data_7ZUN # _entry.id 7ZUN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ZUN pdb_00007zun 10.2210/pdb7zun/pdb WWPDB D_1292123000 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-10-05 2 'Structure model' 2 0 2022-10-12 3 'Structure model' 2 1 2024-01-31 4 'Structure model' 2 2 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' citation 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_atom_id' 6 2 'Structure model' '_atom_site.label_atom_id' 7 2 'Structure model' '_citation.journal_volume' 8 2 'Structure model' '_citation.page_first' 9 2 'Structure model' '_citation.page_last' 10 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7ZUN _pdbx_database_status.recvd_initial_deposition_date 2022-05-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email francesco.casuscelli@nervianoms.com _pdbx_contact_author.name_first Francesco _pdbx_contact_author.name_last Casuscelli _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3883-4126 # _audit_author.name 'Casale, E.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-7614-7485 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chirality _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-636X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 34 _citation.language ? _citation.page_first 1437 _citation.page_last 1452 _citation.title ;Stereoselective synthesis of 3,4-dihydropyrrolo[1,2-a]pyrazin-1(2H)-one derivatives as PIM kinase inhibitors inspired from marine alkaloids. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/chir.23501 _citation.pdbx_database_id_PubMed 35959859 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Casuscelli, F.' 1 0000-0003-3883-4126 primary 'Ardini, E.' 2 ? primary 'Avanzi, N.' 3 ? primary 'Badari, A.' 4 ? primary 'Casale, E.' 5 ? primary 'Disingrini, T.' 6 ? primary 'Donati, D.' 7 ? primary 'Ermoli, A.' 8 ? primary 'Felder, E.R.' 9 ? primary 'Galvani, A.' 10 ? primary 'Isacchi, A.' 11 ? primary 'Menichincheri, M.' 12 ? primary 'Montemartini, M.' 13 ? primary 'Orrenius, C.' 14 ? primary 'Piutti, C.' 15 ? primary 'Salom, B.' 16 ? primary 'Papeo, G.' 17 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform 2 of Serine/threonine-protein kinase pim-1' 35835.691 1 2.7.11.1 ? ? 'residue SEP 261 is a PHOSPHOSERINE THE FIRST TWO RESIDUES AT THE N-TERMINAL GLY AND PRO ARE EXPRESSION TAG' 2 non-polymer syn '(4~{S})-4-(2-azanylethyl)-6-phenyl-7-[3-(trifluoromethyloxy)phenyl]-3,4-dihydropyrrolo[1,2-a]pyrazin-1-ol' 415.408 1 ? ? ? ? 3 water nat water 18.015 46 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD IPFEHDEEIIRGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD IPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(4~{S})-4-(2-azanylethyl)-6-phenyl-7-[3-(trifluoromethyloxy)phenyl]-3,4-dihydropyrrolo[1,2-a]pyrazin-1-ol' JYO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 LEU n 1 5 SER n 1 6 LYS n 1 7 ILE n 1 8 ASN n 1 9 SER n 1 10 LEU n 1 11 ALA n 1 12 HIS n 1 13 LEU n 1 14 ARG n 1 15 ALA n 1 16 ALA n 1 17 PRO n 1 18 CYS n 1 19 ASN n 1 20 ASP n 1 21 LEU n 1 22 HIS n 1 23 ALA n 1 24 THR n 1 25 LYS n 1 26 LEU n 1 27 ALA n 1 28 PRO n 1 29 GLY n 1 30 LYS n 1 31 GLU n 1 32 LYS n 1 33 GLU n 1 34 PRO n 1 35 LEU n 1 36 GLU n 1 37 SER n 1 38 GLN n 1 39 TYR n 1 40 GLN n 1 41 VAL n 1 42 GLY n 1 43 PRO n 1 44 LEU n 1 45 LEU n 1 46 GLY n 1 47 SER n 1 48 GLY n 1 49 GLY n 1 50 PHE n 1 51 GLY n 1 52 SER n 1 53 VAL n 1 54 TYR n 1 55 SER n 1 56 GLY n 1 57 ILE n 1 58 ARG n 1 59 VAL n 1 60 SER n 1 61 ASP n 1 62 ASN n 1 63 LEU n 1 64 PRO n 1 65 VAL n 1 66 ALA n 1 67 ILE n 1 68 LYS n 1 69 HIS n 1 70 VAL n 1 71 GLU n 1 72 LYS n 1 73 ASP n 1 74 ARG n 1 75 ILE n 1 76 SER n 1 77 ASP n 1 78 TRP n 1 79 GLY n 1 80 GLU n 1 81 LEU n 1 82 PRO n 1 83 ASN n 1 84 GLY n 1 85 THR n 1 86 ARG n 1 87 VAL n 1 88 PRO n 1 89 MET n 1 90 GLU n 1 91 VAL n 1 92 VAL n 1 93 LEU n 1 94 LEU n 1 95 LYS n 1 96 LYS n 1 97 VAL n 1 98 SER n 1 99 SER n 1 100 GLY n 1 101 PHE n 1 102 SER n 1 103 GLY n 1 104 VAL n 1 105 ILE n 1 106 ARG n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 TRP n 1 111 PHE n 1 112 GLU n 1 113 ARG n 1 114 PRO n 1 115 ASP n 1 116 SER n 1 117 PHE n 1 118 VAL n 1 119 LEU n 1 120 ILE n 1 121 LEU n 1 122 GLU n 1 123 ARG n 1 124 PRO n 1 125 GLU n 1 126 PRO n 1 127 VAL n 1 128 GLN n 1 129 ASP n 1 130 LEU n 1 131 PHE n 1 132 ASP n 1 133 PHE n 1 134 ILE n 1 135 THR n 1 136 GLU n 1 137 ARG n 1 138 GLY n 1 139 ALA n 1 140 LEU n 1 141 GLN n 1 142 GLU n 1 143 GLU n 1 144 LEU n 1 145 ALA n 1 146 ARG n 1 147 SER n 1 148 PHE n 1 149 PHE n 1 150 TRP n 1 151 GLN n 1 152 VAL n 1 153 LEU n 1 154 GLU n 1 155 ALA n 1 156 VAL n 1 157 ARG n 1 158 HIS n 1 159 CYS n 1 160 HIS n 1 161 ASN n 1 162 CYS n 1 163 GLY n 1 164 VAL n 1 165 LEU n 1 166 HIS n 1 167 ARG n 1 168 ASP n 1 169 ILE n 1 170 LYS n 1 171 ASP n 1 172 GLU n 1 173 ASN n 1 174 ILE n 1 175 LEU n 1 176 ILE n 1 177 ASP n 1 178 LEU n 1 179 ASN n 1 180 ARG n 1 181 GLY n 1 182 GLU n 1 183 LEU n 1 184 LYS n 1 185 LEU n 1 186 ILE n 1 187 ASP n 1 188 PHE n 1 189 GLY n 1 190 SER n 1 191 GLY n 1 192 ALA n 1 193 LEU n 1 194 LEU n 1 195 LYS n 1 196 ASP n 1 197 THR n 1 198 VAL n 1 199 TYR n 1 200 THR n 1 201 ASP n 1 202 PHE n 1 203 ASP n 1 204 GLY n 1 205 THR n 1 206 ARG n 1 207 VAL n 1 208 TYR n 1 209 SER n 1 210 PRO n 1 211 PRO n 1 212 GLU n 1 213 TRP n 1 214 ILE n 1 215 ARG n 1 216 TYR n 1 217 HIS n 1 218 ARG n 1 219 TYR n 1 220 HIS n 1 221 GLY n 1 222 ARG n 1 223 SER n 1 224 ALA n 1 225 ALA n 1 226 VAL n 1 227 TRP n 1 228 SER n 1 229 LEU n 1 230 GLY n 1 231 ILE