data_8A3P # _entry.id 8A3P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8A3P pdb_00008a3p 10.2210/pdb8a3p/pdb WWPDB D_1292122997 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-29 2 'Structure model' 1 1 2022-07-20 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' struct 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct.title' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ASTM' 5 3 'Structure model' '_citation.journal_id_CSD' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation.pdbx_database_id_DOI' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation.year' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 3 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8A3P _pdbx_database_status.recvd_initial_deposition_date 2022-06-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'core particle of the FERRY complex' _pdbx_database_related.db_id 7ND2 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email zerial@mpi-cbg.de _pdbx_contact_author.name_first Marino _pdbx_contact_author.name_last Zerial _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7490-4235 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schuhmacher, J.S.' 1 0000-0002-4437-9687 'Zerial, M.' 2 0000-0002-7490-4235 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 83 _citation.language ? _citation.page_first 1856 _citation.page_last 1871.e9 _citation.title 'Structural basis of mRNA binding by the human FERRY Rab5 effector complex.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2023.05.009 _citation.pdbx_database_id_PubMed 37267906 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Quentin, D.' 1 ? primary 'Schuhmacher, J.S.' 2 ? primary 'Klink, B.U.' 3 ? primary 'Lauer, J.' 4 ? primary 'Shaikh, T.R.' 5 ? primary ;Huis In 't Veld, P.J. ; 6 ? primary 'Welp, L.M.' 7 ? primary 'Urlaub, H.' 8 ? primary 'Zerial, M.' 9 ? primary 'Raunser, S.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Glutamine amidotransferase-like class 1 domain-containing protein 1' _entity.formula_weight 23321.529 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Parkinson disease 7 domain-containing protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESNARWVQDFRLKAYASPAKLES IDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKPICAVGHGVAALCCATNEDRSWVFDSYSLTGPSVCELVRAP GFARLPLVVEDFVKDSGACFSASEPDAVHVVLDRHLVTGQNASSTVPAVQNLLFLCGSRK ; _entity_poly.pdbx_seq_one_letter_code_can ;MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESNARWVQDFRLKAYASPAKLES IDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKPICAVGHGVAALCCATNEDRSWVFDSYSLTGPSVCELVRAP GFARLPLVVEDFVKDSGACFSASEPDAVHVVLDRHLVTGQNASSTVPAVQNLLFLCGSRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 GLU n 1 5 ARG n 1 6 LEU n 1 7 PRO n 1 8 ASN n 1 9 ARG n 1 10 PRO n 1 11 ALA n 1 12 CYS n 1 13 LEU n 1 14 LEU n 1 15 VAL n 1 16 ALA n 1 17 SER n 1 18 GLY n 1 19 ALA n 1 20 ALA n 1 21 GLU n 1 22 GLY n 1 23 VAL n 1 24 SER n 1 25 ALA n 1 26 GLN n 1 27 SER n 1 28 PHE n 1 29 LEU n 1 30 HIS n 1 31 CYS n 1 32 PHE n 1 33 THR n 1 34 MET n 1 35 ALA n 1 36 SER n 1 37 THR n 1 38 ALA n 1 39 PHE n 1 40 ASN n 1 41 LEU n 1 42 GLN n 1 43 VAL n 1 44 ALA n 1 45 THR n 1 46 PRO n 1 47 GLY n 1 48 GLY n 1 49 LYS n 1 50 ALA n 1 51 MET n 1 52 GLU n 1 53 PHE n 1 54 VAL n 1 55 ASP n 1 56 VAL n 1 57 THR n 1 58 GLU n 1 59 SER n 1 60 ASN n 1 61 ALA n 1 62 ARG n 1 63 TRP n 1 64 VAL n 1 65 GLN n 1 66 ASP n 1 67 PHE n 1 68 ARG n 1 69 LEU n 1 70 LYS n 1 71 ALA n 1 72 TYR n 1 73 ALA n 1 74 SER n 1 75 PRO n 1 76 ALA n 1 77 LYS n 1 78 LEU n 1 79 GLU n 1 80 SER n 1 81 ILE n 1 82 ASP n 1 83 GLY n 1 84 ALA n 1 85 ARG n 1 86 TYR n 1 87 HIS n 1 88 ALA n 1 89 LEU n 1 90 LEU n 1 91 ILE n 1 92 PRO n 1 93 SER n 1 94 CYS n 1 95 PRO n 1 96 GLY n 1 97 ALA n 1 98 LEU n 1 99 THR n 1 100 ASP n 1 101 LEU n 1 102 ALA n 1 103 