data_7ZAV # _entry.id 7ZAV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ZAV pdb_00007zav 10.2210/pdb7zav/pdb WWPDB D_1292121810 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-02 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7ZAV _pdbx_database_status.recvd_initial_deposition_date 2022-03-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 5 _pdbx_contact_author.email elena.seiradake@bioch.ox.ac.uk _pdbx_contact_author.name_first Elena _pdbx_contact_author.name_last Seiradake _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6112-5198 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Akkermans, O.' 1 0000-0002-8436-2281 'Delloye-Bourgeois, C.' 2 ? 'Peregrina, C.' 3 ? 'Carrasquero, M.' 4 ? 'Kokolaki, M.' 5 ? 'Berbeira-Santana, M.' 6 ? 'Chavent, M.' 7 ? 'Reynaud, F.' 8 ? 'Ritu, R.' 9 ? 'Agirre, J.' 10 0000-0002-1086-0253 'Aksu, M.' 11 0000-0001-8627-7526 'White, E.' 12 ? 'Lowe, E.' 13 0000-0002-1757-0208 'Ben Amar, D.' 14 ? 'Zaballa, S.' 15 ? 'Huo, J.' 16 ? 'Pakos, I.' 17 ? 'McCubbin, P.' 18 ? 'Comoletti, D.' 19 ? 'Owens, R.' 20 ? 'Robinson, C.' 21 ? 'Castellani, V.' 22 ? 'del Toro, D.' 23 ? 'Seiradake, E.' 24 0000-0001-6112-5198 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary Cell ? ? 1097-4172 ? ? 185 ? 3931 3949.e26 'GPC3-Unc5 receptor complex structure and role in cell migration.' 2022 ? 10.1016/j.cell.2022.09.025 36240740 ? ? ? ? ? ? ? ? ? DK ? ? 1 'Acta Crystallogr., Sect. D: Biol. Crystallogr.' ABCRE6 0766 0907-4449 ? ? 68 ? 352 67 'Towards automated crystallographic structure refinement with phenix.refine.' 2012 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 'Acta Crystallogr D Struct Biol' ? ? 2059-7983 ? ? 75 ? 861 877 'Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix.' 2019 ? 10.1107/S2059798319011471 31588918 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Akkermans, O.' 1 ? primary 'Delloye-Bourgeois, C.' 2 ? primary 'Peregrina, C.' 3 ? primary 'Carrasquero-Ordaz, M.' 4 ? primary 'Kokolaki, M.' 5 ? primary 'Berbeira-Santana, M.' 6 ? primary 'Chavent, M.' 7 ? primary 'Reynaud, F.' 8 ? primary 'Raj, R.' 9 ? primary 'Agirre, J.' 10 ? primary 'Aksu, M.' 11 ? primary 'White, E.S.' 12 ? primary 'Lowe, E.' 13 ? primary 'Ben Amar, D.' 14 ? primary 'Zaballa, S.' 15 ? primary 'Huo, J.' 16 ? primary 'Pakos, I.' 17 ? primary 'McCubbin, P.T.N.' 18 ? primary 'Comoletti, D.' 19 ? primary 'Owens, R.J.' 20 ? primary 'Robinson, C.V.' 21 ? primary 'Castellani, V.' 22 ? primary 'Del Toro, D.' 23 ? primary 'Seiradake, E.' 24 ? 1 'Afonine, P.V.' 25 ? 2 'Liebschner, D.' 26 0000-0003-3921-3209 2 'Afonine, P.V.' 27 0000-0002-5052-991X 2 'Baker, M.L.' 28 ? 2 'Bunkoczi, G.' 29 ? 2 'Chen, V.B.' 30 ? 2 'Croll, T.I.' 31 ? 2 'Hintze, B.' 32 0000-0002-4871-2096 2 'Hung, L.W.' 33 0000-0001-6690-8458 2 'Jain, S.' 34 ? 2 'McCoy, A.J.' 35 ? 2 'Moriarty, N.W.' 36 0000-0001-8857-9464 2 'Oeffner, R.D.' 37 0000-0003-3107-2202 2 'Poon, B.K.' 38 0000-0001-9633-6067 2 'Prisant, M.G.' 39 ? 2 'Read, R.J.' 40 0000-0001-8273-0047 2 'Richardson, J.S.' 41 ? 2 'Richardson, D.C.' 42 ? 2 'Sammito, M.D.' 43 ? 2 'Sobolev, O.V.' 44 0000-0002-0623-3214 2 'Stockwell, D.H.' 45 ? 2 'Terwilliger, T.C.' 46 0000-0001-6384-0320 2 'Urzhumtsev, A.G.' 47 ? 2 'Videau, L.L.' 48 ? 2 'Williams, C.J.' 49 ? 2 'Adams, P.D.' 50 0000-0001-9333-8219 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Glypican-3 53323.598 1 ? ? ? ? 2 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ETGDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNA AVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQMMNPGLP ESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGL MMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTTIGKL CAHSQQRQYRSAYYPEDLFIDKKILKVAHVEHEETLSSRRRELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNGQEL VERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPKGKVGTKHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;ETGDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNA AVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQMMNPGLP ESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGL MMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTTIGKL CAHSQQRQYRSAYYPEDLFIDKKILKVAHVEHEETLSSRRRELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNGQEL VERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPKGKVGTKHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 THR n 1 3 GLY n 1 4 ASP n 1 5 ALA n 1 6 THR n 1 7 CYS n 1 8 HIS n 1 9 GLN n 1 10 VAL n 1 11 ARG n 1 12 SER n 1 13 PHE n 1 14 PHE n 1 15 GLN n 1 16 ARG n 1 17 LEU n 1 18 GLN n 1 19 PRO n 1 20 GLY n 1 21 LEU n 1 22 LYS n 1 23 TRP n 1 24 VAL n 1 25 PRO n 1 26 GLU n 1 27 THR n 1 28 PRO n 1 29 VAL n 1 30 PRO n 1 31 GLY n 1 32 SER n 1 33 ASP n 1 34 LEU n 1 35 GLN n 1 36 VAL n 1 37 CYS n 1 38 LEU n 1 39 PRO n 1 40 LYS n 1 41 GLY n 1 42 PRO n 1 43 THR n 1 44 CYS n 1 45 CYS n 1 46 SER n 1 47 ARG n 1 48 LYS n 1 49 MET n 1 50 GLU n 1 51 GLU n 1 52 LYS n 1 53 TYR n 1 54 GLN n 1 55 LEU n 1 56 THR n 1 57 ALA n 1 58 ARG n 1 59 LEU n 1 60 ASN n 1 61 MET n 1 62 GLU n 1 63 GLN n 1 64 LEU n 1 65 LEU n 1 66 GLN n 1 67 SER n 1 68 ALA n 1 69 SER n 1 70 MET n 1 71 GLU n 1 72 LEU n 1 73 LYS n 1 74 PHE n 1 75 LEU n 1 76 ILE n 1 77 ILE n 1 78 GLN n 1 79 ASN n 1 80 ALA n 1 81 ALA n 1 82 VAL n 1 83 PHE n 1 84 GLN n 1 85 GLU n 1 86 ALA n 1 87 PHE n 1 88 GLU n 1 89 ILE n 1 90 VAL n 1 91 VAL n 1 92 ARG n 1 93 HIS n 1 94 ALA n 1 95 LYS n 1 96 ASN n 1 97 TYR n 1 98 THR n 1 99 ASN n 1 100 ALA n 1 101 MET n 1 102 PHE n 1 103 LYS n 1 104 ASN n 1 105 ASN n 1 106 TYR n 1 107 PRO n 1 108 SER n 1 109 LEU n 1 110 THR n 1 111 PRO n 1 112 GLN n 1 113 ALA n 1 114 PHE n 1 115 GLU n 1 116 PHE n 1 117 VAL n 1 118 GLY n 1 119 GLU n 1 120 PHE n 1 121 PHE n 1 122 THR n 1 123 ASP n 1 124 VAL n 1 125 SER n 1 126 LEU n 1 127 TYR n 1 128 ILE n 1 129 LEU n 1 130 GLY n 1 131 SER n 1 132 ASP n 1 133 ILE n 1 134 ASN n 1 135 VAL n 1 136 ASP n 1 137 ASP n 1 138 MET n 1 139 VAL n 1 140 ASN n 1 141 GLU n 1 142 LEU n 1 143 PHE n 1 144 ASP n 1 145 SER n 1 146 LEU n 1 147 PHE n 1 148 PRO n 1 149 VAL n 1 150 ILE n 1 151 TYR n 1 152 THR n 1 153 GLN n 1 154 MET n 1 155 MET n 1 156 ASN n 1 157 PRO n 1 158 GLY n 1 159 LEU n 1 160 PRO n 1 161 GLU n 1 162 SER n 1 163 VAL n 1 164 LEU n 1 165 ASP n 1 166 ILE n 1 167 ASN n 1 168 GLU n 1 169 CYS n 1 170 LEU n 1 171 ARG n 1 172 GLY n 1 173 ALA n 1 174 ARG n 1 175 ARG n 1 176 ASP n 1 177 LEU n 1 178 LYS n 1 179 VAL n 1 180 PHE n 1 181 GLY n 1 182 SER n 1 183 PHE n 1 184 PRO n 1 185 LYS n 1 186 LEU n 1 187 ILE n 1 188 MET n 1 189 THR n 1 190 GLN n 1 191 VAL n 1 192 SER n 1 193 LYS n 1 194 SER n 1 195 LEU n 1 196 GLN n 1 197 VAL n 1 198 THR n 1 199 ARG n 1 200 ILE n 1 201 PHE n 1 202 LEU n 1 203 GLN n 1 204 ALA n 1 205 LEU n 1 206 ASN n 1 207 LEU n 1 208 GLY n 1 209 ILE n 1 210 GLU n 1 211 VAL n 1 212 ILE n 1 213 ASN n 1 214 THR n 1 215 THR n 1 216 ASP n 1 217 HIS n 1 218 LEU n 1 219 LYS n 1 220 PHE n 1 221 SER n 1 222 LYS n 1 223 ASP n 1 224 CYS n 1 225 GLY n 1 226 ARG n 1 227 MET n 1 228 LEU n 1 229 THR n 1 230 ARG n 1 231 MET n 1 232 TRP n 1 233 TYR n 1 234 CYS n 1 235 SER n 1 236 TYR n 1 237 CYS n 1 238 GLN n 1 239 GLY n 1 240 LEU n 1 241 MET n 1 242 MET n 1 243 VAL n 1 244 LYS n 1 245 PRO n 1 246 CYS n 1 247 GLY n 1 248 GLY n 1 249 TYR n 1 250 CYS n 1 251 ASN n 1 252 VAL n 1 253 VAL n 1 254 MET n 1 255 GLN n 1 256 GLY n 1 257 CYS n 1 258 MET n 1 259 ALA n 1 260 GLY n 1 261 VAL n 1 262 VAL n 1 263 GLU n 1 264 ILE n 1 265 ASP n 1 266 LYS n 1 267 TYR n 1 268 TRP n 1 269 ARG n 1 270 GLU n 1 271 TYR n 1 272 ILE n 1 273 LEU n 1 274 SER n 1 275 LEU n 1 276 GLU n 1 277 GLU n 1 278 LEU n 1 279 VAL n 1 280 ASN n 1 281 GLY n 1 282 MET n 1 283 TYR n 1 284 ARG n 1 285 ILE n 1 286 TYR n 1 287 ASP n 1 288 MET n 1 289 GLU n 1 290 ASN n 1 291 VAL n 1 292 LEU n 1 293 LEU n 1 294 GLY n 1 295 LEU n 1 296 PHE n 1 297 SER n 1 298 THR n 1 299 ILE n 1 300 HIS n 1 301 ASP n 1 302 SER n 1 303 ILE n 1 304 GLN n 1 305 TYR n 1 306 VAL n 1 307 GLN n 1 308 LYS n 1 309 ASN n 1 310 GLY n 1 311 GLY n 1 312 LYS n 1 313 LEU n 1 314 THR n 1 315 THR n 1 316 THR n 1 317 ILE n 1 318 GLY n 1 319 LYS n 1 320 LEU n 1 321 CYS n 1 322 ALA n 1 323 HIS n 1 324 SER n 1 325 GLN n 1 326 GLN n 1 327 ARG n 1 328 GLN n 1 329 TYR n 1 330 ARG n 1 331 SER n 1 332 ALA n 1 333 TYR n 1 334 TYR n 1 335 PRO n 1 336 GLU n 1 337 ASP n 1 338 LEU n 1 339 PHE n 1 340 ILE n 1 341 ASP n 1 342 LYS n 1 343 LYS n 1 344 ILE n 1 345 LEU n 1 346 LYS n 1 347 VAL n 1 348 ALA n 1 349 HIS n 1 350 VAL n 1 351 GLU n 1 352 HIS n 1 353 GLU n 1 354 GLU n 1 355 THR n 1 356 LEU n 1 357 SER n 1 358 SER n 1 359 ARG n 1 360 ARG n 1 361 ARG n 1 362 GLU n 1 363 LEU n 1 364 ILE n 1 365 GLN n 1 366 LYS n 1 367 LEU n 1 368 LYS n 1 369 SER n 1 370 PHE n 1 371 ILE n 1 372 ASN n 1 373 PHE n 1 374 TYR n 1 375 SER n 1 376 ALA n 1 377 LEU n 1 378 PRO n 1 379 GLY n 1 380 TYR n 1 381 ILE n 1 382 CYS n 1 383 SER n 1 384 HIS n 1 385 SER n 1 386 PRO n 1 387 VAL n 1 388 ALA n 1 389 GLU n 1 390 ASN n 1 391 ASP n 1 392 THR n 1 393 LEU n 1 394 CYS n 1 395 TRP n 1 396 ASN n 1 397 GLY n 1 398 GLN n 1 399 GLU n 1 400 LEU n 1 401 VAL n 1 402 GLU n 1 403 ARG n 1 404 TYR n 1 405 SER n 1 406 GLN n 1 407 LYS n 1 408 ALA n 1 409 ALA n 1 410 ARG n 1 411 ASN n 1 412 GLY n 1 413 MET n 1 414 LYS n 1 415 ASN n 1 416 GLN n 1 417 PHE n 1 418 ASN n 1 419 LEU n 1 420 HIS n 1 421 GLU n 1 422 LEU n 1 423 LYS n 1 424 MET n 1 425 LYS n 1 426 GLY n 1 427 PRO n 1 428 GLU n 1 429 PRO n 1 430 VAL n 1 431 VAL n 1 432 SER n 1 433 GLN n 1 434 ILE n 1 435 ILE n 1 436 ASP n 1 437 LYS n 1 438 LEU n 1 439 LYS n 1 440 HIS n 1 441 ILE n 1 442 ASN n 1 443 GLN n 1 444 LEU n 1 445 LEU n 1 446 ARG n 1 447 THR n 1 448 MET n 1 449 SER n 1 450 VAL n 1 451 PRO n 1 452 LYS n 1 453 GLY n 1 454 LYS n 1 455 VAL n 1 456 GLY n 1 457 THR n 1 458 LYS n 1 459 HIS n 1 460 HIS n 1 461 HIS n 1 462 HIS n 1 463 HIS n 1 464 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 464 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Gpc3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'HEK293S GnTi-' _entity_src_gen.pdbx_host_org_atcc crl-3022 _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 28 ? ? ? A . n A 1 2 THR 2 29 ? ? ? A . n A 1 3 GLY 3 30 ? ? ? A . n A 1 4 ASP 4 31 ? ? ? A . n A 1 5 ALA 5 32 ? ? ? A . n A 1 6 THR 6 33 ? ? ? A . n A 1 7 CYS 7 34 ? ? ? A . n A 1 8 HIS 8 35 ? ? ? A . n A 1 9 GLN 9 36 ? ? ? A . n A 1 10 VAL 10 37 ? ? ? A . n A 1 11 ARG 11 38 ? ? ? A . n A 1 12 SER 12 39 ? ? ? A . n A 1 13 PHE 13 40 ? ? ? A . n A 1 14 PHE 14 41 ? ? ? A . n A 1 15 GLN 15 42 ? ? ? A . n A 1 16 ARG 16 43 ? ? ? A . n A 1 17 LEU 17 44 ? ? ? A . n A 1 18 GLN 18 45 ? ? ? A . n A 1 19 PRO 19 46 ? ? ? A . n A 1 20 GLY 20 47 ? ? ? A . n A 1 21 LEU 21 48 ? ? ? A . n A 1 22 LYS 22 49 ? ? ? A . n A 1 23 TRP 23 50 ? ? ? A . n A 1 24 VAL 24 51 ? ? ? A . n A 1 25 PRO 25 52 ? ? ? A . n A 1 26 GLU 26 53 ? ? ? A . n A 1 27 THR 27 54 ? ? ? A . n A 1 28 PRO 28 55 ? ? ? A . n A 1 29 VAL 29 56 ? ? ? A . n A 1 30 PRO 30 57 ? ? ? A . n A 1 31 GLY 31 58 ? ? ? A . n A 1 32 SER 32 59 59 SER SER A . n A 1 33 ASP 33 60 60 ASP ASP A . n A 1 34 LEU 34 61 61 LEU LEU A . n A 1 35 GLN 35 62 62 GLN GLN A . n A 1 36 VAL 36 63 63 VAL VAL A . n A 1 37 CYS 37 64 64 CYS CYS A . n A 1 38 LEU 38 65 65 LEU LEU A . n A 1 39 PRO 39 66 66 PRO PRO A . n A 1 40 LYS 40 67 67 LYS LYS A . n A 1 41 GLY 41 68 68 GLY GLY A . n A 1 42 PRO 42 69 69 PRO PRO A . n A 1 43 THR 43 70 70 THR THR A . n A 1 44 CYS 44 71 71 CYS CYS A . n A 1 45 CYS 45 72 72 CYS CYS A . n A 1 46 SER 46 73 73 SER SER A . n A 1 47 ARG 47 74 74 ARG ARG A . n A 1 48 LYS 48 75 75 LYS LYS A . n A 1 49 MET 49 76 76 MET MET A . n A 1 50 GLU 50 77 77 GLU GLU A . n A 1 51 GLU 51 78 78 GLU GLU A . n A 1 52 LYS 52 79 79 LYS LYS A . n A 1 53 TYR 53 80 80 TYR TYR A . n A 1 54 GLN 54 81 81 GLN GLN A . n A 1 55 LEU 55 82 82 LEU LEU A . n A 1 56 THR 56 83 83 THR THR A . n A 1 57 ALA 57 84 84 ALA ALA A . n A 1 58 ARG 58 85 85 ARG ARG A . n A 1 59 LEU 59 86 86 LEU LEU A . n A 1 60 ASN 60 87 87 ASN ASN A . n A 1 61 MET 61 88 88 MET MET A . n A 1 62 GLU 62 89 89 GLU GLU A . n A 1 63 GLN 63 90 90 GLN GLN A . n A 1 64 LEU 64 91 91 LEU LEU A . n A 1 65 LEU 65 92 92 LEU LEU A . n A 1 66 GLN 66 93 93 GLN GLN A . n A 1 67 SER 67 94 94 SER SER A . n A 1 68 ALA 68 95 95 ALA ALA A . n A 1 69 SER 69 96 96 SER SER A . n A 1 70 MET 70 97 97 MET MET A . n A 1 71 GLU 71 98 98 GLU GLU A . n A 1 72 LEU 72 99 99 LEU LEU A . n A 1 73 LYS 73 100 100 LYS LYS A . n A 1 74 PHE 74 101 101 PHE PHE A . n A 1 75 LEU 75 102 102 LEU LEU A . n A 1 76 ILE 76 103 103 ILE ILE A . n A 1 77 ILE 77 104 104 ILE ILE A . n A 1 78 GLN 78 105 105 GLN GLN A . n A 1 79 ASN 79 106 106 ASN ASN A . n A 1 80 ALA 80 107 107 ALA ALA A . n A 1 81 ALA 81 108 108 ALA ALA A . n A 1 82 VAL 82 109 109 VAL VAL A . n A 1 83 PHE 83 110 110 PHE PHE A . n A 1 84 GLN 84 111 111 GLN GLN A . n A 1 85 GLU 85 112 112 GLU GLU A . n A 1 86 ALA 86 113 113 ALA ALA A . n A 1 87 PHE 87 114 114 PHE PHE A . n A 1 88 GLU 88 115 115 GLU GLU A . n A 1 89 ILE 89 116 116 ILE ILE A . n A 1 90 VAL 90 117 117 VAL VAL A . n A 1 91 VAL 91 118 118 VAL VAL A . n A 1 92 ARG 92 119 119 ARG ARG A . n A 1 93 HIS 93 120 120 HIS HIS A . n A 1 94 ALA 94 121 121 ALA ALA A . n A 1 95 LYS 95 122 122 LYS LYS A . n A 1 96 ASN 96 123 123 ASN ASN A . n A 1 97 TYR 97 124 124 TYR TYR A . n A 1 98 THR 98 125 125 THR THR A . n A 1 99 ASN 99 126 126 ASN ASN A . n A 1 100 ALA 100 127 127 ALA ALA A . n A 1 101 MET 101 128 128 MET MET A . n A 1 102 PHE 102 129 129 PHE PHE A . n A 1 103 LYS 103 130 130 LYS LYS A . n A 1 104 ASN 104 131 131 ASN ASN A . n A 1 105 ASN 105 132 132 ASN ASN A . n A 1 106 TYR 106 133 133 TYR TYR A . n A 1 107 PRO 107 134 134 PRO PRO A . n A 1 108 SER 108 135 135 SER SER A . n A 1 109 LEU 109 136 136 LEU LEU A . n A 1 110 THR 110 137 137 THR THR A . n A 1 111 PRO 111 138 138 PRO PRO A . n A 1 112 GLN 112 139 139 GLN GLN A . n A 1 113 ALA 113 140 140 ALA ALA A . n A 1 114 PHE 114 141 141 PHE PHE A . n A 1 115 GLU 115 142 142 GLU GLU A . n A 1 116 PHE 116 143 143 PHE PHE A . n A 1 117 VAL 117 144 144 VAL VAL A . n A 1 118 GLY 118 145 145 GLY GLY A . n A 1 119 GLU 119 146 146 GLU GLU A . n A 1 120 PHE 120 147 147 PHE PHE A . n A 1 121 PHE 121 148 148 PHE PHE A . n A 1 122 THR 122 149 149 THR THR A . n A 1 123 ASP 123 150 150 ASP ASP A . n A 1 124 VAL 124 151 151 VAL VAL A . n A 1 125 SER 125 152 152 SER SER A . n A 1 126 LEU 126 153 153 LEU LEU A . n A 1 127 TYR 127 154 154 TYR TYR A . n A 1 128 ILE 128 155 155 ILE ILE A . n A 1 129 LEU 129 156 156 LEU LEU A . n A 1 130 GLY 130 157 157 GLY GLY A . n A 1 131 SER 131 158 158 SER SER A . n A 1 132 ASP 132 159 159 ASP ASP A . n A 1 133 ILE 133 160 160 ILE ILE A . n A 1 134 ASN 134 161 161 ASN ASN A . n A 1 135 VAL 135 162 162 VAL VAL A . n A 1 136 ASP 136 163 163 ASP ASP A . n A 1 137 ASP 137 164 164 ASP ASP A . n A 1 138 MET 138 165 165 MET MET A . n A 1 139 VAL 139 166 166 VAL VAL A . n A 1 140 ASN 140 167 167 ASN ASN A . n A 1 141 GLU 141 168 168 GLU GLU A . n A 1 142 LEU 142 169 169 LEU LEU A . n A 1 143 PHE 143 170 170 PHE PHE A . n A 1 144 ASP 144 171 171 ASP ASP A . n A 1 145 SER 145 172 172 SER SER A . n A 1 146 LEU 146 173 173 LEU LEU A . n A 1 147 PHE 147 174 174 PHE PHE A . n A 1 148 PRO 148 175 175 PRO PRO A . n A 1 149 VAL 149 176 176 VAL VAL A . n A 1 150 ILE 150 177 177 ILE ILE A . n A 1 151 TYR 151 178 178 TYR TYR A . n A 1 152 THR 152 179 179 THR THR A . n A 1 153 GLN 153 180 180 GLN GLN A . n A 1 154 MET 154 181 181 MET MET A . n A 1 155 MET 155 182 182 MET MET A . n A 1 156 ASN 156 183 183 ASN ASN A . n A 1 157 PRO 157 184 184 PRO PRO A . n A 1 158 GLY 158 185 185 GLY GLY A . n A 1 159 LEU 159 186 ? ? ? A . n A 1 160 PRO 160 187 ? ? ? A . n A 1 161 GLU 161 188 ? ? ? A . n A 1 162 SER 162 189 ? ? ? A . n A 1 163 VAL 163 190 ? ? ? A . n A 1 164 LEU 164 191 191 LEU LEU A . n A 1 165 ASP 165 192 192 ASP ASP A . n A 1 166 ILE 166 193 193 ILE ILE A . n A 1 167 ASN 167 194 194 ASN ASN A . n A 1 168 GLU 168 195 195 GLU GLU A . n A 1 169 CYS 169 196 196 CYS CYS A . n A 1 170 LEU 170 197 197 LEU LEU A . n A 1 171 ARG 171 198 198 ARG ARG A . n A 1 172 GLY 172 199 199 GLY GLY A . n A 1 173 ALA 173 200 200 ALA ALA A . n A 1 174 ARG 174 201 201 ARG ARG A . n A 1 175 ARG 175 202 202 ARG ARG A . n A 1 176 ASP 176 203 203 ASP ASP A . n A 1 177 LEU 177 204 204 LEU LEU A . n A 1 178 LYS 178 205 205 LYS LYS A . n A 1 179 VAL 179 206 206 VAL VAL A . n A 1 180 PHE 180 207 207 PHE PHE A . n A 1 181 GLY 181 208 208 GLY GLY A . n A 1 182 SER 182 209 209 SER SER A . n A 1 183 PHE 183 210 210 PHE PHE A . n A 1 184 PRO 184 211 211 PRO PRO A . n A 1 185 LYS 185 212 212 LYS LYS A . n A 1 186 LEU 186 213 213 LEU LEU A . n A 1 187 ILE 187 214 214 ILE ILE A . n A 1 188 MET 188 215 215 MET MET A . n A 1 189 THR 189 216 216 THR THR A . n A 1 190 GLN 190 217 217 GLN GLN A . n A 1 191 VAL 191 218 218 VAL VAL A . n A 1 192 SER 192 219 219 SER SER A . n A 1 193 LYS 193 220 220 LYS LYS A . n A 1 194 SER 194 221 221 SER SER A . n A 1 195 LEU 195 222 222 LEU LEU A . n A 1 196 GLN 196 223 223 GLN GLN A . n A 1 197 VAL 197 224 224 VAL VAL A . n A 1 198 THR 198 225 225 THR THR A . n A 1 199 ARG 199 226 226 ARG ARG A . n A 1 200 ILE 200 227 227 ILE ILE A . n A 1 201 PHE 201 228 228 PHE PHE A . n A 1 202 LEU 202 229 229 LEU LEU A . n A 1 203 GLN 203 230 230 GLN GLN A . n A 1 204 ALA 204 231 231 ALA ALA A . n A 1 205 LEU 205 232 232 LEU LEU A . n A 1 206 ASN 206 233 233 ASN ASN A . n A 1 207 LEU 207 234 234 LEU LEU A . n A 1 208 GLY 208 235 235 GLY GLY A . n A 1 209 ILE 209 236 236 ILE ILE A . n A 1 210 GLU 210 237 237 GLU GLU A . n A 1 211 VAL 211 238 238 VAL VAL A . n A 1 212 ILE 212 239 239 ILE ILE A . n A 1 213 ASN 213 240 240 ASN ASN A . n A 1 214 THR 214 241 241 THR THR A . n A 1 215 THR 215 242 242 THR THR A . n A 1 216 ASP 216 243 243 ASP ASP A . n A 1 217 HIS 217 244 244 HIS HIS A . n A 1 218 LEU 218 245 245 LEU LEU A . n A 1 219 LYS 219 246 246 LYS LYS A . n A 1 220 PHE 220 247 247 PHE PHE A . n A 1 221 SER 221 248 248 SER SER A . n A 1 222 LYS 222 249 249 LYS LYS A . n A 1 223 ASP 223 250 250 ASP ASP A . n A 1 224 CYS 224 251 251 CYS CYS A . n A 1 225 GLY 225 252 252 GLY GLY A . n A 1 226 ARG 226 253 253 ARG ARG A . n A 1 227 MET 227 254 254 MET MET A . n A 1 228 LEU 228 255 255 LEU LEU A . n A 1 229 THR 229 256 256 THR THR A . n A 1 230 ARG 230 257 257 ARG ARG A . n A 1 231 MET 231 258 258 MET MET A . n A 1 232 TRP 232 259 259 TRP TRP A . n A 1 233 TYR 233 260 260 TYR TYR A . n A 1 234 CYS 234 261 261 CYS CYS A . n A 1 235 SER 235 262 262 SER SER A . n A 1 236 TYR 236 263 263 TYR TYR A . n A 1 237 CYS 237 264 264 CYS CYS A . n A 1 238 GLN 238 265 265 GLN GLN A . n A 1 239 GLY 239 266 266 GLY GLY A . n A 1 240 LEU 240 267 267 LEU LEU A . n A 1 241 MET 241 268 268 MET MET A . n A 1 242 MET 242 269 269 MET MET A . n A 1 243 VAL 243 270 270 VAL VAL A . n A 1 244 LYS 244 271 271 LYS LYS A . n A 1 245 PRO 245 272 272 PRO PRO A . n A 1 246 CYS 246 273 273 CYS CYS A . n A 1 247 GLY 247 274 274 GLY GLY A . n A 1 248 GLY 248 275 275 GLY GLY A . n A 1 249 TYR 249 276 276 TYR TYR A . n A 1 250 CYS 250 277 277 CYS CYS A . n A 1 251 ASN 251 278 278 ASN ASN A . n A 1 252 VAL 252 279 279 VAL VAL A . n A 1 253 VAL 253 280 280 VAL VAL A . n A 1 254 MET 254 281 281 MET MET A . n A 1 255 GLN 255 282 282 GLN GLN A . n A 1 256 GLY 256 283 283 GLY GLY A . n A 1 257 CYS 257 284 284 CYS CYS A . n A 1 258 MET 258 285 285 MET MET A . n A 1 259 ALA 259 286 286 ALA ALA A . n A 1 260 GLY 260 287 287 GLY GLY A . n A 1 261 VAL 261 288 288 VAL VAL A . n A 1 262 VAL 262 289 289 VAL VAL A . n A 1 263 GLU 263 290 290 GLU GLU A . n A 1 264 ILE 264 291 291 ILE ILE A . n A 1 265 ASP 265 292 292 ASP ASP A . n A 1 266 LYS 266 293 293 LYS LYS A . n A 1 267 TYR 267 294 294 TYR TYR A . n A 1 268 TRP 268 295 295 TRP TRP A . n A 1 269 ARG 269 296 296 ARG ARG A . n A 1 270 GLU 270 297 297 GLU GLU A . n A 1 271 TYR 271 298 298 TYR TYR A . n A 1 272 ILE 272 299 299 ILE ILE A . n A 1 273 LEU 273 300 300 LEU LEU A . n A 1 274 SER 274 301 301 SER SER A . n A 1 275 LEU 275 302 302 LEU LEU A . n A 1 276 GLU 276 303 303 GLU GLU A . n A 1 277 GLU 277 304 304 GLU GLU A . n A 1 278 LEU 278 305 305 LEU LEU A . n A 1 279 VAL 279 306 306 VAL VAL A . n A 1 280 ASN 280 307 307 ASN ASN A . n A 1 281 GLY 281 308 ? ? ? A . n A 1 282 MET 282 309 ? ? ? A . n A 1 283 TYR 283 310 ? ? ? A . n A 1 284 ARG 284 311 ? ? ? A . n A 1 285 ILE 285 312 ? ? ? A . n A 1 286 TYR 286 313 ? ? ? A . n A 1 287 ASP 287 314 314 ASP ASP A . n A 1 288 MET 288 315 315 MET MET A . n A 1 289 GLU 289 316 316 GLU GLU A . n A 1 290 ASN 290 317 317 ASN ASN A . n A 1 291 VAL 291 318 318 VAL VAL A . n A 1 292 LEU 292 319 319 LEU LEU A . n A 1 293 LEU 293 320 320 LEU LEU A . n A 1 294 GLY 294 321 321 GLY GLY A . n A 1 295 LEU 295 322 322 LEU LEU A . n A 1 296 PHE 296 323 323 PHE PHE A . n A 1 297 SER 297 324 324 SER SER A . n A 1 298 THR 298 325 325 THR THR A . n A 1 299 ILE 299 326 326 ILE ILE A . n A 1 300 HIS 300 327 327 HIS HIS A . n A 1 301 ASP 301 328 328 ASP ASP A . n A 1 302 SER 302 329 329 SER SER A . n A 1 303 ILE 303 330 330 ILE ILE A . n A 1 304 GLN 304 331 331 GLN GLN A . n A 1 305 TYR 305 332 332 TYR TYR A . n A 1 306 VAL 306 333 333 VAL VAL A . n A 1 307 GLN 307 334 334 GLN GLN A . n A 1 308 LYS 308 335 335 LYS LYS A . n A 1 309 ASN 309 336 336 ASN ASN A . n A 1 310 GLY 310 337 337 GLY GLY A . n A 1 311 GLY 311 338 338 GLY GLY A . n A 1 312 LYS 312 339 339 LYS LYS A . n A 1 313 LEU 313 340 340 LEU LEU A . n A 1 314 THR 314 341 341 THR THR A . n A 1 315 THR 315 342 342 THR THR A . n A 1 316 THR 316 343 343 THR THR A . n A 1 317 ILE 317 344 344 ILE ILE A . n A 1 318 GLY 318 345 345 GLY GLY A . n A 1 319 LYS 319 346 346 LYS LYS A . n A 1 320 LEU 320 347 347 LEU LEU A . n A 1 321 CYS 321 348 348 CYS CYS A . n A 1 322 ALA 322 349 ? ? ? A . n A 1 323 HIS 323 350 ? ? ? A . n A 1 324 SER 324 351 ? ? ? A . n A 1 325 GLN 325 352 ? ? ? A . n A 1 326 GLN 326 353 ? ? ? A . n A 1 327 ARG 327 354 ? ? ? A . n A 1 328 GLN 328 355 ? ? ? A . n A 1 329 TYR 329 356 ? ? ? A . n A 1 330 ARG 330 357 ? ? ? A . n A 1 331 SER 331 358 ? ? ? A . n A 1 332 ALA 332 359 ? ? ? A . n A 1 333 TYR 333 360 ? ? ? A . n A 1 334 TYR 334 361 ? ? ? A . n A 1 335 PRO 335 362 ? ? ? A . n A 1 336 GLU 336 363 ? ? ? A . n A 1 337 ASP 337 364 ? ? ? A . n A 1 338 LEU 338 365 ? ? ? A . n A 1 339 PHE 339 366 ? ? ? A . n A 1 340 ILE 340 367 ? ? ? A . n A 1 341 ASP 341 368 ? ? ? A . n A 1 342 LYS 342 369 ? ? ? A . n A 1 343 LYS 343 370 ? ? ? A . n A 1 344 ILE 344 371 ? ? ? A . n A 1 345 LEU 345 372 ? ? ? A . n A 1 346 LYS 346 373 ? ? ? A . n A 1 347 VAL 347 374 ? ? ? A . n A 1 348 ALA 348 375 ? ? ? A . n A 1 349 HIS 349 376 ? ? ? A . n A 1 350 VAL 350 377 ? ? ? A . n A 1 351 GLU 351 378 ? ? ? A . n A 1 352 HIS 352 379 ? ? ? A . n A 1 353 GLU 353 380 ? ? ? A . n A 1 354 GLU 354 381 ? ? ? A . n A 1 355 THR 355 382 382 THR THR A . n A 1 356 LEU 356 383 383 LEU LEU A . n A 1 357 SER 357 384 384 SER SER A . n A 1 358 SER 358 385 385 SER SER A . n A 1 359 ARG 359 386 386 ARG ARG A . n A 1 360 ARG 360 387 387 ARG ARG A . n A 1 361 ARG 361 388 388 ARG ARG A . n A 1 362 GLU 362 389 389 GLU GLU A . n A 1 363 LEU 363 390 390 LEU LEU A . n A 1 364 ILE 364 391 391 ILE ILE A . n A 1 365 GLN 365 392 392 GLN GLN A . n A 1 366 LYS 366 393 393 LYS LYS A . n A 1 367 LEU 367 394 394 LEU LEU A . n A 1 368 LYS 368 395 395 LYS LYS A . n A 1 369 SER 369 396 396 SER SER A . n A 1 370 PHE 370 397 397 PHE PHE A . n A 1 371 ILE 371 398 398 ILE ILE A . n A 1 372 ASN 372 399 399 ASN ASN A . n A 1 373 PHE 373 400 400 PHE PHE A . n A 1 374 TYR 374 401 401 TYR TYR A . n A 1 375 SER 375 402 402 SER SER A . n A 1 376 ALA 376 403 403 ALA ALA A . n A 1 377 LEU 377 404 404 LEU LEU A . n A 1 378 PRO 378 405 405 PRO PRO A . n A 1 379 GLY 379 406 406 GLY GLY A . n A 1 380 TYR 380 407 407 TYR TYR A . n A 1 381 ILE 381 408 408 ILE ILE A . n A 1 382 CYS 382 409 409 CYS CYS A . n A 1 383 SER 383 410 410 SER SER A . n A 1 384 HIS 384 411 411 HIS HIS A . n A 1 385 SER 385 412 412 SER SER A . n A 1 386 PRO 386 413 413 PRO PRO A . n A 1 387 VAL 387 414 414 VAL VAL A . n A 1 388 ALA 388 415 415 ALA ALA A . n A 1 389 GLU 389 416 416 GLU GLU A . n A 1 390 ASN 390 417 417 ASN ASN A . n A 1 391 ASP 391 418 418 ASP ASP A . n A 1 392 THR 392 419 419 THR THR A . n A 1 393 LEU 393 420 420 LEU LEU A . n A 1 394 CYS 394 421 421 CYS CYS A . n A 1 395 TRP 395 422 422 TRP TRP A . n A 1 396 ASN 396 423 423 ASN ASN A . n A 1 397 GLY 397 424 424 GLY GLY A . n A 1 398 GLN 398 425 425 GLN GLN A . n A 1 399 GLU 399 426 426 GLU GLU A . n A 1 400 LEU 400 427 427 LEU LEU A . n A 1 401 VAL 401 428 428 VAL VAL A . n A 1 402 GLU 402 429 429 GLU GLU A . n A 1 403 ARG 403 430 430 ARG ARG A . n A 1 404 TYR 404 431 431 TYR TYR A . n A 1 405 SER 405 432 432 SER SER A . n A 1 406 GLN 406 433 433 GLN GLN A . n A 1 407 LYS 407 434 ? ? ? A . n A 1 408 ALA 408 435 ? ? ? A . n A 1 409 ALA 409 436 ? ? ? A . n A 1 410 ARG 410 437 ? ? ? A . n A 1 411 ASN 411 438 ? ? ? A . n A 1 412 GLY 412 439 ? ? ? A . n A 1 413 MET 413 440 ? ? ? A . n A 1 414 LYS 414 441 ? ? ? A . n A 1 415 ASN 415 442 ? ? ? A . n A 1 416 GLN 416 443 ? ? ? A . n A 1 417 PHE 417 444 ? ? ? A . n A 1 418 ASN 418 445 ? ? ? A . n A 1 419 LEU 419 446 ? ? ? A . n A 1 420 HIS 420 447 ? ? ? A . n A 1 421 GLU 421 448 ? ? ? A . n A 1 422 LEU 422 449 ? ? ? A . n A 1 423 LYS 423 450 ? ? ? A . n A 1 424 MET 424 451 ? ? ? A . n A 1 425 LYS 425 452 ? ? ? A . n A 1 426 GLY 426 453 ? ? ? A . n A 1 427 PRO 427 454 ? ? ? A . n A 1 428 GLU 428 455 455 GLU GLU A . n A 1 429 PRO 429 456 456 PRO PRO A . n A 1 430 VAL 430 457 457 VAL VAL A . n A 1 431 VAL 431 458 458 VAL VAL A . n A 1 432 SER 432 459 459 SER SER A . n A 1 433 GLN 433 460 460 GLN GLN A . n A 1 434 ILE 434 461 461 ILE ILE A . n A 1 435 ILE 435 462 462 ILE ILE A . n A 1 436 ASP 436 463 463 ASP ASP A . n A 1 437 LYS 437 464 464 LYS LYS A . n A 1 438 LEU 438 465 465 LEU LEU A . n A 1 439 LYS 439 466 466 LYS LYS A . n A 1 440 HIS 440 467 467 HIS HIS A . n A 1 441 ILE 441 468 468 ILE ILE A . n A 1 442 ASN 442 469 469 ASN ASN A . n A 1 443 GLN 443 470 470 GLN GLN A . n A 1 444 LEU 444 471 471 LEU LEU A . n A 1 445 LEU 445 472 472 LEU LEU A . n A 1 446 ARG 446 473 473 ARG ARG A . n A 1 447 THR 447 474 474 THR THR A . n A 1 448 MET 448 475 475 MET MET A . n A 1 449 SER 449 476 476 SER SER A . n A 1 450 VAL 450 477 ? ? ? A . n A 1 451 PRO 451 478 ? ? ? A . n A 1 452 LYS 452 479 ? ? ? A . n A 1 453 GLY 453 480 ? ? ? A . n A 1 454 LYS 454 481 ? ? ? A . n A 1 455 VAL 455 482 ? ? ? A . n A 1 456 GLY 456 483 ? ? ? A . n A 1 457 THR 457 484 ? ? ? A . n A 1 458 LYS 458 485 ? ? ? A . n A 1 459 HIS 459 486 ? ? ? A . n A 1 460 HIS 460 487 ? ? ? A . n A 1 461 HIS 461 488 ? ? ? A . n A 1 462 HIS 462 489 ? ? ? A . n A 1 463 HIS 463 490 ? ? ? A . n A 1 464 HIS 464 491 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 1000 1000 NAG NAG A . C 2 NAG 1 1001 1001 NAG NAG A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 59 ? OG ? A SER 32 OG 2 1 Y 1 A ASP 60 ? CG ? A ASP 33 CG 3 1 Y 1 A ASP 60 ? OD1 ? A ASP 33 OD1 4 1 Y 1 A ASP 60 ? OD2 ? A ASP 33 OD2 5 1 Y 1 A LYS 67 ? CG ? A LYS 40 CG 6 1 Y 1 A LYS 67 ? CD ? A LYS 40 CD 7 1 Y 1 A LYS 67 ? CE ? A LYS 40 CE 8 1 Y 1 A LYS 67 ? NZ ? A LYS 40 NZ 9 1 Y 1 A LYS 75 ? CG ? A LYS 48 CG 10 1 Y 1 A LYS 75 ? CD ? A LYS 48 CD 11 1 Y 1 A LYS 75 ? CE ? A LYS 48 CE 12 1 Y 1 A LYS 75 ? NZ ? A LYS 48 NZ 13 1 Y 1 A LYS 79 ? CG ? A LYS 52 CG 14 1 Y 1 A LYS 79 ? CD ? A LYS 52 CD 15 1 Y 1 A LYS 79 ? CE ? A LYS 52 CE 16 1 Y 1 A LYS 79 ? NZ ? A LYS 52 NZ 17 1 Y 1 A LEU 191 ? CG ? A LEU 164 CG 18 1 Y 1 A LEU 191 ? CD1 ? A LEU 164 CD1 19 1 Y 1 A LEU 191 ? CD2 ? A LEU 164 CD2 20 1 Y 1 A ASP 192 ? CG ? A ASP 165 CG 21 1 Y 1 A ASP 192 ? OD1 ? A ASP 165 OD1 22 1 Y 1 A ASP 192 ? OD2 ? A ASP 165 OD2 23 1 Y 1 A LYS 249 ? CG ? A LYS 222 CG 24 1 Y 1 A LYS 249 ? CD ? A LYS 222 CD 25 1 Y 1 A LYS 249 ? CE ? A LYS 222 CE 26 1 Y 1 A LYS 249 ? NZ ? A LYS 222 NZ 27 1 Y 1 A GLU 290 ? CG ? A GLU 263 CG 28 1 Y 1 A GLU 290 ? CD ? A GLU 263 CD 29 1 Y 1 A GLU 290 ? OE1 ? A GLU 263 OE1 30 1 Y 1 A GLU 290 ? OE2 ? A GLU 263 OE2 31 1 Y 1 A LYS 339 ? CG ? A LYS 312 CG 32 1 Y 1 A LYS 339 ? CD ? A LYS 312 CD 33 1 Y 1 A LYS 339 ? CE ? A LYS 312 CE 34 1 Y 1 A LYS 339 ? NZ ? A LYS 312 NZ 35 1 Y 1 A LYS 346 ? CG ? A LYS 319 CG 36 1 Y 1 A LYS 346 ? CD ? A LYS 319 CD 37 1 Y 1 A LYS 346 ? CE ? A LYS 319 CE 38 1 Y 1 A LYS 346 ? NZ ? A LYS 319 NZ 39 1 Y 1 A ARG 386 ? CG ? A ARG 359 CG 40 1 Y 1 A ARG 386 ? CD ? A ARG 359 CD 41 1 Y 1 A ARG 386 ? NE ? A ARG 359 NE 42 1 Y 1 A ARG 386 ? CZ ? A ARG 359 CZ 43 1 Y 1 A ARG 386 ? NH1 ? A ARG 359 NH1 44 1 Y 1 A ARG 386 ? NH2 ? A ARG 359 NH2 45 1 Y 1 A ARG 430 ? CG ? A ARG 403 CG 46 1 Y 1 A ARG 430 ? CD ? A ARG 403 CD 47 1 Y 1 A ARG 430 ? NE ? A ARG 403 NE 48 1 Y 1 A ARG 430 ? CZ ? A ARG 403 CZ 49 1 Y 1 A ARG 430 ? NH1 ? A ARG 403 NH1 50 1 Y 1 A ARG 430 ? NH2 ? A ARG 403 NH2 51 1 Y 1 A GLN 433 ? CG ? A GLN 406 CG 52 1 Y 1 A GLN 433 ? CD ? A GLN 406 CD 53 1 Y 1 A GLN 433 ? OE1 ? A GLN 406 OE1 54 1 Y 1 A GLN 433 ? NE2 ? A GLN 406 NE2 55 1 Y 1 A GLU 455 ? CG ? A GLU 428 CG 56 1 Y 1 A GLU 455 ? CD ? A GLU 428 CD 57 1 Y 1 A GLU 455 ? OE1 ? A GLU 428 OE1 58 1 Y 1 A GLU 455 ? OE2 ? A GLU 428 OE2 59 1 Y 1 A GLN 460 ? CG ? A GLN 433 CG 60 1 Y 1 A GLN 460 ? CD ? A GLN 433 CD 61 1 Y 1 A GLN 460 ? OE1 ? A GLN 433 OE1 62 1 Y 1 A GLN 460 ? NE2 ? A GLN 433 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7ZAV _cell.details ? _cell.formula_units_Z ? _cell.length_a 100.488 _cell.length_a_esd ? _cell.length_b 100.488 _cell.length_b_esd ? _cell.length_c 90.620 _cell.length_c_esd ? _cell.volume 792467.859 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7ZAV _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ZAV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium nitrate and 20% w/v PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-12-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96859 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96859 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 92.03 _reflns.entry_id 7ZAV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.90 _reflns.d_resolution_low 90.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12106 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.5 _reflns.pdbx_Rmerge_I_obs 0.130 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.143 _reflns.pdbx_Rpim_I_all 0.065 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 2.98 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 875 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.999 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.493 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 86.61 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7ZAV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.90 _refine.ls_d_res_low 43.94 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12081 _refine.ls_number_reflns_R_free 569 _refine.ls_number_reflns_R_work 11502 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.68 _refine.ls_percent_reflns_R_free 4.71 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2203 _refine.ls_R_factor_R_free 0.2615 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2183 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4YWT _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.8973 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2961 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 43.94 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2786 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2758 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0036 ? 2834 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6622 ? 3832 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0414 ? 449 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0045 ? 483 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.3275 ? 387 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.90 3.19 . . 148 2777 98.88 . . . 0.3764 . 0.3275 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.19 3.65 . . 107 2889 100.00 . . . 0.3369 . 0.2623 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.65 4.60 . . 154 2863 99.97 . . . 0.2701 . 0.2240 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.60 43.94 . . 160 2973 99.97 . . . 0.2283 . 0.1858 . . . . . . . . . . . # _struct.entry_id 7ZAV _struct.title 'GPC3-Unc5D octamer structure and role in cell migration' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ZAV _struct_keywords.text 'Glycoprotein, Migration, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GPC3_MOUSE _struct_ref.pdbx_db_accession Q8CFZ4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVF QEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQMMNPGLPESV LDINECLRGARRDLKVFGSFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMV KPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTTIGKLCAH SQQRQYRSAYYPEDLFIDKKILKVAHVEHEETLSSRRRELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNGQELVER YSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPKGKV ; _struct_ref.pdbx_align_begin 31 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7ZAV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 455 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8CFZ4 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 482 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 31 _struct_ref_seq.pdbx_auth_seq_align_end 482 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7ZAV GLU A 1 ? UNP Q8CFZ4 ? ? 'expression tag' 28 1 1 7ZAV THR A 2 ? UNP Q8CFZ4 ? ? 'expression tag' 29 2 1 7ZAV GLY A 3 ? UNP Q8CFZ4 ? ? 'expression tag' 30 3 1 7ZAV GLY A 456 ? UNP Q8CFZ4 ? ? 'expression tag' 483 4 1 7ZAV THR A 457 ? UNP Q8CFZ4 ? ? 'expression tag' 484 5 1 7ZAV LYS A 458 ? UNP Q8CFZ4 ? ? 'expression tag' 485 6 1 7ZAV HIS A 459 ? UNP Q8CFZ4 ? ? 'expression tag' 486 7 1 7ZAV HIS A 460 ? UNP Q8CFZ4 ? ? 'expression tag' 487 8 1 7ZAV HIS A 461 ? UNP Q8CFZ4 ? ? 'expression tag' 488 9 1 7ZAV HIS A 462 ? UNP Q8CFZ4 ? ? 'expression tag' 489 10 1 7ZAV HIS A 463 ? UNP Q8CFZ4 ? ? 'expression tag' 490 11 1 7ZAV HIS A 464 ? UNP Q8CFZ4 ? ? 'expression tag' 491 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 480 ? 1 MORE 6 ? 1 'SSA (A^2)' 17730 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 47 ? TYR A 106 ? ARG A 74 TYR A 133 1 ? 60 HELX_P HELX_P2 AA2 PRO A 107 ? THR A 110 ? PRO A 134 THR A 137 5 ? 4 HELX_P HELX_P3 AA3 PRO A 111 ? LEU A 129 ? PRO A 138 LEU A 156 1 ? 19 HELX_P HELX_P4 AA4 ASN A 134 ? MET A 154 ? ASN A 161 MET A 181 1 ? 21 HELX_P HELX_P5 AA5 ILE A 166 ? LEU A 177 ? ILE A 193 LEU A 204 1 ? 12 HELX_P HELX_P6 AA6 SER A 182 ? ASP A 216 ? SER A 209 ASP A 243 1 ? 35 HELX_P HELX_P7 AA7 SER A 221 ? TYR A 233 ? SER A 248 TYR A 260 1 ? 13 HELX_P HELX_P8 AA8 TYR A 233 ? GLN A 238 ? TYR A 260 GLN A 265 1 ? 6 HELX_P HELX_P9 AA9 CYS A 246 ? MET A 258 ? CYS A 273 MET A 285 1 ? 13 HELX_P HELX_P10 AB1 MET A 258 ? GLU A 263 ? MET A 285 GLU A 290 1 ? 6 HELX_P HELX_P11 AB2 ILE A 264 ? ASN A 280 ? ILE A 291 ASN A 307 1 ? 17 HELX_P HELX_P12 AB3 MET A 288 ? LEU A 293 ? MET A 315 LEU A 320 1 ? 6 HELX_P HELX_P13 AB4 GLY A 294 ? LYS A 308 ? GLY A 321 LYS A 335 1 ? 15 HELX_P HELX_P14 AB5 ASN A 309 ? CYS A 321 ? ASN A 336 CYS A 348 1 ? 13 HELX_P HELX_P15 AB6 LEU A 356 ? LYS A 368 ? LEU A 383 LYS A 395 1 ? 13 HELX_P HELX_P16 AB7 SER A 369 ? ILE A 371 ? SER A 396 ILE A 398 5 ? 3 HELX_P HELX_P17 AB8 ALA A 376 ? SER A 385 ? ALA A 403 SER A 412 1 ? 10 HELX_P HELX_P18 AB9 PRO A 429 ? SER A 449 ? PRO A 456 SER A 476 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 234 SG ? ? A CYS 64 A CYS 261 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 237 SG ? ? A CYS 72 A CYS 264 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 169 SG ? ? ? 1_555 A CYS 321 SG ? ? A CYS 196 A CYS 348 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf4 disulf ? ? A CYS 224 SG ? ? ? 1_555 A CYS 257 SG ? ? A CYS 251 A CYS 284 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf5 disulf ? ? A CYS 246 SG ? ? ? 1_555 A CYS 394 SG ? ? A CYS 273 A CYS 421 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf6 disulf ? ? A CYS 250 SG ? ? ? 1_555 A CYS 382 SG ? ? A CYS 277 A CYS 409 1_555 ? ? ? ? ? ? ? 2.036 ? ? covale1 covale one ? A ASN 96 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 123 A NAG 1000 1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation covale2 covale one ? A ASN 213 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 240 A NAG 1001 1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 137 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 138 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.32 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 392 ? TRP A 395 ? THR A 419 TRP A 422 AA1 2 LEU A 400 ? ARG A 403 ? LEU A 427 ARG A 430 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 394 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 421 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 401 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 428 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 63 ? ? -124.70 -60.29 2 1 LEU A 320 ? ? -85.75 30.92 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -18.4804829562 _pdbx_refine_tls.origin_y -24.6206763277 _pdbx_refine_tls.origin_z 12.1716553409 _pdbx_refine_tls.T[1][1] 0.577224364911 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0633586385083 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0612280990188 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.564854843509 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.000908937050743 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.537768595726 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.16948545859 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -1.53069843063 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.575853042985 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.21611116178 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.986875068224 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.302936461396 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0832669117778 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.247563771081 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0693286784865 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0900906837871 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.158491773555 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.156724452332 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0547193865458 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.16364222287 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.000123750621058 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 59 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id C _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 1001 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # _pdbx_entry_details.entry_id 7ZAV _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 28 ? A GLU 1 2 1 Y 1 A THR 29 ? A THR 2 3 1 Y 1 A GLY 30 ? A GLY 3 4 1 Y 1 A ASP 31 ? A ASP 4 5 1 Y 1 A ALA 32 ? A ALA 5 6 1 Y 1 A THR 33 ? A THR 6 7 1 Y 1 A CYS 34 ? A CYS 7 8 1 Y 1 A HIS 35 ? A HIS 8 9 1 Y 1 A GLN 36 ? A GLN 9 10 1 Y 1 A VAL 37 ? A VAL 10 11 1 Y 1 A ARG 38 ? A ARG 11 12 1 Y 1 A SER 39 ? A SER 12 13 1 Y 1 A PHE 40 ? A PHE 13 14 1 Y 1 A PHE 41 ? A PHE 14 15 1 Y 1 A GLN 42 ? A GLN 15 16 1 Y 1 A ARG 43 ? A ARG 16 17 1 Y 1 A LEU 44 ? A LEU 17 18 1 Y 1 A GLN 45 ? A GLN 18 19 1 Y 1 A PRO 46 ? A PRO 19 20 1 Y 1 A GLY 47 ? A GLY 20 21 1 Y 1 A LEU 48 ? A LEU 21 22 1 Y 1 A LYS 49 ? A LYS 22 23 1 Y 1 A TRP 50 ? A TRP 23 24 1 Y 1 A VAL 51 ? A VAL 24 25 1 Y 1 A PRO 52 ? A PRO 25 26 1 Y 1 A GLU 53 ? A GLU 26 27 1 Y 1 A THR 54 ? A THR 27 28 1 Y 1 A PRO 55 ? A PRO 28 29 1 Y 1 A VAL 56 ? A VAL 29 30 1 Y 1 A PRO 57 ? A PRO 30 31 1 Y 1 A GLY 58 ? A GLY 31 32 1 Y 1 A LEU 186 ? A LEU 159 33 1 Y 1 A PRO 187 ? A PRO 160 34 1 Y 1 A GLU 188 ? A GLU 161 35 1 Y 1 A SER 189 ? A SER 162 36 1 Y 1 A VAL 190 ? A VAL 163 37 1 Y 1 A GLY 308 ? A GLY 281 38 1 Y 1 A MET 309 ? A MET 282 39 1 Y 1 A TYR 310 ? A TYR 283 40 1 Y 1 A ARG 311 ? A ARG 284 41 1 Y 1 A ILE 312 ? A ILE 285 42 1 Y 1 A TYR 313 ? A TYR 286 43 1 Y 1 A ALA 349 ? A ALA 322 44 1 Y 1 A HIS 350 ? A HIS 323 45 1 Y 1 A SER 351 ? A SER 324 46 1 Y 1 A GLN 352 ? A GLN 325 47 1 Y 1 A GLN 353 ? A GLN 326 48 1 Y 1 A ARG 354 ? A ARG 327 49 1 Y 1 A GLN 355 ? A GLN 328 50 1 Y 1 A TYR 356 ? A TYR 329 51 1 Y 1 A ARG 357 ? A ARG 330 52 1 Y 1 A SER 358 ? A SER 331 53 1 Y 1 A ALA 359 ? A ALA 332 54 1 Y 1 A TYR 360 ? A TYR 333 55 1 Y 1 A TYR 361 ? A TYR 334 56 1 Y 1 A PRO 362 ? A PRO 335 57 1 Y 1 A GLU 363 ? A GLU 336 58 1 Y 1 A ASP 364 ? A ASP 337 59 1 Y 1 A LEU 365 ? A LEU 338 60 1 Y 1 A PHE 366 ? A PHE 339 61 1 Y 1 A ILE 367 ? A ILE 340 62 1 Y 1 A ASP 368 ? A ASP 341 63 1 Y 1 A LYS 369 ? A LYS 342 64 1 Y 1 A LYS 370 ? A LYS 343 65 1 Y 1 A ILE 371 ? A ILE 344 66 1 Y 1 A LEU 372 ? A LEU 345 67 1 Y 1 A LYS 373 ? A LYS 346 68 1 Y 1 A VAL 374 ? A VAL 347 69 1 Y 1 A ALA 375 ? A ALA 348 70 1 Y 1 A HIS 376 ? A HIS 349 71 1 Y 1 A VAL 377 ? A VAL 350 72 1 Y 1 A GLU 378 ? A GLU 351 73 1 Y 1 A HIS 379 ? A HIS 352 74 1 Y 1 A GLU 380 ? A GLU 353 75 1 Y 1 A GLU 381 ? A GLU 354 76 1 Y 1 A LYS 434 ? A LYS 407 77 1 Y 1 A ALA 435 ? A ALA 408 78 1 Y 1 A ALA 436 ? A ALA 409 79 1 Y 1 A ARG 437 ? A ARG 410 80 1 Y 1 A ASN 438 ? A ASN 411 81 1 Y 1 A GLY 439 ? A GLY 412 82 1 Y 1 A MET 440 ? A MET 413 83 1 Y 1 A LYS 441 ? A LYS 414 84 1 Y 1 A ASN 442 ? A ASN 415 85 1 Y 1 A GLN 443 ? A GLN 416 86 1 Y 1 A PHE 444 ? A PHE 417 87 1 Y 1 A ASN 445 ? A ASN 418 88 1 Y 1 A LEU 446 ? A LEU 419 89 1 Y 1 A HIS 447 ? A HIS 420 90 1 Y 1 A GLU 448 ? A GLU 421 91 1 Y 1 A LEU 449 ? A LEU 422 92 1 Y 1 A LYS 450 ? A LYS 423 93 1 Y 1 A MET 451 ? A MET 424 94 1 Y 1 A LYS 452 ? A LYS 425 95 1 Y 1 A