n 1 232 LEU n 1 233 LEU n 1 234 TYR n 1 235 ASP n 1 236 MET n 1 237 VAL n 1 238 CYS n 1 239 GLY n 1 240 ASP n 1 241 ILE n 1 242 PRO n 1 243 PHE n 1 244 GLU n 1 245 HIS n 1 246 ASP n 1 247 GLU n 1 248 GLU n 1 249 ILE n 1 250 ILE n 1 251 ARG n 1 252 GLY n 1 253 GLN n 1 254 VAL n 1 255 PHE n 1 256 PHE n 1 257 ARG n 1 258 GLN n 1 259 ARG n 1 260 VAL n 1 261 SER n 1 262 SEP n 1 263 GLU n 1 264 CYS n 1 265 GLN n 1 266 HIS n 1 267 LEU n 1 268 ILE n 1 269 ARG n 1 270 TRP n 1 271 CYS n 1 272 LEU n 1 273 ALA n 1 274 LEU n 1 275 ARG n 1 276 PRO n 1 277 SER n 1 278 ASP n 1 279 ARG n 1 280 PRO n 1 281 THR n 1 282 PHE n 1 283 GLU n 1 284 GLU n 1 285 ILE n 1 286 GLN n 1 287 ASN n 1 288 HIS n 1 289 PRO n 1 290 TRP n 1 291 MET n 1 292 GLN n 1 293 ASP n 1 294 VAL n 1 295 LEU n 1 296 LEU n 1 297 PRO n 1 298 GLN n 1 299 GLU n 1 300 THR n 1 301 ALA n 1 302 GLU n 1 303 ILE n 1 304 HIS n 1 305 LEU n 1 306 HIS n 1 307 SER n 1 308 LEU n 1 309 SER n 1 310 PRO n 1 311 GLY n 1 312 PRO n 1 313 SER n 1 314 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 314 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JYO non-polymer . '(4~{S})-4-(2-azanylethyl)-6-phenyl-7-[3-(trifluoromethyloxy)phenyl]-3,4-dihydropyrrolo[1,2-a]pyrazin-1-ol' ? 'C22 H20 F3 N3 O2' 415.408 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 PRO 2 1 ? ? ? A . n A 1 3 LEU 3 2 ? ? ? A . n A 1 4 LEU 4 3 ? ? ? A . n A 1 5 SER 5 4 ? ? ? A . n A 1 6 LYS 6 5 ? ? ? A . n A 1 7 ILE 7 6 ? ? ? A . n A 1 8 ASN 8 7 ? ? ? A . n A 1 9 SER 9 8 ? ? ? A . n A 1 10 LEU 10 9 ? ? ? A . n A 1 11 ALA 11 10 ? ? ? A . n A 1 12 HIS 12 11 ? ? ? A . n A 1 13 LEU 13 12 ? ? ? A . n A 1 14 ARG 14 13 ? ? ? A . n A 1 15 ALA 15 14 ? ? ? A . n A 1 16 ALA 16 15 ? ? ? A . n A 1 17 PRO 17 16 ? ? ? A . n A 1 18 CYS 18 17 ? ? ? A . n A 1 19 ASN 19 18 ? ? ? A . n A 1 20 ASP 20 19 ? ? ? A . n A 1 21 LEU 21 20 ? ? ? A . n A 1 22 HIS 22 21 ? ? ? A . n A 1 23 ALA 23 22 ? ? ? A . n A 1 24 THR 24 23 ? ? ? A . n A 1 25 LYS 25 24 ? ? ? A . n A 1 26 LEU 26 25 ? ? ? A . n A 1 27 ALA 27 26 ? ? ? A . n A 1 28 PRO 28 27 ? ? ? A . n A 1 29 GLY 29 28 ? ? ? A . n A 1 30 LYS 30 29 ? ? ? A . n A 1 31 GLU 31 30 ? ? ? A . n A 1 32 LYS 32 31 ? ? ? A . n A 1 33 GLU 33 32 ? ? ? A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 GLN 38 37 37 GLN GLN A . n A 1 39 TYR 39 38 38 TYR TYR A . n A 1 40 GLN 40 39 39 GLN GLN A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 PRO 43 42 42 PRO PRO A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 SER 47 46 ? ? ? A . n A 1 48 GLY 48 47 ? ? ? A . n A 1 49 GLY 49 48 ? ? ? A . n A 1 50 PHE 50 49 49 PHE PHE A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 SER 52 51 51 SER SER A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 TYR 54 53 53 TYR TYR A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 ARG 58 57 57 ARG ARG A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 ASN 62 61 61 ASN ASN A . n A 1 63 LEU 63 62 62 LEU LEU A . n A 1 64 PRO 64 63 63 PRO PRO A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 ALA 66 65 65 ALA ALA A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 ILE 75 74 74 ILE ILE A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 TRP 78 77 77 TRP TRP A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 GLU 80 79 79 GLU GLU A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 PRO 82 81 81 PRO PRO A . n A 1 83 ASN 83 82 82 ASN ASN A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 THR 85 84 84 THR THR A . n A 1 86 ARG 86 85 85 ARG ARG A . n A 1 87 VAL 87 86 86 VAL VAL A . n A 1 88 PRO 88 87 87 PRO PRO A . n A 1 89 MET 89 88 88 MET MET A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 LEU 93 92 92 LEU LEU A . n A 1 94 LEU 94 93 93 LEU LEU A . n A 1 95 LYS 95 94 94 LYS LYS A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 SER 98 97 97 SER SER A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 GLY 100 99 99 GLY GLY A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 SER 102 101 101 SER SER A . n A 1 103 GLY 103 102 102 GLY GLY A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 ILE 105 104 104 ILE ILE A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 TRP 110 109 109 TRP TRP A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 GLU 112 111 111 GLU GLU A . n A 1 113 ARG 113 112 112 ARG ARG A . n A 1 114 PRO 114 113 113 PRO PRO A . n A 1 115 ASP 115 114 114 ASP ASP A . n A 1 116 SER 116 115 115 SER SER A . n A 1 117 PHE 117 116 116 PHE PHE A . n A 1 118 VAL 118 117 117 VAL VAL A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 ILE 120 119 119 ILE ILE A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 GLU 122 121 121 GLU GLU A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 PRO 124 123 123 PRO PRO A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 PRO 126 125 125 PRO PRO A . n A 1 127 VAL 127 126 126 VAL VAL A . n A 1 128 GLN 128 127 127 GLN GLN A . n A 1 129 ASP 129 128 128 ASP ASP A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 PHE 131 130 130 PHE PHE A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 THR 135 134 134 THR THR A . n A 1 136 GLU 136 135 135 GLU GLU A . n A 1 137 ARG 137 136 136 ARG ARG A . n A 1 138 GLY 138 137 137 GLY GLY A . n A 1 139 ALA 139 138 138 ALA ALA A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 GLN 141 140 140 GLN GLN A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 LEU 144 143 143 LEU LEU A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 ARG 146 145 145 ARG ARG A . n A 1 147 SER 147 146 146 SER SER A . n A 