SER n 1 104 SER n 1 105 GLY n 1 106 SER n 1 107 LEU n 1 108 ALA n 1 109 ARG n 1 110 ILE n 1 111 LEU n 1 112 GLN n 1 113 HIS n 1 114 PHE n 1 115 HIS n 1 116 SER n 1 117 GLU n 1 118 SER n 1 119 LYS n 1 120 PRO n 1 121 ILE n 1 122 CYS n 1 123 ALA n 1 124 VAL n 1 125 GLY n 1 126 HIS n 1 127 GLY n 1 128 VAL n 1 129 ALA n 1 130 ALA n 1 131 LEU n 1 132 CYS n 1 133 CYS n 1 134 ALA n 1 135 THR n 1 136 ASN n 1 137 GLU n 1 138 ASP n 1 139 ARG n 1 140 SER n 1 141 TRP n 1 142 VAL n 1 143 PHE n 1 144 ASP n 1 145 SER n 1 146 TYR n 1 147 SER n 1 148 LEU n 1 149 THR n 1 150 GLY n 1 151 PRO n 1 152 SER n 1 153 VAL n 1 154 CYS n 1 155 GLU n 1 156 LEU n 1 157 VAL n 1 158 ARG n 1 159 ALA n 1 160 PRO n 1 161 GLY n 1 162 PHE n 1 163 ALA n 1 164 ARG n 1 165 LEU n 1 166 PRO n 1 167 LEU n 1 168 VAL n 1 169 VAL n 1 170 GLU n 1 171 ASP n 1 172 PHE n 1 173 VAL n 1 174 LYS n 1 175 ASP n 1 176 SER n 1 177 GLY n 1 178 ALA n 1 179 CYS n 1 180 PHE n 1 181 SER n 1 182 ALA n 1 183 SER n 1 184 GLU n 1 185 PRO n 1 186 ASP n 1 187 ALA n 1 188 VAL n 1 189 HIS n 1 190 VAL n 1 191 VAL n 1 192 LEU n 1 193 ASP n 1 194 ARG n 1 195 HIS n 1 196 LEU n 1 197 VAL n 1 198 THR n 1 199 GLY n 1 200 GLN n 1 201 ASN n 1 202 ALA n 1 203 SER n 1 204 SER n 1 205 THR n 1 206 VAL n 1 207 PRO n 1 208 ALA n 1 209 VAL n 1 210 GLN n 1 211 ASN n 1 212 LEU n 1 213 LEU n 1 214 PHE n 1 215 LEU n 1 216 CYS n 1 217 GLY n 1 218 SER n 1 219 ARG n 1 220 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 220 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GATD1, PDDC1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 CYS 154 154 154 CYS CYS A . n A 1 155 GLU 155 155 ? ? ? A . n A 1 156 LEU 156 156 ? ? ? A . n A 1 157 VAL 157 157 ? ? ? A . n A 1 158 ARG 158 158 ? ? ? A . n A 1 159 ALA 159 159 ? ? ? A . n A 1 160 PRO 160 160 ? ? ? A . n A 1 161 GLY 161 161 ? ? ? A . n A 1 162 PHE 162 162 ? ? ? A . n A 1 163 ALA 163 163 ? ? ? A . n A 1 164 ARG 164 164 ? ? ? A . n A 1 165 LEU 165 165 ? ? ? A . n A 1 166 PRO 166 166 ? ? ? A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 GLY 177 177 ? ? ? A . n A 1 178 ALA 178 178 ? ? ? A . n A 1 179 CYS 179 179 ? ? ? A . n A 1 180 PHE 180 180 ? ? ? A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 HIS 189 189 189 HIS HIS A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 CYS 216 216 216 CYS CYS A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 SER 218 218 ? ? ? A . n A 1 219 ARG 219 219 ? ? ? A . n A 1 220 LYS 220 220 ? ? ? A . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 2 ? 'data scaling' ? ? 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 2013/01/04 ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/scala.html ? SCALA ? ? other 3.3.21 3 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk ? ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Oct. 31, 2020' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8A3P _cell.details ? _cell.formula_units_Z ? _cell.length_a 94.619 _cell.length_a_esd ? _cell.length_b 99.573 _cell.length_b_esd ? _cell.length_c 62.158 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8A3P _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8A3P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES, pH 5.0, 0.8 M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.968 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.968 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 62.160 _reflns.entry_id 8A3P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 47.310 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 8339 _reflns.number_obs 8339 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.600 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.088 _reflns.pdbx_netI_over_av_sigmaI 5.500 _reflns.pdbx_netI_over_sigmaI 13.