y N 195 HIS CE1 HE1 sing N N 196 HIS NE2 HE2 sing N N 197 HIS OXT HXT sing N N 198 HOH O H1 sing N N 199 HOH O H2 sing N N 200 ILE N CA sing N N 201 ILE N H sing N N 202 ILE N H2 sing N N 203 ILE CA C sing N N 204 ILE CA CB sing N N 205 ILE CA HA sing N N 206 ILE C O doub N N 207 ILE C OXT sing N N 208 ILE CB CG1 sing N N 209 ILE CB CG2 sing N N 210 ILE CB HB sing N N 211 ILE CG1 CD1 sing N N 212 ILE CG1 HG12 sing N N 213 ILE CG1 HG13 sing N N 214 ILE CG2 HG21 sing N N 215 ILE CG2 HG22 sing N N 216 ILE CG2 HG23 sing N N 217 ILE CD1 HD11 sing N N 218 ILE CD1 HD12 sing N N 219 ILE CD1 HD13 sing N N 220 ILE OXT HXT sing N N 221 LEU N CA sing N N 222 LEU N H sing N N 223 LEU N H2 sing N N 224 LEU CA C sing N N 225 LEU CA CB sing N N 226 LEU CA HA sing N N 227 LEU C O doub N N 228 LEU C OXT sing N N 229 LEU CB CG sing N N 230 LEU CB HB2 sing N N 231 LEU CB HB3 sing N N 232 LEU CG CD1 sing N N 233 LEU CG CD2 sing N N 234 LEU CG HG sing N N 235 LEU CD1 HD11 sing N N 236 LEU CD1 HD12 sing N N 237 LEU CD1 HD13 sing N N 238 LEU CD2 HD21 sing N N 239 LEU CD2 HD22 sing N N 240 LEU CD2 HD23 sing N N 241 LEU OXT HXT sing N N 242 LYS N CA sing N N 243 LYS N H sing N N 244 LYS N H2 sing N N 245 LYS CA C sing N N 246 LYS CA CB sing N N 247 LYS CA HA sing N N 248 LYS C O doub N N 249 LYS C OXT sing N N 250 LYS CB CG sing N N 251 LYS CB HB2 sing N N 252 LYS CB HB3 sing N N 253 LYS CG CD sing N N 254 LYS CG HG2 sing N N 255 LYS CG HG3 sing N N 256 LYS CD CE sing N N 257 LYS CD HD2 sing N N 258 LYS CD HD3 sing N N 259 LYS CE NZ sing N N 260 LYS CE HE2 sing N N 261 LYS CE HE3 sing N N 262 LYS NZ HZ1 sing N N 263 LYS NZ HZ2 sing N N 264 LYS NZ HZ3 sing N N 265 LYS OXT HXT sing N N 266 MET N CA sing N N 267 MET N H sing N N 268 MET N H2 sing N N 269 MET CA C sing N N 270 MET CA CB sing N N 271 MET CA HA sing N N 272 MET C O doub N N 273 MET C OXT sing N N 274 MET CB CG sing N N 275 MET CB HB2 sing N N 276 MET CB HB3 sing N N 277 MET CG SD sing N N 278 MET CG HG2 sing N N 279 MET CG HG3 sing N N 280 MET SD CE sing N N 281 MET CE HE1 sing N N 282 MET CE HE2 sing N N 283 MET CE HE3 sing N N 284 MET OXT HXT sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 PRP C1 C2 sing N N 326 PRP C1 O1 sing N N 327 PRP C1 O4 sing N N 328 PRP C1 H1 sing N N 329 PRP C2 C3 sing N N 330 PRP C2 O2 sing N N 331 PRP C2 H2 sing N N 332 PRP C3 C4 sing N N 333 PRP C3 O3 sing N N 334 PRP C3 H3 sing N N 335 PRP C4 C5 sing N N 336 PRP C4 O4 sing N N 337 PRP C4 H4 sing N N 338 PRP C5 O5 sing N N 339 PRP C5 H51 sing N N 340 PRP C5 H52 sing N N 341 PRP O1 PA sing N N 342 PRP O2 HO2 sing N N 343 PRP O3 HO3 sing N N 344 PRP O5 P sing N N 345 PRP P O1P doub N N 346 PRP P O2P sing N N 347 PRP P O3P sing N N 348 PRP O2P HOP2 sing N N 349 PRP O3P HOP3 sing N N 350 PRP PA O1A doub N N 351 PRP PA O2A sing N N 352 PRP PA O3A sing N N 353 PRP O2A HOA2 sing N N 354 PRP O3A PB sing N N 355 PRP PB O1B doub N N 356 PRP PB O2B sing N N 357 PRP PB O3B sing N N 358 PRP O2B HOB2 sing N N 359 PRP O3B HOB3 sing N N 360 SER N CA sing N N 361 SER N H sing N N 362 SER N H2 sing N N 363 SER CA C sing N N 364 SER CA CB sing N N 365 SER CA HA sing N N 366 SER C O doub N N 367 SER C OXT sing N N 368 SER CB OG sing N N 369 SER CB HB2 sing N N 370 SER CB HB3 sing N N 371 SER OG HG sing N N 372 SER OXT HXT sing N N 373 THR N CA sing N N 374 THR N H sing N N 375 THR N H2 sing N N 376 THR CA C sing N N 377 THR CA CB sing N N 378 THR CA HA sing N N 379 THR C O doub N N 380 THR C OXT sing N N 381 THR CB OG1 sing N N 382 THR CB CG2 sing N N 383 THR CB HB sing N N 384 THR OG1 HG1 sing N N 385 THR CG2 HG21 sing N N 386 THR CG2 HG22 sing N N 387 THR CG2 HG23 sing N N 388 THR OXT HXT sing N N 389 TYR N CA sing N N 390 TYR N H sing N N 391 TYR N H2 sing N N 392 TYR CA C sing N N 393 TYR CA CB sing N N 394 TYR CA HA sing N N 395 TYR C O doub N N 396 TYR C OXT sing N N 397 TYR CB CG sing N N 398 TYR CB HB2 sing N N 399 TYR CB HB3 sing N N 400 TYR CG CD1 doub Y N 401 TYR CG CD2 sing Y N 402 TYR CD1 CE1 sing Y N 403 TYR CD1 HD1 sing N N 404 TYR CD2 CE2 doub Y N 405 TYR CD2 HD2 sing N N 406 TYR CE1 CZ doub Y N 407 TYR CE1 HE1 sing N N 408 TYR CE2 CZ sing Y N 409 TYR CE2 HE2 sing N N 410 TYR CZ OH sing N N 411 TYR OH HH sing N N 412 TYR OXT HXT sing N N 413 VAL N CA sing N N 414 VAL N H sing N N 415 VAL N H2 sing N N 416 VAL CA C sing N N 417 VAL CA CB sing N N 418 VAL CA HA sing N N 419 VAL C O doub N N 420 VAL C OXT sing N N 421 VAL CB CG1 sing N N 422 VAL CB CG2 sing N N 423 VAL CB HB sing N N 424 VAL CG1 HG11 sing N N 425 VAL CG1 HG12 sing N N 426 VAL CG1 HG13 sing N N 427 VAL CG2 HG21 sing N N 428 VAL CG2 HG22 sing N N 429 VAL CG2 HG23 sing N N 430 VAL OXT HXT sing N N 431 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number BB/M010996/1 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ATP ? ? ATP ? ? 'SUBJECT OF INVESTIGATION' ? 2 PRP ? ? PRP ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6FCT _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7Z8U _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014267 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003430 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029499 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011522 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O P S # loop_