1 148 PHE 148 147 147 PHE PHE A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 TRP 150 149 149 TRP TRP A . n A 1 151 GLN 151 150 150 GLN GLN A . n A 1 152 VAL 152 151 151 VAL VAL A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 ALA 155 154 154 ALA ALA A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 HIS 158 157 157 HIS HIS A . n A 1 159 CYS 159 158 158 CYS CYS A . n A 1 160 HIS 160 159 159 HIS HIS A . n A 1 161 ASN 161 160 160 ASN ASN A . n A 1 162 CYS 162 161 161 CYS CYS A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 VAL 164 163 163 VAL VAL A . n A 1 165 LEU 165 164 164 LEU LEU A . n A 1 166 HIS 166 165 165 HIS HIS A . n A 1 167 ARG 167 166 166 ARG ARG A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 ILE 169 168 168 ILE ILE A . n A 1 170 LYS 170 169 169 LYS LYS A . n A 1 171 ASP 171 170 170 ASP ASP A . n A 1 172 GLU 172 171 171 GLU GLU A . n A 1 173 ASN 173 172 172 ASN ASN A . n A 1 174 ILE 174 173 173 ILE ILE A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 ILE 176 175 175 ILE ILE A . n A 1 177 ASP 177 176 176 ASP ASP A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 ASN 179 178 178 ASN ASN A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 GLY 181 180 180 GLY GLY A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 LEU 183 182 182 LEU LEU A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 LEU 185 184 184 LEU LEU A . n A 1 186 ILE 186 185 185 ILE ILE A . n A 1 187 ASP 187 186 186 ASP ASP A . n A 1 188 PHE 188 187 187 PHE PHE A . n A 1 189 GLY 189 188 188 GLY GLY A . n A 1 190 SER 190 189 189 SER SER A . n A 1 191 GLY 191 190 190 GLY GLY A . n A 1 192 ALA 192 191 191 ALA ALA A . n A 1 193 LEU 193 192 192 LEU LEU A . n A 1 194 LEU 194 193 193 LEU LEU A . n A 1 195 LYS 195 194 194 LYS LYS A . n A 1 196 ASP 196 195 195 ASP ASP A . n A 1 197 THR 197 196 196 THR THR A . n A 1 198 VAL 198 197 197 VAL VAL A . n A 1 199 TYR 199 198 198 TYR TYR A . n A 1 200 THR 200 199 199 THR THR A . n A 1 201 ASP 201 200 200 ASP ASP A . n A 1 202 PHE 202 201 201 PHE PHE A . n A 1 203 ASP 203 202 202 ASP ASP A . n A 1 204 GLY 204 203 203 GLY GLY A . n A 1 205 THR 205 204 204 THR THR A . n A 1 206 ARG 206 205 205 ARG ARG A . n A 1 207 VAL 207 206 206 VAL VAL A . n A 1 208 TYR 208 207 207 TYR TYR A . n A 1 209 SER 209 208 208 SER SER A . n A 1 210 PRO 210 209 209 PRO PRO A . n A 1 211 PRO 211 210 210 PRO PRO A . n A 1 212 GLU 212 211 211 GLU GLU A . n A 1 213 TRP 213 212 212 TRP TRP A . n A 1 214 ILE 214 213 213 ILE ILE A . n A 1 215 ARG 215 214 214 ARG ARG A . n A 1 216 TYR 216 215 215 TYR TYR A . n A 1 217 HIS 217 216 216 HIS HIS A . n A 1 218 ARG 218 217 217 ARG ARG A . n A 1 219 TYR 219 218 218 TYR TYR A . n A 1 220 HIS 220 219 219 HIS HIS A . n A 1 221 GLY 221 220 220 GLY GLY A . n A 1 222 ARG 222 221 221 ARG ARG A . n A 1 223 SER 223 222 222 SER SER A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 ALA 225 224 224 ALA ALA A . n A 1 226 VAL 226 225 225 VAL VAL A . n A 1 227 TRP 227 226 226 TRP TRP A . n A 1 228 SER 228 227 227 SER SER A . n A 1 229 LEU 229 228 228 LEU LEU A . n A 1 230 GLY 230 229 229 GLY GLY A . n A 1 231 ILE 231 230 230 ILE ILE A . n A 1 232 LEU 232 231 231 LEU LEU A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 TYR 234 233 233 TYR TYR A . n A 1 235 ASP 235 234 234 ASP ASP A . n A 1 236 MET 236 235 235 MET MET A . n A 1 237 VAL 237 236 236 VAL VAL A . n A 1 238 CYS 238 237 237 CYS CYS A . n A 1 239 GLY 239 238 238 GLY GLY A . n A 1 240 ASP 240 239 239 ASP ASP A . n A 1 241 ILE 241 240 240 ILE ILE A . n A 1 242 PRO 242 241 241 PRO PRO A . n A 1 243 PHE 243 242 242 PHE PHE A . n A 1 244 GLU 244 243 243 GLU GLU A . n A 1 245 HIS 245 244 244 HIS HIS A . n A 1 246 ASP 246 245 245 ASP ASP A . n A 1 247 GLU 247 246 246 GLU GLU A . n A 1 248 GLU 248 247 247 GLU GLU A . n A 1 249 ILE 249 248 248 ILE ILE A . n A 1 250 ILE 250 249 249 ILE ILE A . n A 1 251 ARG 251 250 250 ARG ARG A . n A 1 252 GLY 252 251 251 GLY GLY A . n A 1 253 GLN 253 252 252 GLN GLN A . n A 1 254 VAL 254 253 253 VAL VAL A . n A 1 255 PHE 255 254 254 PHE PHE A . n A 1 256 PHE 256 255 255 PHE PHE A . n A 1 257 ARG 257 256 256 ARG ARG A . n A 1 258 GLN 258 257 257 GLN GLN A . n A 1 259 ARG 259 258 258 ARG ARG A . n A 1 260 VAL 260 259 259 VAL VAL A . n A 1 261 SER 261 260 260 SER SER A . n A 1 262 SEP 262 261 261 SEP SEP A . n A 1 263 GLU 263 262 262 GLU GLU A . n A 1 264 CYS 264 263 263 CYS CYS A . n A 1 265 GLN 265 264 264 GLN GLN A . n A 1 266 HIS 266 265 265 HIS HIS A . n A 1 267 LEU 267 266 266 LEU LEU A . n A 1 268 ILE 268 267 267 ILE ILE A . n A 1 269 ARG 269 268 268 ARG ARG A . n A 1 270 TRP 270 269 269 TRP TRP A . n A 1 271 CYS 271 270 270 CYS CYS A . n A 1 272 LEU 272 271 271 LEU LEU A . n A 1 273 ALA 273 272 272 ALA ALA A . n A 1 274 LEU 274 273 273 LEU LEU A . n A 1 275 ARG 275 274 274 ARG ARG A . n A 1 276 PRO 276 275 275 PRO PRO A . n A 1 277 SER 277 276 276 SER SER A . n A 1 278 ASP 278 277 277 ASP ASP A . n A 1 279 ARG 279 278 278 ARG ARG A . n A 1 280 PRO 280 279 279 PRO PRO A . n A 1 281 THR 281 280 280 THR THR A . n A 1 282 PHE 282 281 281 PHE PHE A . n A 1 283 GLU 283 282 282 GLU GLU A . n A 1 284 GLU 284 283 283 GLU GLU A . n A 1 285 ILE 285 284 284 ILE ILE A . n A 1 286 GLN 286 285 285 GLN GLN A . n A 1 287 ASN 287 286 286 ASN ASN A . n A 1 288 HIS 288 287 287 HIS HIS A . n A 1 289 PRO 289 288 288 PRO PRO A . n A 1 290 TRP 290 289 289 TRP TRP A . n A 1 291 MET 291 290 290 MET MET A . n A 1 292 GLN 292 291 291 GLN GLN A . n A 1 293 ASP 293 