data_7Z9U # _entry.id 7Z9U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Z9U pdb_00007z9u 10.2210/pdb7z9u/pdb WWPDB D_1292121846 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2022-12-07 3 'Structure model' 1 2 2024-01-31 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Z9U _pdbx_database_status.recvd_initial_deposition_date 2022-03-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email martin.noble@ncl.ac.uk _pdbx_contact_author.name_first Martin _pdbx_contact_author.name_last Noble _pdbx_contact_author.name_mi E.M _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3595-9807 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Turberville, S.' 1 0000-0003-2173-9675 'Martin, M.P.' 2 0000-0003-4810-3351 'Hope, I.' 3 ? 'Noble, M.E.M.' 4 0000-0002-3595-9807 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 15416 _citation.page_last 15432 _citation.title ;Mapping Ligand Interactions of Bromodomains BRD4 and ATAD2 with FragLites and PepLites─Halogenated Probes of Druglike and Peptide-like Molecular Interactions. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01357 _citation.pdbx_database_id_PubMed 36367089 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Davison, G.' 1 ? primary 'Martin, M.P.' 2 ? primary 'Turberville, S.' 3 ? primary 'Dormen, S.' 4 ? primary 'Heath, R.' 5 ? primary 'Heptinstall, A.B.' 6 ? primary 'Lawson, M.' 7 ? primary 'Miller, D.C.' 8 ? primary 'Ng, Y.M.' 9 ? primary 'Sanderson, J.N.' 10 ? primary 'Hope, I.' 11 ? primary 'Wood, D.J.' 12 ? primary 'Cano, C.' 13 ? primary 'Endicott, J.A.' 14 ? primary 'Hardcastle, I.R.' 15 ? primary 'Noble, M.E.M.' 16 ? primary 'Waring, M.J.' 17 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATPase family AAA domain-containing protein 2' 15453.514 1 3.6.1.3 ? bromodomain ? 2 non-polymer syn ARGININE 175.209 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 non-polymer syn 1,2-ETHANEDIOL 62.068 5 ? ? ? ? 6 non-polymer syn '(2S)-2,6-diacetamido-N-methyl-hexanamide' 243.303 1 ? ? ? ? 7 water nat water 18.015 113 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AAA nuclear coregulator cancer-associated protein,ANCCA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_seq_one_letter_code_can ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ARGININE ARG 3 'SULFATE ION' SO4 4 'CHLORIDE ION' CL 5 1,2-ETHANEDIOL EDO 6 '(2S)-2,6-diacetamido-N-methyl-hexanamide' 8WS 7 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLN n 1 4 GLU n 1 5 GLU n 1 6 ASP n 1 7 THR n 1 8 PHE n 1 9 ARG n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 PHE n 1 15 LEU n 1 16 ARG n 1 17 ASN n 1 18 VAL n 1 19 THR n 1 20 HIS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ILE n 1 25 ASP n 1 26 LYS n 1 27 ARG n 1 28 PHE n 1 29 ARG n 1 30 VAL n 1 31 PHE n 1 32 THR n 1 33 LYS n 1 34 PRO n 1 35 VAL n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 GLU n 1 40 VAL n 1 41 PRO n 1 42 ASP n 1 43 TYR n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 PRO n 1 51 MET n 1 52 ASP n 1 53 LEU n 1 54 SER n 1 55 SER n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 ILE n 1 61 ASP n 1 62 LEU n 1 63 HIS n 1 64 LYS n 1 65 TYR n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 LYS n 1 70 ASP n 1 71 TYR n 1 72 LEU n 1 73 ARG n 1 74 ASP n 1 75 ILE n 1 76 ASP n 1 77 LEU n 1 78 ILE n 1 79 CYS n 1 80 SER n 1 81 ASN n 1 82 ALA n 1 83 LEU n 1 84 GLU n 1 85 TYR n 1 86 ASN n 1 87 PRO n 1 88 ASP n 1 89 ARG n 1 90 ASP n 1 91 PRO n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 LEU n 1 96 ILE n 1 97 ARG n 1 98 HIS n 1 99 ARG n 1 100 ALA n 1 101 CYS n 1 102 ALA n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 THR n 1 107 ALA n 1 108 TYR n 1 109 ALA n 1 110 ILE n 1 111 ILE n 1 112 LYS n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 ASP n 1 117 GLU n 1 118 ASP n 1 119 PHE n 1 120 GLU n 1 121 GLN n 1 122 LEU n 1 123 CYS n 1 124 GLU n 1 125 GLU n 1 126 ILE n 1 127 GLN n 1 128 GLU n 1 129 SER n 1 130 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATAD2, L16, PRO2000' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8WS non-polymer . '(2S)-2,6-diacetamido-N-methyl-hexanamide' ? 