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.094 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 79865 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.700 2.850 ? 1.200 12118 ? ? ? 1205 99.900 ? ? ? ? 0.603 ? ? ? ? ? ? ? ? 10.100 0.603 ? ? 3.200 0.636 0.201 ? 1 1 ? ? ? ? ? ? ? ? ? ? ? 2.850 3.020 ? 1.600 11259 ? ? ? 1133 99.900 ? ? ? ? 0.453 ? ? ? ? ? ? ? ? 9.900 0.453 ? ? 4.100 0.479 0.153 ? 2 1 ? ? ? ? ? ? ? ? ? ? ? 3.020 3.230 ? 2.700 10518 ? ? ? 1063 100.000 ? ? ? ? 0.266 ? ? ? ? ? ? ? ? 9.900 0.266 ? ? 6.200 0.281 0.091 ? 3 1 ? ? ? ? ? ? ? ? ? ? ? 3.230 3.490 ? 4.600 9737 ? ? ? 1002 100.000 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 9.700 0.146 ? ? 10.100 0.155 0.051 ? 4 1 ? ? ? ? ? ? ? ? ? ? ? 3.490 3.820 ? 6.000 8779 ? ? ? 928 100.000 ? ? ? ? 0.101 ? ? ? ? ? ? ? ? 9.500 0.101 ? ? 14.600 0.108 0.036 ? 5 1 ? ? ? ? ? ? ? ? ? ? ? 3.820 4.270 ? 6.700 7544 ? ? ? 832 100.000 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 9.100 0.086 ? ? 19.000 0.091 0.031 ? 6 1 ? ? ? ? ? ? ? ? ? ? ? 4.270 4.930 ? 9.300 6160 ? ? ? 721 96.100 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 8.500 0.062 ? ? 24.100 0.066 0.023 ? 7 1 ? ? ? ? ? ? ? ? ? ? ? 4.930 6.040 ? 9.800 6307 ? ? ? 639 100.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 9.900 0.065 ? ? 24.300 0.068 0.022 ? 8 1 ? ? ? ? ? ? ? ? ? ? ? 6.040 8.540 ? 10.400 4917 ? ? ? 513 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 9.600 0.058 ? ? 28.100 0.061 0.020 ? 9 1 ? ? ? ? ? ? ? ? ? ? ? 8.540 47.310 ? 10.100 2526 ? ? ? 303 99.400 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 8.300 0.047 ? ? 33.600 0.050 0.017 ? 10 1 ? ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 172.970 _refine.B_iso_mean 85.7001 _refine.B_iso_min 48.300 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8A3P _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7000 _refine.ls_d_res_low 47.3090 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8293 _refine.ls_number_reflns_R_free 837 _refine.ls_number_reflns_R_work 7456 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0800 _refine.ls_percent_reflns_R_free 10.0900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2247 _refine.ls_R_factor_R_free 0.2668 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2198 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1u9c _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.3200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7000 _refine_hist.d_res_low 47.3090 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1426 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 193 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1426 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1455 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.894 ? 1980 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 233 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 256 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.958 ? 863 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7003 2.8694 . . 133 1223 99.0000 . . . 0.3455 0.0000 0.2949 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8694 3.0909 . . 141 1214 99.0000 . . . 0.3202 0.0000 0.2756 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0909 3.4019 . . 130 1233 100.0000 . . . 0.2773 0.0000 0.2399 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4019 3.8940 . . 147 1239 100.0000 . . . 0.2888 0.0000 0.2278 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8940 4.9052 . . 135 1230 97.0000 . . . 0.2154 0.0000 0.1800 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.9052 47.3090 . . 151 1317 100.0000 . . . 0.2700 0.0000 0.2180 . . . . . . . . . . . # _struct.entry_id 8A3P _struct.title 'Structure of human Fy-5.