292 292 ASP ASP A . n A 1 294 VAL 294 293 293 VAL VAL A . n A 1 295 LEU 295 294 294 LEU LEU A . n A 1 296 LEU 296 295 295 LEU LEU A . n A 1 297 PRO 297 296 296 PRO PRO A . n A 1 298 GLN 298 297 297 GLN GLN A . n A 1 299 GLU 299 298 298 GLU GLU A . n A 1 300 THR 300 299 299 THR THR A . n A 1 301 ALA 301 300 300 ALA ALA A . n A 1 302 GLU 302 301 301 GLU GLU A . n A 1 303 ILE 303 302 302 ILE ILE A . n A 1 304 HIS 304 303 303 HIS HIS A . n A 1 305 LEU 305 304 304 LEU LEU A . n A 1 306 HIS 306 305 305 HIS HIS A . n A 1 307 SER 307 306 ? ? ? A . n A 1 308 LEU 308 307 ? ? ? A . n A 1 309 SER 309 308 ? ? ? A . n A 1 310 PRO 310 309 ? ? ? A . n A 1 311 GLY 311 310 ? ? ? A . n A 1 312 PRO 312 311 ? ? ? A . n A 1 313 SER 313 312 ? ? ? A . n A 1 314 LYS 314 313 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id JYO _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id JYO _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 JYO 1 401 1 JYO 337 A . C 3 HOH 1 501 5 HOH HOH A . C 3 HOH 2 502 78 HOH HOH A . C 3 HOH 3 503 86 HOH HOH A . C 3 HOH 4 504 6 HOH HOH A . C 3 HOH 5 505 20 HOH HOH A . C 3 HOH 6 506 19 HOH HOH A . C 3 HOH 7 507 50 HOH HOH A . C 3 HOH 8 508 61 HOH HOH A . C 3 HOH 9 509 8 HOH HOH A . C 3 HOH 10 510 9 HOH HOH A . C 3 HOH 11 511 39 HOH HOH A . C 3 HOH 12 512 83 HOH HOH A . C 3 HOH 13 513 18 HOH HOH A . C 3 HOH 14 514 80 HOH HOH A . C 3 HOH 15 515 36 HOH HOH A . C 3 HOH 16 516 22 HOH HOH A . C 3 HOH 17 517 81 HOH HOH A . C 3 HOH 18 518 23 HOH HOH A . C 3 HOH 19 519 38 HOH HOH A . C 3 HOH 20 520 68 HOH HOH A . C 3 HOH 21 521 17 HOH HOH A . C 3 HOH 22 522 13 HOH HOH A . C 3 HOH 23 523 4 HOH HOH A . C 3 HOH 24 524 7 HOH HOH A . C 3 HOH 25 525 28 HOH HOH A . C 3 HOH 26 526 16 HOH HOH A . C 3 HOH 27 527 60 HOH HOH A . C 3 HOH 28 528 51 HOH HOH A . C 3 HOH 29 529 15 HOH HOH A . C 3 HOH 30 530 10 HOH HOH A . C 3 HOH 31 531 1 HOH HOH A . C 3 HOH 32 532 25 HOH HOH A . C 3 HOH 33 533 63 HOH HOH A . C 3 HOH 34 534 70 HOH HOH A . C 3 HOH 35 535 79 HOH HOH A . C 3 HOH 36 536 41 HOH HOH A . C 3 HOH 37 537 84 HOH HOH A . C 3 HOH 38 538 75 HOH HOH A . C 3 HOH 39 539 40 HOH HOH A . C 3 HOH 40 540 27 HOH HOH A . C 3 HOH 41 541 58 HOH HOH A . C 3 HOH 42 542 62 HOH HOH A . C 3 HOH 43 543 35 HOH HOH A . C 3 HOH 44 544 72 HOH HOH A . C 3 HOH 45 545 71 HOH HOH A . C 3 HOH 46 546 77 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 49 ? CG ? A PHE 50 CG 2 1 Y 1 A PHE 49 ? CD1 ? A PHE 50 CD1 3 1 Y 1 A PHE 49 ? CD2 ? A PHE 50 CD2 4 1 Y 1 A PHE 49 ? CE1 ? A PHE 50 CE1 5 1 Y 1 A PHE 49 ? CE2 ? A PHE 50 CE2 6 1 Y 1 A PHE 49 ? CZ ? A PHE 50 CZ 7 1 Y 1 A ARG 73 ? CG ? A ARG 74 CG 8 1 Y 1 A ARG 73 ? CD ? A ARG 74 CD 9 1 Y 1 A ARG 73 ? NE ? A ARG 74 NE 10 1 Y 1 A ARG 73 ? CZ ? A ARG 74 CZ 11 1 Y 1 A ARG 73 ? NH1 ? A ARG 74 NH1 12 1 Y 1 A ARG 73 ? NH2 ? A ARG 74 NH2 13 1 Y 1 A ARG 105 ? CG ? A ARG 106 CG 14 1 Y 1 A ARG 105 ? CD ? A ARG 106 CD 15 1 Y 1 A ARG 105 ? NE ? A ARG 106 NE 16 1 Y 1 A ARG 105 ? CZ ? A ARG 106 CZ 17 1 Y 1 A ARG 105 ? NH1 ? A ARG 106 NH1 18 1 Y 1 A ARG 105 ? NH2 ? A ARG 106 NH2 19 1 Y 1 A ARG 217 ? CG ? A ARG 218 CG 20 1 Y 1 A ARG 217 ? CD ? A ARG 218 CD 21 1 Y 1 A ARG 217 ? NE ? A ARG 218 NE 22 1 Y 1 A ARG 217 ? CZ ? A ARG 218 CZ 23 1 Y 1 A ARG 217 ? NH1 ? A ARG 218 NH1 24 1 Y 1 A ARG 217 ? NH2 ? A ARG 218 NH2 25 1 Y 1 A GLU 243 ? CG ? A GLU 244 CG 26 1 Y 1 A GLU 243 ? CD ? A GLU 244 CD 27 1 Y 1 A GLU 243 ? OE1 ? A GLU 244 OE1 28 1 Y 1 A GLU 243 ? OE2 ? A GLU 244 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7ZUN _cell.details ? _cell.formula_units_Z ? _cell.length_a 95.090 _cell.length_a_esd ? _cell.length_b 95.090 _cell.length_b_esd ? _cell.length_c 80.181 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7ZUN _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ZUN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.78 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 3350K, 0.3 M NACL, 0.1 M TRIS-HCL PH 7.6' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type MARRESEARCH _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-11-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7ZUN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 36.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14258 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.4 _reflns.pdbx_Rmerge_I_obs 0.093 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.6 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 6771 _reflns_shell.percent_possible_all 99.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.47 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.807 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.293 _refine.aniso_B[1][2] 0.646 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 1.293 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -4.193 _refine.B_iso_max ? _refine.B_iso_mean 47.926 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.918 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7ZUN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 36.655 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14232 _refine.ls_number_reflns_R_free 716 _refine.ls_number_reflns_R_work 13516 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.150 _refine.ls_percent_reflns_R_free 5.031 _refine.ls_R_factor_all 0.177 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2350 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1744 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1YHS _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.317 _refine.pdbx_overall_ESU_R_Free 0.245 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.666 _refine.overall_SU_ML 0.189 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2186 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 2262 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 36.655 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.013 2277 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.015 2095 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.315 1.654 3099 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.294 1.586 4814 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.620 5.000 268 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.734 21.603 131 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.882 15.000 366 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.234 15.000 18 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.058 0.200 279 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2555 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 547 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.206 0.200 421 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.193 0.200 1995 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 1083 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.079 0.200 970 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.137 0.200 79 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.091 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.240 0.200 6 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.215 0.200 32 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.606 0.200 4 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.644 0.200 1 ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 3.046 5.005 1078 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.045 5.002 1077 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.752 7.491 1344 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.751 7.494 1345 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.256 5.294 1199 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.255 5.294 1200 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.164 7.817 1755 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.163 7.816 1756 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.315 56.072 2490 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 7.318 56.059 2487 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.500 2.565 . . 56 985 99.4269 . . . 0.333 . 0.270 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.565 2.635 . . 47 978 99.4180 . . . 0.336 . 0.248 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.635 2.712 . . 62 936 99.4024 . . . 0.301 . 0.233 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.712 2.795 . . 53 921 99.3878 . . . 0.235 . 0.231 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.795 2.886 . . 47 889 99.4687 . . . 0.214 . 0.202 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.886 2.988 . . 26 854 98.4340 . . . 0.272 . 0.190 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.988 3.100 . . 52 833 99.5501 . . . 0.253 . 0.184 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.100 3.227 . . 23 812 99.4048 . . . 0.296 . 0.181 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.227 3.370 . . 45 768 99.5104 . . . 0.262 . 0.177 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.370 3.534 . . 43 735 99.8716 . . . 0.233 . 0.181 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.534 3.725 . . 40 696 100.0000 . . . 0.215 . 0.174 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.725 3.950 . . 34 670 99.0155 . . . 0.223 . 0.149 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.950 4.222 . . 23 634 99.8480 . . . 0.188 . 0.143 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.222 4.560 . . 24 592 99.0354 . . . 0.210 . 0.128 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.560 4.993 . . 29 532 98.0769 . . . 0.199 . 0.131 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.993 5.580 . . 35 468 98.4344 . . . 0.176 . 0.156 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.580 6.438 . . 42 398 96.4912 . . . 0.251 . 0.172 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.438 7.873 . . 20 367 99.7423 . . . 0.257 . 0.176 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.873 11.084 . . 11 282 97.6667 . . . 0.217 . 0.144 . . . . . . . . . . . 'X-RAY DIFFRACTION' 11.084 36 . . 4 166 96.0452 . . . 0.191 . 0.246 . . . . . . . . . . . # _struct.entry_id 7ZUN _struct.title 'Crystal structure of PIM1 in complex with a Pyrrolo-Pyrazinone compound' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ZUN _struct_keywords.text 'PIM1, ATP BINDING, KINASE INHIBITOR, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIM1-2_HUMAN _struct_ref.pdbx_db_accession P11309-2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELP NGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNC GVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIP FEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; _struct_ref.pdbx_align_begin 93 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7ZUN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 314 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11309-2 _struct_ref_seq.db_align_beg 93 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 404 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 313 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7ZUN GLY A 1 ? UNP P11309-2 ? ? 'expression tag' 0 1 1 7ZUN PRO A 2 ? UNP P11309-2 ? ? 'expression tag' 1 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 34 ? GLN A 38 ? PRO A 33 GLN A 37 1 ? 5 HELX_P HELX_P2 AA2 ASP A 73 ? ILE A 75 ? ASP A 72 ILE A 74 5 ? 3 HELX_P HELX_P3 AA3 MET A 89 ? VAL A 97 ? MET A 88 VAL A 96 1 ? 9 HELX_P HELX_P4 AA4 LEU A 130 ? GLY A 138 ? LEU A 129 GLY A 137 1 ? 9 HELX_P HELX_P5 AA5 GLN A 141 ? CYS A 162 ? GLN A 140 CYS A 161 1 ? 22 HELX_P HELX_P6 AA6 LYS A 170 ? GLU A 172 ? LYS A 169 GLU A 171 5 ? 3 HELX_P HELX_P7 AA7 THR A 205 ? SER A 209 ? THR A 204 SER A 208 5 ? 5 HELX_P HELX_P8 AA8 PRO A 210 ? HIS A 217 ? PRO A 209 HIS A 216 1 ? 8 HELX_P HELX_P9 AA9 HIS A 220 ? GLY A 239 ? HIS A 219 GLY A 238 1 ? 20 HELX_P HELX_P10 AB1 HIS A 245 ? GLY A 252 ? HIS A 244 GLY A 251 1 ? 8 HELX_P HELX_P11 AB2 SER A 261 ? LEU A 272 ? SER A 260 LEU A 271 1 ? 12 HELX_P HELX_P12 AB3 ARG A 275 ? ARG A 279 ? ARG A 274 ARG A 278 5 ? 5 HELX_P HELX_P13 AB4 THR A 281 ? HIS A 288 ? THR A 280 HIS A 287 1 ? 8 HELX_P HELX_P14 AB5 PRO A 289 ? GLN A 292 ? PRO A 288 GLN A 291 5 ? 4 HELX_P HELX_P15 AB6 LEU A 296 ? LEU A 305 ? LEU A 295 LEU A 304 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 261 C ? ? ? 1_555 A SEP 262 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? A SEP 262 C ? ? ? 1_555 A GLU 263 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.339 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id SEP _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 262 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id SEP _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 261 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id SEP _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 125 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 124 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 126 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 125 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.35 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 39 ? LEU A 44 ? TYR A 38 LEU A 43 AA1 2 SER A 52 ? ARG A 58 ? SER A 51 ARG A 57 AA1 3 LEU A 63 ? GLU A 71 ? LEU A 62 GLU A 70 AA1 4 SER A 116 ? GLU A 122 ? SER A 115 GLU A 121 AA1 5 LEU A 107 ? GLU A 112 ? LEU A 106 GLU A 111 AA2 1 TRP A 78 ? GLU A 80 ? TRP A 77 GLU A 79 AA2 2 ARG A 86 ? PRO A 88 ? ARG A 85 PRO A 87 AA3 1 VAL A 127 ? ASP A 129 ? VAL A 126 ASP A 128 AA3 2 ILE A 174 ? ASP A 177 ? ILE A 173 ASP A 176 AA3 3 GLU A 182 ? LEU A 185 ? GLU A 181 LEU A 184 AA4 1 VAL A 164 ? LEU A 165 ? VAL A 163 LEU A 164 AA4 2 ALA A 192 ? LEU A 193 ? ALA A 191 LEU A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 42 ? N GLY A 41 O SER A 55 ? O SER A 54 AA1 2 3 N SER A 52 ? N SER A 51 O HIS A 69 ? O HIS A 68 AA1 3 4 N ALA A 66 ? N ALA A 65 O LEU A 121 ? O LEU A 120 AA1 4 5 O ILE A 120 ? O ILE A 119 N ASP A 109 ? N ASP A 108 AA2 1 2 N GLY A 79 ? N GLY A 78 O VAL A 87 ? O VAL A 86 AA3 1 2 N GLN A 128 ? N GLN A 127 O ILE A 176 ? O ILE A 175 AA3 2 3 N ASP A 177 ? N ASP A 176 O GLU A 182 ? O GLU A 181 AA4 1 2 N LEU A 165 ? N LEU A 164 O ALA A 192 ? O ALA A 191 # _pdbx_entry_details.entry_id 7ZUN _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH11 A ARG 258 ? ? O A HOH 501 ? ? 0.98 2 1 HZ1 A LYS 67 ? ? HO14 A JYO 401 ? ? 1.11 3 1 HZ1 A LYS 169 ? ? HG1 A THR 204 ? ? 1.19 4 1 HD1 A HIS 287 ? ? H A TRP 289 ? ? 1.22 5 1 HD1 A HIS 165 ? ? H A ASP 167 ? ? 1.30 6 1 O A SER 101 ? ? HZ3 A LYS 183 ? ? 1.53 7 1 HG A SER 115 ? ? O A HOH 503 ? ? 1.60 8 1 NH1 A ARG 258 ? ? O A HOH 501 ? ? 1.62 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 82 ? ? -63.57 3.57 2 1 ALA A 138 ? ? -39.95 127.84 3 1 ASP A 167 ? ? -147.49 40.56 4 1 ASP A 186 ? ? 67.55 84.83 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 262 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 261 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A PRO 1 ? A PRO 2 3 1 Y 1 A LEU 2 ? A LEU 3 4 1 Y 1 A LEU 3 ? A LEU 4 5 1 Y 1 A SER 4 ? A SER 5 6 1 Y 1 A LYS 5 ? A LYS 6 7 1 Y 1 A ILE 6 ? A ILE 7 8 1 Y 1 A ASN 7 ? A ASN 8 9 1 Y 1 A SER 8 ? A SER 9 10 1 Y 1 A LEU 9 ? A LEU 10 11 1 Y 1 A ALA 10 ? A ALA 11 12 1 Y 1 A HIS 11 ? A HIS 12 13 1 Y 1 A LEU 12 ? A LEU 13 14 1 Y 1 A ARG 13 ? A ARG 14 15 1 Y 1 A ALA 14 ? A ALA 15 16 1 Y 1 A ALA 15 ? A ALA 16 17 1 Y 1 A PRO 16 ? A PRO 17 18 1 Y 1 A CYS 17 ? A CYS 18 19 1 Y 1 A ASN 18 ? A ASN 19 20 1 Y 1 A ASP 19 ? A ASP 20 21 1 Y 1 A LEU 20 ? A LEU 21 22 1 Y 1 A HIS 21 ? A HIS 22 23 1 Y 1 A ALA 22 ? A ALA 23 24 1 Y 1 A THR 23 ? A THR 24 25 1 Y 1 A LYS 24 ? A LYS 25 26 1 Y 1 A LEU 25 ? A LEU 26 27 1 Y 1 A ALA 26 ? A ALA 27 28 1 Y 1 A PRO 27 ? A PRO 28 29 1 Y 1 A GLY 28 ? A GLY 29 30 1 Y 1 A LYS 29 ? A LYS 30 31 1 Y 1 A GLU 30 ? A GLU 31 32 1 Y 1 A LYS 31 ? A LYS 32 33 1 Y 1 A GLU 32 ? A GLU 33 34 1 Y 1 A SER 46 ? A SER 47 35 1 Y 1 A GLY 47 ? A GLY 48 36 1 Y 1 A GLY 48 ? A GLY 49 37 1 Y 1 A SER 306 ? A SER 307 38 1 Y 1 A LEU 307 ? A LEU 308 39 1 Y 1 A SER 308 ? A SER 309 40 1 Y 1 A PRO 309 ? A PRO 310 41 1 Y 1 A GLY 310 ? A GLY 311 42 1 Y 1 A PRO 311 ? A PRO 312 43 1 Y 1 A SER 312 ? A SER 313 44 1 Y 1 A LYS 313 ? A LYS 314 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 JYO C4 C Y N 183 JYO C6 C N S 184 JYO C7 C N N 185 JYO C10 C Y N 186 JYO C15 C Y N 187 JYO C17 C Y N 188 JYO C26 C Y N 189 JYO C1 C Y N 190 JYO C2 C Y N 191 JYO C3 C Y N 192 JYO C9 C N N 193 JYO C11 C N N 194 JYO C12 C N N 195 JYO C16 C Y N 196 JYO C18 C Y N 197 JYO C25 C Y N 198 JYO F24 F N N 199 JYO C21 C N N 200 JYO F22 F N N 201 JYO F23 F N N 202 JYO O20 O N N 203 JYO C19 C Y N 204 JYO O14 O N N 205 JYO N8 N N N 206 JYO N13 N N N 207 JYO N5 N Y N 208 JYO C27 C Y N 209 JYO C28 C Y N 210 JYO C29 C Y N 211 JYO C30 C Y N 212 JYO H6 H N N 213 JYO H72 H N N 214 JYO H71 H N N 215 JYO H15 H N N 216 JYO H17 H N N 217 JYO H26 H N N 218 JYO H2 H N N 219 JYO H112 H N N 220 JYO H111 H N N 221 JYO H122 H N N 222 JYO H121 H N N 223 JYO H16 H N N 224 JYO H19 H N N 225 JYO HO14 H N N 226 JYO HN12 H N N 227 JYO HN11 H N N 228 JYO H27 H N N 229 JYO H28 H N N 230 JYO H29 H N N 231 JYO H30 H N N 232 LEU N N N N 233 LEU CA C N S 234 LEU C C N N 235 LEU O O N N 236 LEU CB C N N 237 LEU CG C N N 238 LEU CD1 C N N 239 LEU CD2 C N N 240 LEU OXT O N N 241 LEU H H N N 242 LEU H2 H N N 243 LEU HA H N N 244 LEU HB2 H N N 245 LEU HB3 H N N 246 LEU HG H N N 247 LEU HD11 H N N 248 LEU HD12 H N N 249 LEU HD13 H N N 250 LEU HD21 H N N 251 LEU HD22 H N N 252 LEU HD23 H N N 253 LEU HXT H N N 254 LYS N N N N 255 LYS CA C N S 256 LYS C C N N 257 LYS O O N N 258 LYS CB C N N 259 LYS CG C N N 260 LYS CD C N N 261 LYS CE C N N 262 LYS NZ N N N 263 LYS OXT O N N 264 LYS H H N N 265 LYS H2 H N N 266 LYS HA H N N 267 LYS HB2 H N N 268 LYS HB3 H N N 269 LYS HG2 H N N 270 LYS HG3 H N N 271 LYS HD2 H N N 272 LYS HD3 H N N 273 LYS HE2 H N N 274 LYS HE3 H N N 275 LYS HZ1 H N N 276 LYS HZ2 H N N 277 LYS HZ3 H N N 278 LYS HXT H N N 279 MET N N N N 280 MET CA C N S 281 MET C C N N 282 MET O O N N 283 MET CB C N N 284 MET CG C N N 285 MET SD S N N 286 MET CE C N N 287 MET OXT O N N 288 MET H H N N 289 MET H2 H N N 290 MET HA H N N 291 MET HB2 H N N 292 MET HB3 H N N 293 MET HG2 H N N 294 MET HG3 H N N 295 MET HE1 H N N 296 MET HE2 H N N 297 MET HE3 H N N 298 MET HXT H N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SEP N N N N 340 SEP CA C N S 341 SEP CB C N N 342 SEP OG O N N 343 SEP C C N N 344 SEP O O N N 345 SEP OXT O N N 346 SEP P P N N 347 SEP O1P O N N 348 SEP O2P O N N 349 SEP O3P O N N 350 SEP H H N N 351 SEP H2 H N N 352 SEP HA H N N 353 SEP HB2 H N N 354 SEP HB3 H N N 355 SEP HXT H N N 356 SEP HOP2 H N N 357 SEP HOP3 H N N 358 SER N N N N 359 SER CA C N S 360 SER C C N N 361 SER O O N N 362 SER CB C N N 363 SER OG O N N 364 SER OXT O N N 365 SER H H N N 366 SER H2 H N N 367 SER HA H N N 368 SER HB2 H N N 369 SER HB3 H N N 370 SER HG H N N 371 SER HXT H N N 372 THR N N N N 373 THR CA C N S 374 THR C C N N 375 THR O O N N 376 THR CB C N R 377 THR OG1 O N N 378 THR CG2 C N N 379 THR OXT O N N 380 THR H H N N 381 THR H2 H N N 382 THR HA H N N 383 THR HB H N N 384 THR HG1 H N N 385 THR HG21 H N N 386 THR HG22 H N N 387 THR HG23 H N N 388 THR HXT H N N 389 TRP N N N N 390 TRP CA C N S 391 TRP C C N N 392 TRP O O N N 393 TRP CB C N N 394 TRP CG C Y N 395 TRP CD1 C Y N 396 TRP CD2 C Y N 397 TRP NE1 N Y N 398 TRP CE2 C Y N 399 TRP CE3 C Y N 400 TRP CZ2 C Y N 401 TRP CZ3 C Y N 402 TRP CH2 C Y N 403 TRP OXT O N N 404 TRP H H N N 405 TRP H2 H N N 406 TRP HA H N N 407 TRP HB2 H N N 408 TRP HB3 H N N 409 TRP HD1 H N N 410 TRP HE1 H N N 411 TRP HE3 H N N 412 TRP HZ2 H N N 413 TRP HZ3 H N N 414 TRP HH2 H N N 415 TRP HXT H N N 416 TYR N N N N 417 TYR CA C N S 418 TYR C C N N 419 TYR O O N N 420 TYR CB C N N 421 TYR CG C Y N 422 TYR CD1 C Y N 423 TYR CD2 C Y N 424 TYR CE1 C Y N 425 TYR CE2 C Y N 426 TYR CZ C Y N 427 TYR OH O N N 428 TYR OXT O N N 429 TYR H H N N 430 TYR H2 H N N 431 TYR HA H N N 432 TYR HB2 H N N 433 TYR HB3 H N N 434 TYR HD1 H N N 435 TYR HD2 H N N 436 TYR HE1 H N N 437 TYR HE2 H N N 438 TYR HH H N N 439 TYR HXT H N N 440 VAL N N N N 441 VAL CA C N S 442 VAL C C N N 443 VAL O O N N 444 VAL CB C N N 445 VAL CG1 C N N 446 VAL CG2 C N N 447 VAL OXT O N N 448 VAL H H N N 449 VAL H2 H N N 450 VAL HA H N N 451 VAL HB H N N 452 VAL HG11 H N N 453 VAL HG12 H N N 454 VAL HG13 H N N 455 VAL HG21 H N N 456 VAL HG22 H N N 457 VAL HG23 H N N 458 VAL HXT H N N 459 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 JYO C28 C29 doub Y N 173 JYO C28 C27 sing Y N 174 JYO N13 C12 sing N N 175 JYO C29 C30 sing Y N 176 JYO C27 C26 doub Y N 177 JYO C12 C11 sing N N 178 JYO C30 C25 doub Y N 179 JYO C26 C25 sing Y N 180 JYO C25 C1 sing N N 181 JYO C11 C6 sing N N 182 JYO F22 C21 sing N N 183 JYO C6 C7 sing N N 184 JYO C6 N5 sing N N 185 JYO F24 C21 sing N N 186 JYO C7 N8 sing N N 187 JYO C21 F23 sing N N 188 JYO C21 O20 sing N N 189 JYO C1 N5 sing Y N 190 JYO C1 C3 doub Y N 191 JYO N5 C4 sing Y N 192 JYO O20 C18 sing N N 193 JYO N8 C9 doub N N 194 JYO C19 C18 doub Y N 195 JYO C19 C10 sing Y N 196 JYO C4 C9 sing N N 197 JYO C4 C2 doub Y N 198 JYO C3 C10 sing N N 199 JYO C3 C2 sing Y N 200 JYO C18 C17 sing Y N 201 JYO C9 O14 sing N N 202 JYO C10 C15 doub Y N 203 JYO C17 C16 doub Y N 204 JYO C15 C16 sing Y N 205 JYO C6 H6 sing N N 206 JYO C7 H72 sing N N 207 JYO C7 H71 sing N N 208 JYO C15 H15 sing N N 209 JYO C17 H17 sing N N 210 JYO C26 H26 sing N N 211 JYO C2 H2 sing N N 212 JYO C11 H112 sing N N 213 JYO C11 H111 sing N N 214 JYO C12 H122 sing N N 215 JYO C12 H121 sing N N 216 JYO C16 H16 sing N N 217 JYO C19 H19 sing N N 218 JYO O14 HO14 sing N N 219 JYO N13 HN12 sing N N 220 JYO N13 HN11 sing N N 221 JYO C27 H27 sing N N 222 JYO C28 H28 sing N N 223 JYO C29 H29 sing N N 224 JYO C30 H30 sing N N 225 LEU N CA sing N N 226 LEU N H sing N N 227 LEU N H2 sing N N 228 LEU CA C sing N N 229 LEU CA CB sing N N 230 LEU CA HA sing N N 231 LEU C O doub N N 232 LEU C OXT sing N N 233 LEU CB CG sing N N 234 LEU CB HB2 sing N N 235 LEU CB HB3 sing N N 236 LEU CG CD1 sing N N 237 LEU CG CD2 sing N N 238 LEU CG HG sing N N 239 LEU CD1 HD11 sing N N 