'C11 H21 N3 O3' 243.303 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 979 979 SER SER AAA . n A 1 2 MET 2 980 980 MET MET AAA . n A 1 3 GLN 3 981 981 GLN GLN AAA . n A 1 4 GLU 4 982 982 GLU GLU AAA . n A 1 5 GLU 5 983 983 GLU GLU AAA . n A 1 6 ASP 6 984 984 ASP ASP AAA . n A 1 7 THR 7 985 985 THR THR AAA . n A 1 8 PHE 8 986 986 PHE PHE AAA . n A 1 9 ARG 9 987 987 ARG ARG AAA . n A 1 10 GLU 10 988 988 GLU GLU AAA . n A 1 11 LEU 11 989 989 LEU LEU AAA . n A 1 12 ARG 12 990 990 ARG ARG AAA . n A 1 13 ILE 13 991 991 ILE ILE AAA . n A 1 14 PHE 14 992 992 PHE PHE AAA . n A 1 15 LEU 15 993 993 LEU LEU AAA . n A 1 16 ARG 16 994 994 ARG ARG AAA . n A 1 17 ASN 17 995 995 ASN ASN AAA . n A 1 18 VAL 18 996 996 VAL VAL AAA . n A 1 19 THR 19 997 997 THR THR AAA . n A 1 20 HIS 20 998 998 HIS HIS AAA . n A 1 21 ARG 21 999 999 ARG ARG AAA . n A 1 22 LEU 22 1000 1000 LEU LEU AAA . n A 1 23 ALA 23 1001 1001 ALA ALA AAA . n A 1 24 ILE 24 1002 1002 ILE ILE AAA . n A 1 25 ASP 25 1003 1003 ASP ASP AAA . n A 1 26 LYS 26 1004 1004 LYS LYS AAA . n A 1 27 ARG 27 1005 1005 ARG ARG AAA . n A 1 28 PHE 28 1006 1006 PHE PHE AAA . n A 1 29 ARG 29 1007 1007 ARG ARG AAA . n A 1 30 VAL 30 1008 1008 VAL VAL AAA . n A 1 31 PHE 31 1009 1009 PHE PHE AAA . n A 1 32 THR 32 1010 1010 THR THR AAA . n A 1 33 LYS 33 1011 1011 LYS LYS AAA . n A 1 34 PRO 34 1012 1012 PRO PRO AAA . n A 1 35 VAL 35 1013 1013 VAL VAL AAA . n A 1 36 ASP 36 1014 1014 ASP ASP AAA . n A 1 37 PRO 37 1015 1015 PRO PRO AAA . n A 1 38 ASP 38 1016 1016 ASP ASP AAA . n A 1 39 GLU 39 1017 1017 GLU GLU AAA . n A 1 40 VAL 40 1018 1018 VAL VAL AAA . n A 1 41 PRO 41 1019 1019 PRO PRO AAA . n A 1 42 ASP 42 1020 1020 ASP ASP AAA . n A 1 43 TYR 43 1021 1021 TYR TYR AAA . n A 1 44 VAL 44 1022 1022 VAL VAL AAA . n A 1 45 THR 45 1023 1023 THR THR AAA . n A 1 46 VAL 46 1024 1024 VAL VAL AAA . n A 1 47 ILE 47 1025 1025 ILE ILE AAA . n A 1 48 LYS 48 1026 1026 LYS LYS AAA . n A 1 49 GLN 49 1027 1027 GLN GLN AAA . n A 1 50 PRO 50 1028 1028 PRO PRO AAA . n A 1 51 MET 51 1029 1029 MET MET AAA . n A 1 52 ASP 52 1030 1030 ASP ASP AAA . n A 1 53 LEU 53 1031 1031 LEU LEU AAA . n A 1 54 SER 54 1032 1032 SER SER AAA . n A 1 55 SER 55 1033 1033 SER SER AAA . n A 1 56 VAL 56 1034 1034 VAL VAL AAA . n A 1 57 ILE 57 1035 1035 ILE ILE AAA . n A 1 58 SER 58 1036 1036 SER SER AAA . n A 1 59 LYS 59 1037 1037 LYS LYS AAA . n A 1 60 ILE 60 1038 1038 ILE ILE AAA . n A 1 61 ASP 61 1039 1039 ASP ASP AAA . n A 1 62 LEU 62 1040 1040 LEU LEU AAA . n A 1 63 HIS 63 1041 1041 HIS HIS AAA . n A 1 64 LYS 64 1042 1042 LYS LYS AAA . n A 1 65 TYR 65 1043 1043 TYR TYR AAA . n A 1 66 LEU 66 1044 1044 LEU LEU AAA . n A 1 67 THR 67 1045 1045 THR THR AAA . n A 1 68 VAL 68 1046 1046 VAL VAL AAA . n A 1 69 LYS 69 1047 1047 LYS LYS AAA . n A 1 70 ASP 70 1048 1048 ASP ASP AAA . n A 1 71 TYR 71 1049 1049 TYR TYR AAA . n A 1 72 LEU 72 1050 1050 LEU LEU AAA . n A 1 73 ARG 73 1051 1051 ARG ARG AAA . n A 1 74 ASP 74 1052 1052 ASP ASP AAA . n A 1 75 ILE 75 1053 1053 ILE ILE AAA . n A 1 76 ASP 76 1054 1054 ASP ASP AAA . n A 1 77 LEU 77 1055 1055 LEU LEU AAA . n A 1 78 ILE 78 1056 1056 ILE ILE AAA . n A 1 79 CYS 79 1057 1057 CYS CYS AAA . n A 1 80 SER 80 1058 1058 SER SER AAA . n A 1 81 ASN 81 1059 1059 ASN ASN AAA . n A 1 82 ALA 82 1060 1060 ALA ALA AAA . n A 1 83 LEU 83 1061 1061 LEU LEU AAA . n A 1 84 GLU 84 1062 1062 GLU GLU AAA . n A 1 85 TYR 85 1063 1063 TYR TYR AAA . n A 1 86 ASN 86 1064 1064 ASN ASN AAA . n A 1 87 PRO 87 1065 1065 PRO PRO AAA . n A 1 88 ASP 88 1066 1066 ASP ASP AAA . n A 1 89 ARG 89 1067 1067 ARG ARG AAA . n A 1 90 ASP 90 1068 1068 ASP ASP AAA . n A 1 91 PRO 91 1069 1069 PRO PRO AAA . n A 1 92 GLY 92 1070 1070 GLY GLY AAA . n A 1 93 ASP 93 1071 1071 ASP ASP AAA . n A 1 94 ARG 94 1072 1072 ARG ARG AAA . n A 1 95 LEU 95 1073 1073 LEU LEU AAA . n A 1 96 ILE 96 1074 1074 ILE ILE AAA . n A 1 97 ARG 97 1075 1075 ARG ARG AAA . n A 1 98 HIS 98 1076 1076 HIS HIS AAA . n A 1 99 ARG 99 1077 1077 ARG ARG AAA . n A 1 100 ALA 100 1078 1078 ALA ALA AAA . n A 1 101 CYS 101 1079 1079 CYS CYS AAA . n A 1 102 ALA 102 1080 1080 ALA ALA AAA . n A 1 103 LEU 103 1081 1081 LEU LEU AAA . n A 1 104 ARG 104 1082 1082 ARG ARG AAA . n A 1 105 ASP 105 1083 1083 ASP ASP AAA . n A 1 106 THR 106 1084 1084 THR THR AAA . n A 1 107 ALA 107 1085 1085 ALA ALA AAA . n A 1 108 TYR 108 1086 1086 TYR TYR