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8A3P _struct_keywords.text 'FERRY complex, RNA binding, RNA transport, early endosome, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GALD1_HUMAN _struct_ref.pdbx_db_accession Q8NB37 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESNARWVQDFRLKAYASPAKLES IDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKPICAVGHGVAALCCATNEDRSWVFDSYSLTGPSVCELVRAP GFARLPLVVEDFVKDSGACFSASEPDAVHVVLDRHLVTGQNASSTVPAVQNLLFLCGSRK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8A3P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 220 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8NB37 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 220 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 220 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'cryoEM structure 7ND2' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 25 ? THR A 37 ? ALA A 25 THR A 37 1 ? 13 HELX_P HELX_P2 AA2 PRO A 46 ? LYS A 49 ? PRO A 46 LYS A 49 5 ? 4 HELX_P HELX_P3 AA3 ASN A 60 ? ARG A 68 ? ASN A 60 ARG A 68 1 ? 9 HELX_P HELX_P4 AA4 LEU A 69 ? SER A 74 ? LEU A 69 SER A 74 5 ? 6 HELX_P HELX_P5 AA5 GLU A 79 ? ILE A 81 ? GLU A 79 ILE A 81 5 ? 3 HELX_P HELX_P6 AA6 ASP A 82 ? TYR A 86 ? ASP A 82 TYR A 86 5 ? 5 HELX_P HELX_P7 AA7 GLY A 96 ? LEU A 101 ? GLY A 96 LEU A 101 1 ? 6 HELX_P HELX_P8 AA8 SER A 104 ? GLU A 117 ? SER A 104 GLU A 117 1 ? 14 HELX_P HELX_P9 AA9 HIS A 126 ? ALA A 134 ? HIS A 126 ALA A 134 5 ? 9 HELX_P HELX_P10 AB1 ASP A 171 ? SER A 176 ? ASP A 171 SER A 176 1 ? 6 HELX_P HELX_P11 AB2 ASN A 201 ? SER A 203 ? ASN A 201 SER A 203 5 ? 3 HELX_P HELX_P12 AB3 SER A 204 ? CYS A 216 ? SER A 204 CYS A 216 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA2 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 76 ? LYS A 77 ? ALA A 76 LYS A 77 AA1 2 ASN A 40 ? THR A 45 ? ASN A 40 THR A 45 AA1 3 ALA A 11 ? VAL A 15 ? ALA A 11 VAL A 15 AA1 4 ALA A 88 ? ILE A 91 ? ALA A 88 ILE A 91 AA1 5 ILE A 121 ? VAL A 124 ? ILE A 121 VAL A 124 AA1 6 LEU A 196 ? GLY A 199 ? LEU A 196 GLY A 199 AA1 7 VAL A 190 ? ASP A 193 ? VAL A 190 ASP A 193 AA2 1 VAL A 23 ? SER A 24 ? VAL A 23 SER A 24 AA2 2 PHE A 53 ? VAL A 54 ? PHE A 53 VAL A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 76 ? O ALA A 76 N VAL A 43 ? N VAL A 43 AA1 2 3 O GLN A 42 ? O GLN A 42 N LEU A 14 ? N LEU A 14 AA1 3 4 N LEU A 13 ? N LEU A 13 O ALA A 88 ? O ALA A 88 AA1 4 5 N ILE A 91 ? N ILE A 91 O CYS A 122 ? O CYS A 122 AA1 5 6 N ILE A 121 ? N ILE A 121 O VAL A 197 ? O VAL A 197 AA1 6 7 O LEU A 196 ? O LEU A 196 N ASP A 193 ? N ASP A 193 AA2 1 2 N VAL A 23 ? N VAL A 23 O VAL A 54 ? O VAL A 54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 21 ? ? -116.99 66.68 2 1 PHE A 143 ? ? -91.51 55.12 3 1 SER A 183 ? ? -117.49 -87.69 4 1 ARG A 194 ? ? 50.44 -99.62 # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A GLU 155 ? A GLU 155 10 1 Y 1 A LEU 156 ? A LEU 156 11 1 Y 1 A VAL 157 ? A VAL 157 12 1 Y 1 A ARG 158 ? A ARG 158 13 1 Y 1 A ALA 159 ? A ALA 159 14 1 Y 1 A PRO 160 ? A PRO 160 15 1 Y 1 A GLY 161 ? A GLY 161 16 1 Y 1 A PHE 162 ? A PHE 162 17 1 Y 1 A ALA 163 ? A ALA 163 18 1 Y 1 A ARG 164 ? A ARG 164 19 1 Y 1 A LEU 165 ? A LEU 165 20 1 Y 1 A PRO 166 ? A PRO 166 21 1 Y 1 A GLY 177 ? A GLY 177 22 1 Y 1 A ALA 178 ? A ALA 178 23 1 Y 1 A CYS 179 ? A CYS 179 24 1 Y 1 A PHE 180 ? A PHE 180 25 1 Y 1 A SER 218 ? A SER 218 26 1 Y 1 A ARG 219 ? A ARG 219 27 1 Y 1 A LYS 220 ? A LYS 220 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'German Research Foundation (DFG)' Germany 112927078 1 'Max Planck Society' Germany ? 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1U9C _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8A3P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010569 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010043 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016088 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #