data_8A9L # _entry.id 8A9L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8A9L pdb_00008a9l 10.2210/pdb8a9l/pdb WWPDB D_1292123999 ? ? EMDB EMD-15285 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details ;Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease and dementia with Lewy bodies ; _pdbx_database_related.db_id EMD-15285 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8A9L _pdbx_database_status.recvd_initial_deposition_date 2022-06-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yang, Y.' 1 0000-0003-2238-6437 'Shi, Y.' 2 ? 'Schweighauser, M.' 3 ? 'Zhang, X.J.' 4 ? 'Kotecha, A.' 5 ? 'Murzin, A.G.' 6 ? 'Garringer, H.J.' 7 ? 'Cullinane, P.' 8 ? 'Saito, Y.' 9 ? 'Foroud, T.' 10 ? 'Warner, T.T.' 11 ? 'Hasegawa, K.' 12 ? 'Vidal, R.' 13 ? 'Murayama, S.' 14 ? 'Revesz, T.' 15 ? 'Ghetti, B.' 16 ? 'Hasegawa, M.' 17 ? 'Lashley, T.' 18 ? 'Scheres, H.W.S.' 19 ? 'Goedert, M.' 20 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 610 _citation.language ? _citation.page_first 791 _citation.page_last 795 _citation.title 'Structures of alpha-synuclein filaments from human brains with Lewy pathology.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-022-05319-3 _citation.pdbx_database_id_PubMed 36108674 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, Y.' 1 ? primary 'Shi, Y.' 2 ? primary 'Schweighauser, M.' 3 ? primary 'Zhang, X.' 4 ? primary 'Kotecha, A.' 5 ? primary 'Murzin, A.G.' 6 ? primary 'Garringer, H.J.' 7 ? primary 'Cullinane, P.W.' 8 ? primary 'Saito, Y.' 9 ? primary 'Foroud, T.' 10 ? primary 'Warner, T.T.' 11 ? primary 'Hasegawa, K.' 12 ? primary 'Vidal, R.' 13 ? primary 'Murayama, S.' 14 ? primary 'Revesz, T.' 15 ? primary 'Ghetti, B.' 16 ? primary 'Hasegawa, M.' 17 ? primary 'Lashley, T.' 18 ? primary 'Scheres, S.H.W.' 19 ? primary 'Goedert, M.' 20 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8A9L _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8A9L _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Alpha-synuclein 14476.108 1 ? ? ? ? 2 polymer nat 'Unknown fragment' 783.958 1 ? ? ? ? 3 polymer nat 'Unknown fragment' 627.775 1 ? ? ? ? 4 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; A ? 2 'polypeptide(L)' no no '(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)' XXXXXXXXX B ? 3 'polypeptide(L)' no no '(UNK)(UNK)(UNK)(UNK)V(UNK)(UNK)' XXXXVXX C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 VAL n 1 4 PHE n 1 5 MET n 1 6 LYS n 1 7 GLY n 1 8 LEU n 1 9 SER n 1 10 LYS n 1 11 ALA n 1 12 LYS n 1 13 GLU n 1 14 GLY n 1 15 VAL n 1 16 VAL n 1 17 ALA n 1 18 ALA n 1 19 ALA n 1 20 GLU n 1 21 LYS n 1 22 THR n 1 23 LYS n 1 24 GLN n 1 25 GLY n 1 26 VAL n 1 27 ALA n 1 28 GLU n 1 29 ALA n 1 30 ALA n 1 31 GLY n 1 32 LYS n 1 33 THR n 1 34 LYS n 1 35 GLU n 1 36 GLY n 1 37 VAL n 1 38 LEU n 1 39 TYR n 1 40 VAL n 1 41 GLY n 1 42 SER n 1 43 LYS n 1 44 THR n 1 45 LYS n 1 46 GLU n 1 47 GLY n 1 48 VAL n 1 49 VAL n 1 50 HIS n 1 51 GLY n 1 52 VAL n 1 53 ALA n 1 54 THR n 1 55 VAL n 1 56 ALA n 1 57 GLU n 1 58 LYS n 1 59 THR n 1 60 LYS n 1 61 GLU n 1 62 GLN n 1 63 VAL n 1 64 THR n 1 65 ASN n 1 66 VAL n 1 67 GLY n 1 68 GLY n 1 69 ALA n 1 70 VAL n 1 71 VAL n 1 72 THR n 1 73 GLY n 1 74 VAL n 1 75 THR n 1 76 ALA n 1 77 VAL n 1 78 ALA n 1 79 GLN n 1 80 LYS n 1 81 THR n 1 82 VAL n 1 83 GLU n 1 84 GLY n 1 85 ALA n 1 86 GLY n 1 87 SER n 1 88 ILE n 1 89 ALA n 1 90 ALA n 1 91 ALA n 1 92 THR n 1 93 GLY n 1 94 PHE n 1 95 VAL n 1 96 LYS n 1 97 LYS n 1 98 ASP n 1 99 GLN n 1 100 LEU n 1 101 GLY n 1 102 LYS n 1 103 ASN n 1 104 GLU n 1 105 GLU n 1 106 GLY n 1 107 ALA n 1 108 PRO n 1 109 GLN n 1 110 GLU n 1 111 GLY n 1 112 ILE n 1 113 LEU n 1 114 GLU n 1 115 ASP n 1 116 MET n 1 117 PRO n 1 118 VAL n 1 119 ASP n 1 120 PRO n 1 121 ASP n 1 122 ASN n 1 123 GLU n 1 124 ALA n 1 125 TYR n 1 126 GLU n 1 127 MET n 1 128 PRO n 1 129 SER n 1 130 GLU n 1 131 GLU n 1 132 GLY n 1 133 TYR n 1 134 GLN n 1 135 ASP n 1 136 TYR n 1 137 GLU n 1 138 PRO n 1 139 GLU n 1 140 ALA n 2 1 UNK n 2 2 UNK n 2 3 UNK n 2 4 UNK n 2 5 UNK n 2 6 UNK n 2 7 UNK n 2 8 UNK n 2 9 UNK n 3 1 UNK n 3 2 UNK n 3 3 UNK n 3 4 UNK n 3 5 VAL n 3 6 UNK n 3 7 UNK n # loop_ _entity_src_nat.entity_id _entity_src_nat.pdbx_src_id _entity_src_nat.pdbx_alt_source_flag _entity_src_nat.pdbx_beg_seq_num _entity_src_nat.pdbx_end_seq_num _entity_src_nat.common_name _entity_src_nat.pdbx_organism_scientific _entity_src_nat.pdbx_ncbi_taxonomy_id _entity_src_nat.genus _entity_src_nat.species _entity_src_nat.strain _entity_src_nat.tissue _entity_src_nat.tissue_fraction _entity_src_nat.pdbx_secretion _entity_src_nat.pdbx_fragment _entity_src_nat.pdbx_variant _entity_src_nat.pdbx_cell_line _entity_src_nat.pdbx_atcc _entity_src_nat.pdbx_cellular_location _entity_src_nat.pdbx_organ _entity_src_nat.pdbx_organelle _entity_src_nat.pdbx_cell _entity_src_nat.pdbx_plasmid_name _entity_src_nat.pdbx_plasmid_details _entity_src_nat.details 1 1 sample 1 140 human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 1 9 ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 sample 1 7 ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SYUA_HUMAN P37840 ? 1 ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; 1 2 PDB 8A9L 8A9L ? 2 ? 1 3 PDB 8A9L 8A9L ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8A9L A 1 ? 140 ? P37840 1 ? 140 ? 1 140 2 2 8A9L B 1 ? 9 ? 8A9L 1 ? 9 ? 1 9 3 3 8A9L C 1 ? 7 ? 8A9L 1 ? 7 ? 1 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNK 'L-peptide linking' . UNKNOWN ? 'C4 H9 N O2' 103.120 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8A9L _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 51.001 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.769 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8A9L _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.16 _refine.ls_d_res_low 91.60 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 65106 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.00 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.43496 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.43496 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'PARAMETERS FOR MASK CACLULATION' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.090 _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B 5.034 _refine.overall_SU_ML 0.126 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high . _refine_hist.d_res_low . _refine_hist.number_atoms_solvent ? _refine_hist.number_atoms_total 576 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein ? _refine_hist.pdbx_number_atoms_nucleic_acid ? _refine_hist.pdbx_number_atoms_ligand ? _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.006 0.012 570 ? r_bond_refined_d ? ? 'ELECTRON MICROSCOPY' ? 0.001 0.016 585 ? r_bond_other_d ? ? 'ELECTRON MICROSCOPY' ? 1.155 1.624 769 ? r_angle_refined_deg ? ? 'ELECTRON MICROSCOPY' ? 0.424 1.568 1345 ? r_angle_other_deg ? ? 'ELECTRON MICROSCOPY' ? 6.820 5.000 83 ? r_dihedral_angle_1_deg ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_dihedral_angle_2_deg ? ? 'ELECTRON MICROSCOPY' ? 7.682 10.000 89 ? r_dihedral_angle_3_deg ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'ELECTRON MICROSCOPY' ? 0.054 0.200 102 ? r_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.006 0.020 642 ? r_gen_planes_refined ? ? 'ELECTRON MICROSCOPY' ? 0.001 0.020 94 ? r_gen_planes_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbd_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbd_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbtor_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbtor_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_metal_ion_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_metal_ion_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_vdw_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_hbond_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'ELECTRON MICROSCOPY' ? 4.905 4.783 341 ? r_mcbond_it ? ? 'ELECTRON MICROSCOPY' ? 4.902 4.781 341 ? r_mcbond_other ? ? 'ELECTRON MICROSCOPY' ? 7.298 7.117 421 ? r_mcangle_it ? ? 'ELECTRON MICROSCOPY' ? 7.294 7.133 422 ? r_mcangle_other ? ? 'ELECTRON MICROSCOPY' ? 5.915 5.573 229 ? r_scbond_it ? ? 'ELECTRON MICROSCOPY' ? 5.902 5.586 230 ? r_scbond_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_scangle_it ? ? 'ELECTRON MICROSCOPY' ? 9.127 7.964 349 ? r_scangle_other ? ? 'ELECTRON MICROSCOPY' ? 11.798 56.690 477 ? r_long_range_B_refined ? ? 'ELECTRON MICROSCOPY' ? 11.786 56.836 478 ? r_long_range_B_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_rigid_bond_restr ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_sphericity_free ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_ls_shell.d_res_high 2.160 _refine_ls_shell.d_res_low 2.216 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 0 _refine_ls_shell.number_reflns_R_work 4828 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.000 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 1.081 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.details _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] 1 given ? 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 2 generate ? 0.999542 0.030266 0.000000 -0.030266 0.999542 0.000000 0.000000 0.000000 1.000000 -2.77382 2.85907 -9.53776 3 generate ? 0.999885 0.015135 0.000000 -0.015135 0.999885 0.000000 0.000000 0.000000 1.000000 -1.39772 1.41907 -4.76888 4 generate ? 0.999885 -0.015135 0.000000 0.015135 0.999885 0.000000 0.000000 0.000000 1.000000 1.41907 -1.39770 4.76888 5 generate ? 0.999542 -0.030266 0.000000 0.030266 0.999542 0.000000 0.000000 0.000000 1.000000 2.85907 -2.77382 9.53776 # _struct.entry_id 8A9L _struct.title ;Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease and dementia with Lewy bodies ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8A9L _struct_keywords.text ;alpha-synuclein, amyloid, fibril, Parkinson's disease (PD), Parkinson's disease dementia (PDD), dementia with Lewy bodies (DLB), synucleinopathy, PROTEIN FIBRIL ; _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _atom_sites.entry_id 8A9L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 PHE 4 4 ? ? ? A . n A 1 5 MET 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 LYS 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 VAL 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 ALA 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 LYS 21 21 ? ? ? A . n A 1 22 THR 22 22 ? ? ? A . n A 1 23 LYS 23 23 ? ? ? A . n A 1 24 GLN 24 24 ? ? ? A . n A 1 25 GLY 25 25 ? ? ? A . n A 1 26 VAL 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 GLU 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 GLY 101 101 ? ? ? A . n A 1 102 LYS 102 102 ? ? ? A . n A 1 103 ASN 103 103 ? ? ? A . n A 1 104 GLU 104 104 ? ? ? A . n A 1 105 GLU 105 105 ? ? ? A . n A 1 106 GLY 106 106 ? ? ? A . n A 1 107 ALA 107 107 ? ? ? A . n A 1 108 PRO 108 108 ? ? ? A . n A 1 109 GLN 109 109 ? ? ? A . n A 1 110 GLU 110 110 ? ? ? A . n A 1 111 GLY 111 111 ? ? ? A . n A 1 112 ILE 112 112 ? ? ? A . n A 1 113 LEU 113 113 ? ? ? A . n A 1 114 GLU 114 114 ? ? ? A . n A 1 115 ASP 115 115 ? ? ? A . n A 1 116 MET 116 116 ? ? ? A . n A 1 117 PRO 117 117 ? ? ? A . n A 1 118 VAL 118 118 ? ? ? A . n A 1 119 ASP 119 119 ? ? ? A . n A 1 120 PRO 120 120 ? ? ? A . n A 1 121 ASP 121 121 ? ? ? A . n A 1 122 ASN 122 122 ? ? ? A . n A 1 123 GLU 123 123 ? ? ? A . n A 1 124 ALA 124 124 ? ? ? A . n A 1 125 TYR 125 125 ? ? ? A . n A 1 126 GLU 126 126 ? ? ? A . n A 1 127 MET 127 127 ? ? ? A . n A 1 128 PRO 128 128 ? ? ? A . n A 1 129 SER 129 129 ? ? ? A . n A 1 130 GLU 130 130 ? ? ? A . n A 1 131 GLU 131 131 ? ? ? A . n A 1 132 GLY 132 132 ? ? ? A . n A 1 133 TYR 133 133 ? ? ? A . n A 1 134 GLN 134 134 ? ? ? A . n A 1 135 ASP 135 135 ? ? ? A . n A 1 136 TYR 136 136 ? ? ? A . n A 1 137 GLU 137 137 ? ? ? A . n A 1 138 PRO 138 138 ? ? ? A . n A 1 139 GLU 139 139 ? ? ? A . n A 1 140 ALA 140 140 ? ? ? A . n B 2 1 UNK 1 1 4 UNK ALA B . n B 2 2 UNK 2 2 5 UNK ALA B . n B 2 3 UNK 3 3 6 UNK ALA B . n B 2 4 UNK 4 4 7 UNK ALA B . n B 2 5 UNK 5 5 8 UNK ALA B . n B 2 6 UNK 6 6 9 UNK ALA B . n B 2 7 UNK 7 7 10 UNK ALA B . n B 2 8 UNK 8 8 11 UNK ALA B . n B 2 9 UNK 9 9 12 UNK ALA B . n C 3 1 UNK 1 1 108 UNK ALA C . n C 3 2 UNK 2 2 109 UNK ALA C . n C 3 3 UNK 3 3 110 UNK ALA C . n C 3 4 UNK 4 4 111 UNK ALA C . n C 3 5 VAL 5 5 112 VAL VAL C . n C 3 6 UNK 6 6 113 UNK ALA C . n C 3 7 UNK 7 7 114 UNK ALA C . n # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 scheres@mrc-lmb.cam.ac.uk Sjors Scheres H.W. 'principal investigator/group leader' 0000-0002-0462-6540 4 mg@mrc-lmb.cam.ac.uk Michel Goedert ? 'principal investigator/group leader' 0000-0002-5214-7886 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 HOH 1 201 18 HOH HOH A . D 4 HOH 2 202 20 HOH HOH A . D 4 HOH 3 203 19 HOH HOH A . D 4 HOH 4 204 21 HOH HOH A . D 4 HOH 5 205 17 HOH HOH A . D 4 HOH 6 206 16 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details Trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1 0 0 0 0 1 0 0 0 0 1 0 2 'point symmetry operation' ? ? 0.999885 0.015135 0.000000 -1.39772 -0.015135 0.999885 0.000000 1.41907 0.000000 0.000000 1.000000 -4.76888 3 'point symmetry operation' ? ? 0.999885 -0.015135 0.000000 1.41907 0.015135 0.999885 0.000000 -1.39770 0.000000 0.000000 1.000000 4.76888 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-31 2 'Structure model' 1 1 2022-09-28 3 'Structure model' 1 2 2022-11-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation_author.identifier_ORCID' # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name REFMAC _software.os ? _software.os_version ? _software.type ? _software.version 5.8.0350 _software.pdbx_ordinal 1 # _em_3d_fitting.entry_id 8A9L _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 8A9L _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 68330 _em_3d_reconstruction.resolution 2.2 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type HELICAL _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.5 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Alpha-synuclein filaments extracted from the human brain with PD, PDD, and DLB' _em_entity_assembly.source NATURAL _em_entity_assembly.type TISSUE _em_entity_assembly.entity_id_list 1,2,3 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 8A9L _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max 1400 _em_imaging.nominal_defocus_min 600 _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 8A9L _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 8A9L _em_experiment.id 1 _em_experiment.aggregation_state FILAMENT _em_experiment.reconstruction_method HELICAL _em_experiment.entity_assembly_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 50 ? ? -85.14 -72.70 2 1 UNK C 6 ? ? -158.99 86.90 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A PHE 4 ? A PHE 4 5 1 Y 1 A MET 5 ? A MET 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A LYS 12 ? A LYS 12 13 1 Y 1 A GLU 13 ? A GLU 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A VAL 16 ? A VAL 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A ALA 18 ? A ALA 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A LYS 21 ? A LYS 21 22 1 Y 1 A THR 22 ? A THR 22 23 1 Y 1 A LYS 23 ? A LYS 23 24 1 Y 1 A GLN 24 ? A GLN 24 25 1 Y 1 A GLY 25 ? A GLY 25 26 1 Y 1 A VAL 26 ? A VAL 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A GLU 28 ? A GLU 28 29 1 Y 1 A ALA 29 ? A ALA 29 30 1 Y 1 A ALA 30 ? A ALA 30 31 1 Y 1 A GLY 101 ? A GLY 101 32 1 Y 1 A LYS 102 ? A LYS 102 33 1 Y 1 A ASN 103 ? A ASN 103 34 1 Y 1 A GLU 104 ? A GLU 104 35 1 Y 1 A GLU 105 ? A GLU 105 36 1 Y 1 A GLY 106 ? A GLY 106 37 1 Y 1 A ALA 107 ? A ALA 107 38 1 Y 1 A PRO 108 ? A PRO 108 39 1 Y 1 A GLN 109 ? A GLN 109 40 1 Y 1 A GLU 110 ? A GLU 110 41 1 Y 1 A GLY 111 ? A GLY 111 42 1 Y 1 A ILE 112 ? A ILE 112 43 1 Y 1 A LEU 113 ? A LEU 113 44 1 Y 1 A GLU 114 ? A GLU 114 45 1 Y 1 A ASP 115 ? A ASP 115 46 1 Y 1 A MET 116 ? A MET 116 47 1 Y 1 A PRO 117 ? A PRO 117 48 1 Y 1 A VAL 118 ? A VAL 118 49 1 Y 1 A ASP 119 ? A ASP 119 50 1 Y 1 A PRO 120 ? A PRO 120 51 1 Y 1 A ASP 121 ? A ASP 121 52 1 Y 1 A ASN 122 ? A ASN 122 53 1 Y 1 A GLU 123 ? A GLU 123 54 1 Y 1 A ALA 124 ? A ALA 124 55 1 Y 1 A TYR 125 ? A TYR 125 56 1 Y 1 A GLU 126 ? A GLU 126 57 1 Y 1 A MET 127 ? A MET 127 58 1 Y 1 A PRO 128 ? A PRO 128 59 1 Y 1 A SER 129 ? A SER 129 60 1 Y 1 A GLU 130 ? A GLU 130 61 1 Y 1 A GLU 131 ? A GLU 131 62 1 Y 1 A GLY 132 ? A GLY 132 63 1 Y 1 A TYR 133 ? A TYR 133 64 1 Y 1 A GLN 134 ? A GLN 134 65 1 Y 1 A ASP 135 ? A ASP 135 66 1 Y 1 A TYR 136 ? A TYR 136 67 1 Y 1 A GLU 137 ? A GLU 137 68 1 Y 1 A PRO 138 ? A PRO 138 69 1 Y 1 A GLU 139 ? A GLU 139 70 1 Y 1 A ALA 140 ? A ALA 140 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.angular_rotation_per_subunit 0.86 _em_helical_entity.axial_rise_per_subunit 4.76 _em_helical_entity.axial_symmetry C1 _em_helical_entity.details ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 40 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'FEI FALCON IV (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? _em_image_recording.avg_electron_dose_per_subtomogram ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? ? ? 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? Coot ? ? 1 ? 8 OTHER ? ? ? ? ? ? 9 'INITIAL EULER ASSIGNMENT' ? RELION 4.0 1 ? ? 10 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 CLASSIFICATION ? ? ? 1 ? ? 12 RECONSTRUCTION ? RELION 4.0 1 ? ? 13 'VOLUME SELECTION' ? ? ? 1 1 1 14 'SERIES ALIGNMENT' ? ? ? 1 1 1 15 'MOLECULAR REPLACEMENT' ? ? ? 1 1 1 16 'LATTICE DISTORTION CORRECTION' ? ? ? 1 1 1 17 'SYMMETRY DETERMINATION' ? ? ? 1 1 1 18 'CRYSTALLOGRAPHY MERGING' ? ? ? 1 1 1 19 'MODEL REFINEMENT' servalcat REFMAC ? ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' MC_UP_A025_1013 1 'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' 'MC_U105184291 to M.G.' 2 'Alzheimers Research UK (ARUK)' 'United Kingdom' ? 3 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' ? 4 # _pdbx_entity_nonpoly.entity_id 4 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? #