AAA . n A 1 109 ALA 109 1087 1087 ALA ALA AAA . n A 1 110 ILE 110 1088 1088 ILE ILE AAA . n A 1 111 ILE 111 1089 1089 ILE ILE AAA . n A 1 112 LYS 112 1090 1090 LYS LYS AAA . n A 1 113 GLU 113 1091 1091 GLU GLU AAA . n A 1 114 GLU 114 1092 1092 GLU GLU AAA . n A 1 115 LEU 115 1093 1093 LEU LEU AAA . n A 1 116 ASP 116 1094 1094 ASP ASP AAA . n A 1 117 GLU 117 1095 1095 GLU GLU AAA . n A 1 118 ASP 118 1096 1096 ASP ASP AAA . n A 1 119 PHE 119 1097 1097 PHE PHE AAA . n A 1 120 GLU 120 1098 1098 GLU GLU AAA . n A 1 121 GLN 121 1099 1099 GLN GLN AAA . n A 1 122 LEU 122 1100 1100 LEU LEU AAA . n A 1 123 CYS 123 1101 1101 CYS CYS AAA . n A 1 124 GLU 124 1102 1102 GLU GLU AAA . n A 1 125 GLU 125 1103 1103 GLU GLU AAA . n A 1 126 ILE 126 1104 1104 ILE ILE AAA . n A 1 127 GLN 127 1105 1105 GLN GLN AAA . n A 1 128 GLU 128 1106 1106 GLU GLU AAA . n A 1 129 SER 129 1107 1107 SER SER AAA . n A 1 130 ARG 130 1108 1108 ARG ARG AAA . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 8WS _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 8WS _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ARG 1 1201 1108 ARG ARG AAA . C 3 SO4 1 1202 1 SO4 SO4 AAA . D 4 CL 1 1203 1109 CL CL AAA . E 5 EDO 1 1204 1 EDO EDO AAA . F 5 EDO 1 1205 2 EDO EDO AAA . G 5 EDO 1 1206 3 EDO EDO AAA . H 5 EDO 1 1207 4 EDO EDO AAA . I 5 EDO 1 1208 5 EDO EDO AAA . J 3 SO4 1 1209 1 SO4 SO4 AAA . K 6 8WS 1 1210 2 8WS DRG AAA . L 7 HOH 1 1301 236 HOH HOH AAA . L 7 HOH 2 1302 159 HOH HOH AAA . L 7 HOH 3 1303 158 HOH HOH AAA . L 7 HOH 4 1304 193 HOH HOH AAA . L 7 HOH 5 1305 240 HOH HOH AAA . L 7 HOH 6 1306 255 HOH HOH AAA . L 7 HOH 7 1307 24 HOH HOH AAA . L 7 HOH 8 1308 124 HOH HOH AAA . L 7 HOH 9 1309 61 HOH HOH AAA . L 7 HOH 10 1310 104 HOH HOH AAA . L 7 HOH 11 1311 49 HOH HOH AAA . L 7 HOH 12 1312 234 HOH HOH AAA . L 7 HOH 13 1313 47 HOH HOH AAA . L 7 HOH 14 1314 147 HOH HOH AAA . L 7 HOH 15 1315 51 HOH HOH AAA . L 7 HOH 16 1316 22 HOH HOH AAA . L 7 HOH 17 1317 37 HOH HOH AAA . L 7 HOH 18 1318 23 HOH HOH AAA . L 7 HOH 19 1319 120 HOH HOH AAA . L 7 HOH 20 1320 246 HOH HOH AAA . L 7 HOH 21 1321 55 HOH HOH AAA . L 7 HOH 22 1322 242 HOH HOH AAA . L 7 HOH 23 1323 71 HOH HOH AAA . L 7 HOH 24 1324 241 HOH HOH AAA . L 7 HOH 25 1325 39 HOH HOH AAA . L 7 HOH 26 1326 14 HOH HOH AAA . L 7 HOH 27 1327 253 HOH HOH AAA . L 7 HOH 28 1328 15 HOH HOH AAA . L 7 HOH 29 1329 77 HOH HOH AAA . L 7 HOH 30 1330 243 HOH HOH AAA . L 7 HOH 31 1331 197 HOH HOH AAA . L 7 HOH 32 1332 245 HOH HOH AAA . L 7 HOH 33 1333 57 HOH HOH AAA . L 7 HOH 34 1334 13 HOH HOH AAA . L 7 HOH 35 1335 107 HOH HOH AAA . L 7 HOH 36 1336 114 HOH HOH AAA . L 7 HOH 37 1337 132 HOH HOH AAA . L 7 HOH 38 1338 8 HOH HOH AAA . L 7 HOH 39 1339 129 HOH HOH AAA . L 7 HOH 40 1340 53 HOH HOH AAA . L 7 HOH 41 1341 69 HOH HOH AAA . L 7 HOH 42 1342 1 HOH HOH AAA . L 7 HOH 43 1343 32 HOH HOH AAA . L 7 HOH 44 1344 113 HOH HOH AAA . L 7 HOH 45 1345 21 HOH HOH AAA . L 7 HOH 46 1346 238 HOH HOH AAA . L 7 HOH 47 1347 169 HOH HOH AAA . L 7 HOH 48 1348 2 HOH HOH AAA . L 7 HOH 49 1349 175 HOH HOH AAA . L 7 HOH 50 1350 40 HOH HOH AAA . L 7 HOH 51 1351 72 HOH HOH AAA . L 7 HOH 52 1352 58 HOH HOH AAA . L 7 HOH 53 1353 33 HOH HOH AAA . L 7 HOH 54 1354 73 HOH HOH AAA . L 7 HOH 55 1355 35 HOH HOH AAA . L 7 HOH 56 1356 52 HOH HOH AAA . L 7 HOH 57 1357 19 HOH HOH AAA . L 7 HOH 58 1358 127 HOH HOH AAA . L 7 HOH 59 1359 239 HOH HOH AAA . L 7 HOH 60 1360 128 HOH HOH AAA . L 7 HOH 61 1361 38 HOH HOH AAA . L 7 HOH 62 1362 41 HOH HOH AAA . L 7 HOH 63 1363 43 HOH HOH AAA . L 7 HOH 64 1364 64 HOH HOH AAA . L 7 HOH 65 1365 3 HOH HOH AAA . L 7 HOH 66 1366 237 HOH HOH AAA . L 7 HOH 67 1367 20 HOH HOH AAA . L 7 HOH 68 1368 68 HOH HOH AAA . L 7 HOH 69 1369 48 HOH HOH AAA . L 7 HOH 70 1370 25 HOH HOH AAA . L 7 HOH 71 1371 50 HOH HOH AAA . L 7 HOH 72 1372 248 HOH HOH AAA . L 7 HOH 73 1373 195 HOH HOH AAA . L 7 HOH 74 1374 249 HOH HOH AAA . L 7 HOH 75 1375 66 HOH HOH AAA . L 7 HOH 76 1376 9 HOH HOH AAA . L 7 HOH 77 1377 252 HOH HOH AAA . L 7 HOH 78 1378 87 HOH HOH AAA . L 7 HOH 79 1379 188 HOH HOH AAA . L 7 HOH 80 1380 74 HOH HOH AAA . L 7 HOH 81 1381 76 HOH HOH AAA . L 7 HOH 82 1382 88 HOH HOH AAA . L 7 HOH 83 1383 244 HOH HOH AAA . L 7 HOH 84 1384 117 HOH HOH AAA . L 7 HOH 85 1385 139 HOH HOH AAA . L 7 HOH 86 1386 135 HOH HOH AAA . L 7 HOH 87 1387 198 HOH HOH AAA . L 7 HOH 88 1388 168 HOH HOH AAA . L 7 HOH 89 1389 194 HOH HOH AAA . L 7 HOH 90 1390 16 HOH HOH AAA . L 7 HOH 91 1391 254 HOH HOH AAA . L 7 HOH 92 1392 204 HOH HOH AAA . L 7 HOH 93 1393 56 HOH HOH AAA . L 7 HOH 94 1394 227 HOH HOH AAA . L 7 HOH 95 1395 123 HOH HOH AAA . L 7 HOH 96 1396 27 HOH HOH AAA . L 7 HOH 97 1397 82 HOH HOH AAA . L 7 HOH 98 1398 30 HOH HOH AAA . L 7 HOH 99 1399 171 HOH HOH AAA . L 7 HOH 100 1400 251 HOH HOH AAA . L 7 HOH 101 1401 217 HOH HOH AAA . L 7 HOH 102 1402 228 HOH HOH AAA . L 7 HOH 103 1403 137 HOH HOH AAA . L 7 HOH 104 1404 186 HOH HOH AAA . L 7 HOH 105 1405 62 HOH HOH AAA . L 7 HOH 106 1406 5 HOH HOH AAA . L 7 HOH 107 1407 60 HOH HOH AAA . L 7 HOH 108 1408 250 HOH HOH AAA . L 7 HOH 109 1409 45 HOH HOH AAA . L 7 HOH 110 1410 70 HOH HOH AAA . L 7 HOH 111 1411 232 HOH HOH AAA . L 7 HOH 112 1412 44 HOH HOH AAA . L 7 HOH 113 1413 154 HOH HOH AAA . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7Z9U _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.029 _cell.length_a_esd ? _cell.length_b 79.029 _cell.length_b_esd ? _cell.length_c 137.875 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7Z9U _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Z9U _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M BisTris pH 6-7, 1.7-2.1M Ammonium sulphate' _exptl_crystal_grow.pdbx_pH_range 6-7 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-09-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91162 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91162 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7Z9U _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.76 _reflns.d_resolution_low 48.57 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26026 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 39.2 _reflns.pdbx_Rmerge_I_obs 0.150 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.153 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 8.97 48.57 ? ? ? ? ? ? 269 ? ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 28.0 ? ? ? ? 0.028 0.006 ? 1 1 1.000 ? ? ? ? ? ? ? ? ? ? 1.76 1.79 ? ? ? ? ? ? 1441 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 40.4 ? ? ? ? 10.637 2.295 ? 2 1 0.327 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -0.419 _refine.aniso_B[1][2] -0.209 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.419 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 1.359 _refine.B_iso_max ? _refine.B_iso_mean 42.310 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.965 _refine.correlation_coeff_Fo_to_Fc_free 0.955 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Z9U _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.760 _refine.ls_d_res_low 48.57 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25962 _refine.ls_number_reflns_R_free 1345 _refine.ls_number_reflns_R_work 24617 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.958 _refine.ls_percent_reflns_R_free 5.181 _refine.ls_R_factor_all 0.206 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2271 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2047 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3DAI _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.095 _refine.pdbx_overall_ESU_R_Free 0.093 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.600 _refine.overall_SU_ML 0.078 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.760 _refine_hist.d_res_low 48.57 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 1257 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1084 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.012 1195 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 2.046 1.666 1606 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.510 5.000 136 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.459 20.119 84 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.665 15.000 221 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.635 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.135 0.200 152 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.020 933 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.228 0.200 588 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.322 0.200 793 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 98 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.160 0.200 31 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.475 0.200 13 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.142 3.667 541 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.477 5.440 678 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.640 4.432 654 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 9.461 6.366 928 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 11.515 51.777 1865 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.760 1.806 . . 102 1762 99.9464 . . . 0.336 . 0.348 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.806 1.855 . . 83 1745 100.0000 . . . 0.316 . 0.323 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.855 1.909 . . 91 1677 100.0000 . . . 0.345 . 0.312 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.909 1.968 . . 91 1650 100.0000 . . . 0.280 . 0.277 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.968 2.032 . . 97 1589 100.0000 . . . 0.256 . 0.242 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.032 2.104 . . 64 1555 100.0000 . . . 0.265 . 0.217 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.104 2.183 . . 75 1513 100.0000 . . . 0.241 . 0.213 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.183 2.272 . . 77 1439 100.0000 . . . 0.248 . 0.200 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.272 2.373 . . 82 1382 100.0000 . . . 0.237 . 0.206 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.373 2.489 . . 73 1334 100.0000 . . . 0.239 . 0.205 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.489 2.623 . . 74 1257 100.0000 . . . 0.267 . 0.204 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.623 2.782 . . 68 1202 100.0000 . . . 0.249 . 0.204 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.782 2.974 . . 60 1140 100.0000 . . . 0.301 . 0.217 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.974 3.213 . . 62 1062 100.0000 . . . 0.222 . 0.199 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.213 3.519 . . 47 1004 100.0000 . . . 0.180 . 0.193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.519 3.934 . . 56 899 100.0000 . . . 0.178 . 0.174 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.934 4.542 . . 52 803 100.0000 . . . 0.191 . 0.173 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.542 5.561 . . 45 687 100.0000 . . . 0.203 . 0.178 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.561 7.859 . . 30 569 100.0000 . . . 0.219 . 0.220 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.859 48.57 . . 16 348 99.4536 . . . 0.250 . 0.194 . . . . . . . . . . . # _struct.entry_id 7Z9U _struct.title 'ATAD2 in complex with Acetyl-Lys' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Z9U _struct_keywords.text 'ATAD2, INHIBITOR, FRAGMENT, BROMODOMAIN, FRAGLITE, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 5 ? H N N 5 ? I N N 5 ? J N N 3 ? K N N 6 ? L N N 7 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATAD2_HUMAN _struct_ref.pdbx_db_accession Q6PL18 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNA LEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _struct_ref.pdbx_align_begin 981 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Z9U _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6PL18 _struct_ref_seq.db_align_beg 981 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 981 _struct_ref_seq.pdbx_auth_seq_align_end 1108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Z9U SER AAA 1 ? UNP Q6PL18 ? ? 'expression tag' 979 1 1 7Z9U MET AAA 2 ? UNP Q6PL18 ? ? 'expression tag' 980 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1260 ? 1 MORE -7 ? 1 'SSA (A^2)' 8460 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? ILE A 24 ? SER AAA 979 ILE AAA 1002 1 ? 24 HELX_P HELX_P2 AA2 ASP A 25 ? THR A 32 ? ASP AAA 1003 THR AAA 1010 5 ? 8 HELX_P HELX_P3 AA3 ASP A 42 ? ILE A 47 ? ASP AAA 1020 ILE AAA 1025 1 ? 6 HELX_P HELX_P4 AA4 ASP A 52 ? LEU A 62 ? ASP AAA 1030 LEU AAA 1040 1 ? 11 HELX_P HELX_P5 AA5 THR A 67 ? ASN A 86 ? THR AAA 1045 ASN AAA 1064 1 ? 20 HELX_P HELX_P6 AA6 ASP A 90 ? LEU A 115 ? ASP AAA 1068 LEU AAA 1093 1 ? 26 HELX_P HELX_P7 AA7 ASP A 116 ? SER A 129 ? ASP AAA 1094 SER AAA 1107 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 79 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 101 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id AAA _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 1057 _struct_conn.ptnr2_auth_asym_id AAA _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 1079 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.140 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 79 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 101 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id AAA _pdbx_modification_feature.auth_seq_id 1057 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id AAA _pdbx_modification_feature.modified_residue_auth_seq_id 1079 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 7Z9U _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 AAA _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 1305 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 AAA _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 1306 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_565 _pdbx_validate_symm_contact.dist 1.15 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG AAA ARG 1075 ? ? CD AAA ARG 1075 ? ? NE AAA ARG 1075 ? ? 124.57 111.80 12.77 2.10 N 2 1 CB AAA CYS 1079 ? ? CA AAA CYS 1079 ? ? C AAA CYS 1079 ? ? 120.01 111.50 8.51 1.20 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id AAA _pdbx_validate_torsion.auth_seq_id 1016 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -68.25 _pdbx_validate_torsion.psi -78.41 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8WS C1 C N N 1 8WS N1 N N N 2 8WS O1 O N N 3 8WS C01 C N N 4 8WS N01 N N N 5 8WS O01 O N N 6 8WS C02 C N N 7 8WS N02 N N N 8 8WS O02 O N N 9 8WS C03 C N S 10 8WS C04 C N N 11 8WS C05 C N N 12 8WS C06 C N N 13 8WS C07 C N N 14 8WS C08 C N N 15 8WS C09 C N N 16 8WS C10 C N N 17 8WS H1 H N N 18 8WS H1A H N N 19 8WS H1B H N N 20 8WS HN1 H N N 21 8WS H01 H N N 22 8WS H01A H N N 23 8WS H01B H N N 24 8WS HN01 H N N 25 8WS HN02 H N N 26 8WS H03 H N N 27 8WS H04 H N N 28 8WS H04A H N N 29 8WS H05 H N N 30 8WS H05A H N N 31 8WS H06 H N N 32 8WS H06A H N N 33 8WS H07 H N N 34 8WS H07A H N N 35 8WS H09 H N N 36 8WS H09A H N N 37 8WS H09B H N N 38 ALA N N N N 39 ALA CA C N S 40 ALA C C N N 41 ALA O O N N 42 ALA CB C N N 43 ALA OXT O N N 44 ALA H H N N 45 ALA H2 H N N 46 ALA HA H N N 47 ALA HB1 H N N 48 ALA HB2 H N N 49 ALA HB3 H N N 50 ALA HXT H N N 51 ARG N N N N 52 ARG CA C N S 53 ARG C C N N 54 ARG O O N N 55 ARG CB C N N 56 ARG CG C N N 57 ARG CD C N N 58 ARG NE N N N 59 ARG CZ C N N 60 ARG NH1 N N N 61 ARG NH2 N N N 62 ARG OXT O N N 63 ARG H H N N 64 ARG H2 H N N 65 ARG HA H N N 66 ARG HB2 H N N 67 ARG HB3 H N N 68 ARG HG2 H N N 69 ARG HG3 H N N 70 ARG HD2 H N N 71 ARG HD3 H N N 72 ARG HE H N N 73 ARG HH11 H N N 74 ARG HH12 H N N 75 ARG HH21 H N N 76 ARG HH22 H N N 77 ARG HXT H N N 78 ASN N N N N 79 ASN CA C N S 80 ASN C C N N 81 ASN O O N N 82 ASN CB C N N 83 ASN CG C N N 84 ASN OD1 O N N 85 ASN ND2 N N N 86 ASN OXT O N N 87 ASN H H N N 88 ASN H2 H N N 89 ASN HA H N N 90 ASN HB2 H N N 91 ASN HB3 H N N 92 ASN HD21 H N N 93 ASN HD22 H N N 94 ASN HXT H N N 95 ASP N N N N 96 ASP CA C N S 97 ASP C C N N 98 ASP O O N N 99 ASP CB C N N 100 ASP CG C N N 101 ASP OD1 O N N 102 ASP OD2 O N N 103 ASP OXT O N N 104 ASP H H N N 105 ASP H2 H N N 106 ASP HA H N N 107 ASP HB2 H N N 108 ASP HB3 H N N 109 ASP HD2 H N N 110 ASP HXT H N N 111 CL CL CL N N 112 CYS N N N N 113 CYS CA C N R 114 CYS C C N N 115 CYS O O N N 116 CYS CB C N N 117 CYS SG S N N 118 CYS OXT O N N 119 CYS H H N N 120 CYS H2 H N N 121 CYS HA H N N 122 CYS HB2 H N N 123 CYS HB3 H N N 124 CYS HG H N N 125 CYS HXT H N N 126 EDO C1 C N N 127 EDO O1 O N N 128 EDO C2 C N N 129 EDO O2 O N N 130 EDO H11 H N N 131 EDO H12 H N N 132 EDO HO1 H N N 133 EDO H21 H N N 134 EDO H22 H N N 135 EDO HO2 H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HIS N N N N 186 HIS CA C N S 187 HIS C C N N 188 HIS O O N N 189 HIS CB C N N 190 HIS CG C Y N 191 HIS ND1 N Y N 192 HIS CD2 C Y N 193 HIS CE1 C Y N 194 HIS NE2 N Y N 195 HIS OXT O N N 196 HIS H H N N 197 HIS H2 H N N 198 HIS HA H N N 199 HIS HB2 H N N 200 HIS HB3 H N N 201 HIS HD1 H N N 202 HIS HD2 H N N 203 HIS HE1 H N N 204 HIS HE2 H N N 205 HIS HXT H N N 206 HOH O O N N 207 HOH H1 H N N 208 HOH H2 H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 SO4 S S N N 353 SO4 O1 O N N 354 SO4 O2 O N N 355 SO4 O3 O N N 356 SO4 O4 O N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TYR N N N N 375 TYR CA C N S 376 TYR C C N N 377 TYR O O N N 378 TYR CB C N N 379 TYR CG C Y N 380 TYR CD1 C Y N 381 TYR CD2 C Y N 382 TYR CE1 C Y N 383 TYR CE2 C Y N 384 TYR CZ C Y N 385 TYR OH O N N 386 TYR OXT O N N 387 TYR H H N N 388 TYR H2 H N N 389 TYR HA H N N 390 TYR HB2 H N N 391 TYR HB3 H N N 392 TYR HD1 H N N 393 TYR HD2 H N N 394 TYR HE1 H N N 395 TYR HE2 H N N 396 TYR HH H N N 397 TYR HXT H N N 398 VAL N N N N 399 VAL CA C N S 400 VAL C C N N 401 VAL O O N N 402 VAL CB C N N 403 VAL CG1 C N N 404 VAL CG2 C N N 405 VAL OXT O N N 406 VAL H H N N 407 VAL H2 H N N 408 VAL HA H N N 409 VAL HB H N N 410 VAL HG11 H N N 411 VAL HG12 H N N 412 VAL HG13 H N N 413 VAL HG21 H N N 414 VAL HG22 H N N 415 VAL HG23 H N N 416 VAL HXT H N N 417 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8WS C1 C10 sing N N 1 8WS N1 C03 sing N N 2 8WS N1 C10 sing N N 3 8WS O1 C10 doub N N 4 8WS C01 N01 sing N N 5 8WS N01 C02 sing N N 6 8WS O01 C02 doub N N 7 8WS C02 C03 sing N N 8 8WS N02 C07 sing N N 9 8WS N02 C08 sing N N 10 8WS O02 C08 doub N N 11 8WS C03 C04 sing N N 12 8WS C04 C05 sing N N 13 8WS C05 C06 sing N N 14 8WS C06 C07 sing N N 15 8WS C08 C09 sing N N 16 8WS C1 H1 sing N N 17 8WS C1 H1A sing N N 18 8WS C1 H1B sing N N 19 8WS N1 HN1 sing N N 20 8WS C01 H01 sing N N 21 8WS C01 H01A sing N N 22 8WS C01 H01B sing N N 23 8WS N01 HN01 sing N N 24 8WS N02 HN02 sing N N 25 8WS C03 H03 sing N N 26 8WS C04 H04 sing N N 27 8WS C04 H04A sing N N 28 8WS C05 H05 sing N N 29 8WS C05 H05A sing N N 30 8WS C06 H06 sing N N 31 8WS C06 H06A sing N N 32 8WS C07 H07 sing N N 33 8WS C07 H07A sing N N 34 8WS C09 H09 sing N N 35 8WS C09 H09A sing N N 36 8WS C09 H09B sing N N 37 ALA N CA sing N N 38 ALA N H sing N N 39 ALA N H2 sing N N 40 ALA CA C sing N N 41 ALA CA CB sing N N 42 ALA CA HA sing N N 43 ALA C O doub N N 44 ALA C OXT sing N N 45 ALA CB HB1 sing N N 46 ALA CB HB2 sing N N 47 ALA CB HB3 sing N N 48 ALA OXT HXT sing N N 49 ARG N CA sing N N 50 ARG N H sing N N 51 ARG N H2 sing N N 52 ARG CA C sing N N 53 ARG CA CB sing N N 54 ARG CA HA sing N N 55 ARG C O doub N N 56 ARG C OXT sing N N 57 ARG CB CG sing N N 58 ARG CB HB2 sing N N 59 ARG CB HB3 sing N N 60 ARG CG CD sing N N 61 ARG CG HG2 sing N N 62 ARG CG HG3 sing N N 63 ARG CD NE sing N N 64 ARG CD HD2 sing N N 65 ARG CD HD3 sing N N 66 ARG NE CZ sing N N 67 ARG NE HE sing N N 68 ARG CZ NH1 sing N N 69 ARG CZ NH2 doub N N 70 ARG NH1 HH11 sing N N 71 ARG NH1 HH12 sing N N 72 ARG NH2 HH21 sing N N 73 ARG NH2 HH22 sing N N 74 ARG OXT HXT sing N N 75 ASN N CA sing N N 76 ASN N H sing N N 77 ASN N H2 sing N N 78 ASN CA C sing N N 79 ASN CA CB sing N N 80 ASN CA HA sing N N 81 ASN C O doub N N 82 ASN C OXT sing N N 83 ASN CB CG sing N N 84 ASN CB HB2 sing N N 85 ASN CB HB3 sing N N 86 ASN CG OD1 doub N N 87 ASN CG ND2 sing N N 88 ASN ND2 HD21 sing N N 89 ASN ND2 HD22 sing N N 90 ASN OXT HXT sing N N 91 ASP N CA sing N N 92 ASP N H sing N N 93 ASP N H2 sing N N 94 ASP CA C sing N N 95 ASP CA CB sing N N 96 ASP CA HA sing N N 97 ASP C O doub N N 98 ASP C OXT sing N N 99 ASP CB CG sing N N 100 ASP CB HB2 sing N N 101 ASP CB HB3 sing N N 102 ASP CG OD1 doub N N 103 ASP CG OD2 sing N N 104 ASP OD2 HD2 sing N N 105 ASP OXT HXT sing N N 106 CYS N CA sing N N 107 CYS N H sing N N 108 CYS N H2 sing N N 109 CYS CA C sing N N 110 CYS CA CB sing N N 111 CYS CA HA sing N N 112 CYS C O doub N N 113 CYS C OXT sing N N 114 CYS CB SG sing N N 115 CYS CB HB2 sing N N 116 CYS CB HB3 sing N N 117 CYS SG HG sing N N 118 CYS OXT HXT sing N N 119 EDO C1 O1 sing N N 120 EDO C1 C2 sing N N 121 EDO C1 H11 sing N N 122 EDO C1 H12 sing N N 123 EDO O1 HO1 sing N N 124 EDO C2 O2 sing N N 125 EDO C2 H21 sing N N 126 EDO C2 H22 sing N N 127 EDO O2 HO2 sing N N 128 GLN N CA sing N N 129 GLN N H sing N N 130 GLN N H2 sing N N 131 GLN CA C sing N N 132 GLN CA CB sing N N 133 GLN CA HA sing N N 134 GLN C O doub N N 135 GLN C OXT sing N N 136 GLN CB CG sing N N 137 GLN CB HB2 sing N N 138 GLN CB HB3 sing N N 139 GLN CG CD sing N N 140 GLN CG HG2 sing N N 141 GLN CG HG3 sing N N 142 GLN CD OE1 doub N N 143 GLN CD NE2 sing N N 144 GLN NE2 HE21 sing N N 145 GLN NE2 HE22 sing N N 146 GLN OXT HXT sing N N 147 GLU N CA sing N N 148 GLU N H sing N N 149 GLU N H2 sing N N 150 GLU CA C sing N N 151 GLU CA CB sing N N 152 GLU CA HA sing N N 153 GLU C O doub N N 154 GLU C OXT sing N N 155 GLU CB CG sing N N 156 GLU CB HB2 sing N N 157 GLU CB HB3 sing N N 158 GLU CG CD sing N N 159 GLU CG HG2 sing N N 160 GLU CG HG3 sing N N 161 GLU CD OE1 doub N N 162 GLU CD OE2 sing N N 163 GLU OE2 HE2 sing N N 164 GLU OXT HXT sing N N 165 GLY N CA sing N N 166 GLY N H sing N N 167 GLY N H2 sing N N 168 GLY CA C sing N N 169 GLY CA HA2 sing N N 170 GLY CA HA3 sing N N 171 GLY C O doub N N 172 GLY C OXT sing N N 173 GLY OXT HXT sing N N 174 HIS N CA sing N N 175 HIS N H sing N N 176 HIS N H2 sing N N 177 HIS CA C sing N N 178 HIS CA CB sing N N 179 HIS CA HA sing N N 180 HIS C O doub N N 181 HIS C OXT sing N N 182 HIS CB CG sing N N 183 HIS CB HB2 sing N N 184 HIS CB HB3 sing N N 185 HIS CG ND1 sing Y N 186 HIS CG CD2 doub Y N 187 HIS ND1 CE1 doub Y N 188 HIS ND1 HD1 sing N N 189 HIS CD2 NE2 sing Y N 190 HIS CD2 HD2 sing N N 191 HIS CE1 NE2 sing Y N 192 HIS CE1 HE1 sing N N 193 HIS NE2 HE2 sing N N 194 HIS OXT HXT sing N N 195 HOH O H1 sing N N 196 HOH O H2 sing N N 197 ILE N CA sing N N 198 ILE N H sing N N 199 ILE N H2 sing N N 200 ILE CA C sing N N 201 ILE CA CB sing N N 202 ILE CA HA sing N N 203 ILE C O doub N N 204 ILE C OXT sing N N 205 ILE CB CG1 sing N N 206 ILE CB CG2 sing N N 207 ILE CB HB sing N N 208 ILE CG1 CD1 sing N N 209 ILE CG1 HG12 sing N N 210 ILE CG1 HG13 sing N N 211 ILE CG2 HG21 sing N N 212 ILE CG2 HG22 sing N N 213 ILE CG2 HG23 sing N N 214 ILE CD1 HD11 sing N N 215 ILE CD1 HD12 sing N N 216 ILE CD1 HD13 sing N N 217 ILE OXT HXT sing N N 218 LEU N CA sing N N 219 LEU N H sing N N 220 LEU N H2 sing N N 221 LEU CA C sing N N 222 LEU CA CB sing N N 223 LEU CA HA sing N N 224 LEU C O doub N N 225 LEU C OXT sing N N 226 LEU CB CG sing N N 227 LEU CB HB2 sing N N 228 LEU CB HB3 sing N N 229 LEU CG CD1 sing N N 230 LEU CG CD2 sing N N 231 LEU CG HG sing N N 232 LEU CD1 HD11 sing N N 233 LEU CD1 HD12 sing N N 234 LEU CD1 HD13 sing N N 235 LEU CD2 HD21 sing N N 236 LEU CD2 HD22 sing N N 237 LEU CD2 HD23 sing N N 238 LEU OXT HXT sing N N 239 LYS N CA sing N N 240 LYS N H sing N N 241 LYS N H2 sing N N 242 LYS CA C sing N N 243 LYS CA CB sing N N 244 LYS CA HA sing N N 245 LYS C O doub N N 246 LYS C OXT sing N N 247 LYS CB CG sing N N 248 LYS CB HB2 sing N N 249 LYS CB HB3 sing N N 250 LYS CG CD sing N N 251 LYS CG HG2 sing N N 252 LYS CG HG3 sing N N 253 LYS CD CE sing N N 254 LYS CD HD2 sing N N 255 LYS CD HD3 sing N N 256 LYS CE NZ sing N N 257 LYS CE HE2 sing N N 258 LYS CE HE3 sing N N 259 LYS NZ HZ1 sing N N 260 LYS NZ HZ2 sing N N 261 LYS NZ HZ3 sing N N 262 LYS OXT HXT sing N N 263 MET N CA sing N N 264 MET N H sing N N 265 MET N H2 sing N N 266 MET CA C sing N N 267 MET CA CB sing N N 268 MET CA HA sing N N 269 MET C O doub N N 270 MET C OXT sing N N 271 MET CB CG sing N N 272 MET CB HB2 sing N N 273 MET CB HB3 sing N N 274 MET CG SD sing N N 275 MET CG HG2 sing N N 276 MET CG HG3 sing N N 277 MET SD CE sing N N 278 MET CE HE1 sing N N 279 MET CE HE2 sing N N 280 MET CE HE3 sing N N 281 MET OXT HXT sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 SO4 S O1 doub N N 336 SO4 S O2 doub N N 337 SO4 S O3 sing N N 338 SO4 S O4 sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' C57659/A27310 1 'Cancer Research UK' 'United Kingdom' C1362/A20263 2 'Cancer Research UK' 'United Kingdom' C2215/A21421 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3DAI _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7Z9U _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012654 _atom_sites.fract_transf_matrix[1][2] 0.007306 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014611 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007253 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 CL 17 17 11.460 0.010 7.196 1.166 6.255 18.519 1.645 47.778 -9.366 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.030 # loop_