240 LEU CD1 HD12 sing N N 241 LEU CD1 HD13 sing N N 242 LEU CD2 HD21 sing N N 243 LEU CD2 HD22 sing N N 244 LEU CD2 HD23 sing N N 245 LEU OXT HXT sing N N 246 LYS N CA sing N N 247 LYS N H sing N N 248 LYS N H2 sing N N 249 LYS CA C sing N N 250 LYS CA CB sing N N 251 LYS CA HA sing N N 252 LYS C O doub N N 253 LYS C OXT sing N N 254 LYS CB CG sing N N 255 LYS CB HB2 sing N N 256 LYS CB HB3 sing N N 257 LYS CG CD sing N N 258 LYS CG HG2 sing N N 259 LYS CG HG3 sing N N 260 LYS CD CE sing N N 261 LYS CD HD2 sing N N 262 LYS CD HD3 sing N N 263 LYS CE NZ sing N N 264 LYS CE HE2 sing N N 265 LYS CE HE3 sing N N 266 LYS NZ HZ1 sing N N 267 LYS NZ HZ2 sing N N 268 LYS NZ HZ3 sing N N 269 LYS OXT HXT sing N N 270 MET N CA sing N N 271 MET N H sing N N 272 MET N H2 sing N N 273 MET CA C sing N N 274 MET CA CB sing N N 275 MET CA HA sing N N 276 MET C O doub N N 277 MET C OXT sing N N 278 MET CB CG sing N N 279 MET CB HB2 sing N N 280 MET CB HB3 sing N N 281 MET CG SD sing N N 282 MET CG HG2 sing N N 283 MET CG HG3 sing N N 284 MET SD CE sing N N 285 MET CE HE1 sing N N 286 MET CE HE2 sing N N 287 MET CE HE3 sing N N 288 MET OXT HXT sing N N 289 PHE N CA sing N N 290 PHE N H sing N N 291 PHE N H2 sing N N 292 PHE CA C sing N N 293 PHE CA CB sing N N 294 PHE CA HA sing N N 295 PHE C O doub N N 296 PHE C OXT sing N N 297 PHE CB CG sing N N 298 PHE CB HB2 sing N N 299 PHE CB HB3 sing N N 300 PHE CG CD1 doub Y N 301 PHE CG CD2 sing Y N 302 PHE CD1 CE1 sing Y N 303 PHE CD1 HD1 sing N N 304 PHE CD2 CE2 doub Y N 305 PHE CD2 HD2 sing N N 306 PHE CE1 CZ doub Y N 307 PHE CE1 HE1 sing N N 308 PHE CE2 CZ sing Y N 309 PHE CE2 HE2 sing N N 310 PHE CZ HZ sing N N 311 PHE OXT HXT sing N N 312 PRO N CA sing N N 313 PRO N CD sing N N 314 PRO N H sing N N 315 PRO CA C sing N N 316 PRO CA CB sing N N 317 PRO CA HA sing N N 318 PRO C O doub N N 319 PRO C OXT sing N N 320 PRO CB CG sing N N 321 PRO CB HB2 sing N N 322 PRO CB HB3 sing N N 323 PRO CG CD sing N N 324 PRO CG HG2 sing N N 325 PRO CG HG3 sing N N 326 PRO CD HD2 sing N N 327 PRO CD HD3 sing N N 328 PRO OXT HXT sing N N 329 SEP N CA sing N N 330 SEP N H sing N N 331 SEP N H2 sing N N 332 SEP CA CB sing N N 333 SEP CA C sing N N 334 SEP CA HA sing N N 335 SEP CB OG sing N N 336 SEP CB HB2 sing N N 337 SEP CB HB3 sing N N 338 SEP OG P sing N N 339 SEP C O doub N N 340 SEP C OXT sing N N 341 SEP OXT HXT sing N N 342 SEP P O1P doub N N 343 SEP P O2P sing N N 344 SEP P O3P sing N N 345 SEP O2P HOP2 sing N N 346 SEP O3P HOP3 sing N N 347 SER N CA sing N N 348 SER N H sing N N 349 SER N H2 sing N N 350 SER CA C sing N N 351 SER CA CB sing N N 352 SER CA HA sing N N 353 SER C O doub N N 354 SER C OXT sing N N 355 SER CB OG sing N N 356 SER CB HB2 sing N N 357 SER CB HB3 sing N N 358 SER OG HG sing N N 359 SER OXT HXT sing N N 360 THR N CA sing N N 361 THR N H sing N N 362 THR N H2 sing N N 363 THR CA C sing N N 364 THR CA CB sing N N 365 THR CA HA sing N N 366 THR C O doub N N 367 THR C OXT sing N N 368 THR CB OG1 sing N N 369 THR CB CG2 sing N N 370 THR CB HB sing N N 371 THR OG1 HG1 sing N N 372 THR CG2 HG21 sing N N 373 THR CG2 HG22 sing N N 374 THR CG2 HG23 sing N N 375 THR OXT HXT sing N N 376 TRP N CA sing N N 377 TRP N H sing N N 378 TRP N H2 sing N N 379 TRP CA C sing N N 380 TRP CA CB sing N N 381 TRP CA HA sing N N 382 TRP C O doub N N 383 TRP C OXT sing N N 384 TRP CB CG sing N N 385 TRP CB HB2 sing N N 386 TRP CB HB3 sing N N 387 TRP CG CD1 doub Y N 388 TRP CG CD2 sing Y N 389 TRP CD1 NE1 sing Y N 390 TRP CD1 HD1 sing N N 391 TRP CD2 CE2 doub Y N 392 TRP CD2 CE3 sing Y N 393 TRP NE1 CE2 sing Y N 394 TRP NE1 HE1 sing N N 395 TRP CE2 CZ2 sing Y N 396 TRP CE3 CZ3 doub Y N 397 TRP CE3 HE3 sing N N 398 TRP CZ2 CH2 doub Y N 399 TRP CZ2 HZ2 sing N N 400 TRP CZ3 CH2 sing Y N 401 TRP CZ3 HZ3 sing N N 402 TRP CH2 HH2 sing N N 403 TRP OXT HXT sing N N 404 TYR N CA sing N N 405 TYR N H sing N N 406 TYR N H2 sing N N 407 TYR CA C sing N N 408 TYR CA CB sing N N 409 TYR CA HA sing N N 410 TYR C O doub N N 411 TYR C OXT sing N N 412 TYR CB CG sing N N 413 TYR CB HB2 sing N N 414 TYR CB HB3 sing N N 415 TYR CG CD1 doub Y N 416 TYR CG CD2 sing Y N 417 TYR CD1 CE1 sing Y N 418 TYR CD1 HD1 sing N N 419 TYR CD2 CE2 doub Y N 420 TYR CD2 HD2 sing N N 421 TYR CE1 CZ doub Y N 422 TYR CE1 HE1 sing N N 423 TYR CE2 CZ sing Y N 424 TYR CE2 HE2 sing N N 425 TYR CZ OH sing N N 426 TYR OH HH sing N N 427 TYR OXT HXT sing N N 428 VAL N CA sing N N 429 VAL N H sing N N 430 VAL N H2 sing N N 431 VAL CA C sing N N 432 VAL CA CB sing N N 433 VAL CA HA sing N N 434 VAL C O doub N N 435 VAL C OXT sing N N 436 VAL CB CG1 sing N N 437 VAL CB CG2 sing N N 438 VAL CB HB sing N N 439 VAL CG1 HG11 sing N N 440 VAL CG1 HG12 sing N N 441 VAL CG1 HG13 sing N N 442 VAL CG2 HG21 sing N N 443 VAL CG2 HG22 sing N N 444 VAL CG2 HG23 sing N N 445 VAL OXT HXT sing N N 446 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1YHS _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7ZUN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010516 _atom_sites.fract_transf_matrix[1][2] 0.006072 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012143 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012472 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 F 9 9 3.539 10.282 2.641 4.294 1.517 0.262 1.024 26.148 0.304 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 P 15 15 6.435 1.907 4.179 27.157 1.780 0.526 1.491 68.164 1.267 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.049 # loop_