GLY 453 ? A GLY 426 96 1 Y 1 A PRO 454 ? A PRO 427 97 1 Y 1 A VAL 477 ? A VAL 450 98 1 Y 1 A PRO 478 ? A PRO 451 99 1 Y 1 A LYS 479 ? A LYS 452 100 1 Y 1 A GLY 480 ? A GLY 453 101 1 Y 1 A LYS 481 ? A LYS 454 102 1 Y 1 A VAL 482 ? A VAL 455 103 1 Y 1 A GLY 483 ? A GLY 456 104 1 Y 1 A THR 484 ? A THR 457 105 1 Y 1 A LYS 485 ? A LYS 458 106 1 Y 1 A HIS 486 ? A HIS 459 107 1 Y 1 A HIS 487 ? A HIS 460 108 1 Y 1 A HIS 488 ? A HIS 461 109 1 Y 1 A HIS 489 ? A HIS 462 110 1 Y 1 A HIS 490 ? A HIS 463 111 1 Y 1 A HIS 491 ? A HIS 464 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 NAG C1 C N R 247 NAG C2 C N R 248 NAG C3 C N R 249 NAG C4 C N S 250 NAG C5 C N R 251 NAG C6 C N N 252 NAG C7 C N N 253 NAG C8 C N N 254 NAG N2 N N N 255 NAG O1 O N N 256 NAG O3 O N N 257 NAG O4 O N N 258 NAG O5 O N N 259 NAG O6 O N N 260 NAG O7 O N N 261 NAG H1 H N N 262 NAG H2 H N N 263 NAG H3 H N N 264 NAG H4 H N N 265 NAG H5 H N N 266 NAG H61 H N N 267 NAG H62 H N N 268 NAG H81 H N N 269 NAG H82 H N N 270 NAG H83 H N N 271 NAG HN2 H N N 272 NAG HO1 H N N 273 NAG HO3 H N N 274 NAG HO4 H N N 275 NAG HO6 H N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SER N N N N 317 SER CA C N S 318 SER C C N N 319 SER O O N N 320 SER CB C N N 321 SER OG O N N 322 SER OXT O N N 323 SER H H N N 324 SER H2 H N N 325 SER HA H N N 326 SER HB2 H N N 327 SER HB3 H N N 328 SER HG H N N 329 SER HXT H N N 330 THR N N N N 331 THR CA C N S 332 THR C C N N 333 THR O O N N 334 THR CB C N R 335 THR OG1 O N N 336 THR CG2 C N N 337 THR OXT O N N 338 THR H H N N 339 THR H2 H N N 340 THR HA H N N 341 THR HB H N N 342 THR HG1 H N N 343 THR HG21 H N N 344 THR HG22 H N N 345 THR HG23 H N N 346 THR HXT H N N 347 TRP N N N N 348 TRP CA C N S 349 TRP C C N N 350 TRP O O N N 351 TRP CB C N N 352 TRP CG C Y N 353 TRP CD1 C Y N 354 TRP CD2 C Y N 355 TRP NE1 N Y N 356 TRP CE2 C Y N 357 TRP CE3 C Y N 358 TRP CZ2 C Y N 359 TRP CZ3 C Y N 360 TRP CH2 C Y N 361 TRP OXT O N N 362 TRP H H N N 363 TRP H2 H N N 364 TRP HA H N N 365 TRP HB2 H N N 366 TRP HB3 H N N 367 TRP HD1 H N N 368 TRP HE1 H N N 369 TRP HE3 H N N 370 TRP HZ2 H N N 371 TRP HZ3 H N N 372 TRP HH2 H N N 373 TRP HXT H N N 374 TYR N N N N 375 TYR CA C N S 376 TYR C C N N 377 TYR O O N N 378 TYR CB C N N 379 TYR CG C Y N 380 TYR CD1 C Y N 381 TYR CD2 C Y N 382 TYR CE1 C Y N 383 TYR CE2 C Y N 384 TYR CZ C Y N 385 TYR OH O N N 386 TYR OXT O N N 387 TYR H H N N 388 TYR H2 H N N 389 TYR HA H N N 390 TYR HB2 H N N 391 TYR HB3 H N N 392 TYR HD1 H N N 393 TYR HD2 H N N 394 TYR HE1 H N N 395 TYR HE2 H N N 396 TYR HH H N N 397 TYR HXT H N N 398 VAL N N N N 399 VAL CA C N S 400 VAL C C N N 401 VAL O O N N 402 VAL CB C N N 403 VAL CG1 C N N 404 VAL CG2 C N N 405 VAL OXT O N N 406 VAL H H N N 407 VAL H2 H N N 408 VAL HA H N N 409 VAL HB H N N 410 VAL HG11 H N N 411 VAL HG12 H N N 412 VAL HG13 H N N 413 VAL HG21 H N N 414 VAL HG22 H N N 415 VAL HG23 H N N 416 VAL HXT H N N 417 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 NAG C1 C2 sing N N 235 NAG C1 O1 sing N N 236 NAG C1 O5 sing N N 237 NAG C1 H1 sing N N 238 NAG C2 C3 sing N N 239 NAG C2 N2 sing N N 240 NAG C2 H2 sing N N 241 NAG C3 C4 sing N N 242 NAG C3 O3 sing N N 243 NAG C3 H3 sing N N 244 NAG C4 C5 sing N N 245 NAG C4 O4 sing N N 246 NAG C4 H4 sing N N 247 NAG C5 C6 sing N N 248 NAG C5 O5 sing N N 249 NAG C5 H5 sing N N 250 NAG C6 O6 sing N N 251 NAG C6 H61 sing N N 252 NAG C6 H62 sing N N 253 NAG C7 C8 sing N N 254 NAG C7 N2 sing N N 255 NAG C7 O7 doub N N 256 NAG C8 H81 sing N N 257 NAG C8 H82 sing N N 258 NAG C8 H83 sing N N 259 NAG N2 HN2 sing N N 260 NAG O1 HO1 sing N N 261 NAG O3 HO3 sing N N 262 NAG O4 HO4 sing N N 263 NAG O6 HO6 sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TRP N CA sing N N 334 TRP N H sing N N 335 TRP N H2 sing N N 336 TRP CA C sing N N 337 TRP CA CB sing N N 338 TRP CA HA sing N N 339 TRP C O doub N N 340 TRP C OXT sing N N 341 TRP CB CG sing N N 342 TRP CB HB2 sing N N 343 TRP CB HB3 sing N N 344 TRP CG CD1 doub Y N 345 TRP CG CD2 sing Y N 346 TRP CD1 NE1 sing Y N 347 TRP CD1 HD1 sing N N 348 TRP CD2 CE2 doub Y N 349 TRP CD2 CE3 sing Y N 350 TRP NE1 CE2 sing Y N 351 TRP NE1 HE1 sing N N 352 TRP CE2 CZ2 sing Y N 353 TRP CE3 CZ3 doub Y N 354 TRP CE3 HE3 sing N N 355 TRP CZ2 CH2 doub Y N 356 TRP CZ2 HZ2 sing N N 357 TRP CZ3 CH2 sing Y N 358 TRP CZ3 HZ3 sing N N 359 TRP CH2 HH2 sing N N 360 TRP OXT HXT sing N N 361 TYR N CA sing N N 362 TYR N H sing N N 363 TYR N H2 sing N N 364 TYR CA C sing N N 365 TYR CA CB sing N N 366 TYR CA HA sing N N 367 TYR C O doub N N 368 TYR C OXT sing N N 369 TYR CB CG sing N N 370 TYR CB HB2 sing N N 371 TYR CB HB3 sing N N 372 TYR CG CD1 doub Y N 373 TYR CG CD2 sing Y N 374 TYR CD1 CE1 sing Y N 375 TYR CD1 HD1 sing N N 376 TYR CD2 CE2 doub Y N 377 TYR CD2 HD2 sing N N 378 TYR CE1 CZ doub Y N 379 TYR CE1 HE1 sing N N 380 TYR CE2 CZ sing Y N 381 TYR CE2 HE2 sing N N 382 TYR CZ OH sing N N 383 TYR OH HH sing N N 384 TYR OXT HXT sing N N 385 VAL N CA sing N N 386 VAL N H sing N N 387 VAL N H2 sing N N 388 VAL CA C sing N N 389 VAL CA CB sing N N 390 VAL CA HA sing N N 391 VAL C O doub N N 392 VAL C OXT sing N N 393 VAL CB CG1 sing N N 394 VAL CB CG2 sing N N 395 VAL CB HB sing N N 396 VAL CG1 HG11 sing N N 397 VAL CG1 HG12 sing N N 398 VAL CG1 HG13 sing N N 399 VAL CG2 HG21 sing N N 400 VAL CG2 HG22 sing N N 401 VAL CG2 HG23 sing N N 402 VAL OXT HXT sing N N 403 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 202827/Z/16/Z _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4YWT _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 31 2 1' _space_group.name_Hall ;P 31 2" ; _space_group.IT_number 152 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 7ZAV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009951 _atom_sites.fract_transf_matrix[1][2] 0.005745 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011491 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011035 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_