data_8AEH # _entry.id 8AEH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.376 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8AEH pdb_00008aeh 10.2210/pdb8aeh/pdb WWPDB D_1292124176 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8AEH _pdbx_database_status.recvd_initial_deposition_date 2022-07-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schwartz, M.' 1 ? 'Briand, L.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of dog odorant binding protein' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Glaz, M.' 1 ? primary 'Schwartz, M.' 2 ? primary 'Briand, L.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8AEH _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.221 _cell.length_a_esd ? _cell.length_b 88.221 _cell.length_b_esd ? _cell.length_c 37.517 _cell.length_c_esd ? _cell.volume 291992.742 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8AEH _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Major allergen Can f 1' 18915.330 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Allergen Dog 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHTDPQDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVL HKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQ SETCSPGGQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHTDPQDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVL HKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQ SETCSPGGQ ; _entity_poly.pdbx_strand_id AA1 _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 THR n 1 12 ASP n 1 13 PRO n 1 14 GLN n 1 15 ASP n 1 16 THR n 1 17 PRO n 1 18 ALA n 1 19 LEU n 1 20 GLY n 1 21 LYS n 1 22 ASP n 1 23 THR n 1 24 VAL n 1 25 ALA n 1 26 VAL n 1 27 SER n 1 28 GLY n 1 29 LYS n 1 30 TRP n 1 31 TYR n 1 32 LEU n 1 33 LYS n 1 34 ALA n 1 35 MET n 1 36 THR n 1 37 ALA n 1 38 ASP n 1 39 GLN n 1 40 GLU n 1 41 VAL n 1 42 PRO n 1 43 GLU n 1 44 LYS n 1 45 PRO n 1 46 ASP n 1 47 SER n 1 48 VAL n 1 49 THR n 1 50 PRO n 1 51 MET n 1 52 ILE n 1 53 LEU n 1 54 LYS n 1 55 ALA n 1 56 GLN n 1 57 LYS n 1 58 GLY n 1 59 GLY n 1 60 ASN n 1 61 LEU n 1 62 GLU n 1 63 ALA n 1 64 LYS n 1 65 ILE n 1 66 THR n 1 67 MET n 1 68 LEU n 1 69 THR n 1 70 ASN n 1 71 GLY n 1 72 GLN n 1 73 CYS n 1 74 GLN n 1 75 ASN n 1 76 ILE n 1 77 THR n 1 78 VAL n 1 79 VAL n 1 80 LEU n 1 81 HIS n 1 82 LYS n 1 83 THR n 1 84 SER n 1 85 GLU n 1 86 PRO n 1 87 GLY n 1 88 LYS n 1 89 TYR n 1 90 THR n 1 91 ALA n 1 92 TYR n 1 93 GLU n 1 94 GLY n 1 95 GLN n 1 96 ARG n 1 97 VAL n 1 98 VAL n 1 99 PHE n 1 100 ILE n 1 101 GLN n 1 102 PRO n 1 103 SER n 1 104 PRO n 1 105 VAL n 1 106 ARG n 1 107 ASP n 1 108 HIS n 1 109 TYR n 1 110 ILE n 1 111 LEU n 1 112 TYR n 1 113 CYS n 1 114 GLU n 1 115 GLY n 1 116 GLU n 1 117 LEU n 1 118 HIS n 1 119 GLY n 1 120 ARG n 1 121 GLN n 1 122 ILE n 1 123 ARG n 1 124 MET n 1 125 ALA n 1 126 LYS n 1 127 LEU n 1 128 LEU n 1 129 GLY n 1 130 ARG n 1 131 ASP n 1 132 PRO n 1 133 GLU n 1 134 GLN n 1 135 SER n 1 136 GLN n 1 137 GLU n 1 138 ALA n 1 139 LEU n 1 140 GLU n 1 141 ASP n 1 142 PHE n 1 143 ARG n 1 144 GLU n 1 145 PHE n 1 146 SER n 1 147 ARG n 1 148 ALA n 1 149 LYS n 1 150 GLY n 1 151 LEU n 1 152 ASN n 1 153 GLN n 1 154 GLU n 1 155 ILE n 1 156 LEU n 1 157 GLU n 1 158 LEU n 1 159 ALA n 1 160 GLN n 1 161 SER n 1 162 GLU n 1 163 THR n 1 164 CYS n 1 165 SER n 1 166 PRO n 1 167 GLY n 1 168 GLY n 1 169 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 169 _entity_src_gen.gene_src_common_name dog _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Canis lupus familiaris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9615 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ALL1_CANLF _struct_ref.pdbx_db_accession O18873 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYE GQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ ; _struct_ref.pdbx_align_begin 19 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8AEH _struct_ref_seq.pdbx_strand_id AA1 _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O18873 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 19 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8AEH MET AA1 1 ? UNP O18873 ? ? 'initiating methionine' 6 1 1 8AEH ARG AA1 2 ? UNP O18873 ? ? 'expression tag' 7 2 1 8AEH GLY AA1 3 ? UNP O18873 ? ? 'expression tag' 8 3 1 8AEH SER AA1 4 ? UNP O18873 ? ? 'expression tag' 9 4 1 8AEH HIS AA1 5 ? UNP O18873 ? ? 'expression tag' 10 5 1 8AEH HIS AA1 6 ? UNP O18873 ? ? 'expression tag' 11 6 1 8AEH HIS AA1 7 ? UNP O18873 ? ? 'expression tag' 12 7 1 8AEH HIS AA1 8 ? UNP O18873 ? ? 'expression tag' 13 8 1 8AEH HIS AA1 9 ? UNP O18873 ? ? 'expression tag' 14 9 1 8AEH HIS AA1 10 ? UNP O18873 ? ? 'expression tag' 15 10 1 8AEH THR AA1 11 ? UNP O18873 ? ? 'expression tag' 16 11 1 8AEH ASP AA1 12 ? UNP O18873 ? ? 'expression tag' 17 12 1 8AEH PRO AA1 13 ? UNP O18873 ? ? 'expression tag' 18 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8AEH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.74 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 4000, 0.2 M CaCl2 in 0.1 M pH 8.5 Tris buffer' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978565 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978565 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 69.57 _reflns.entry_id 8AEH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.00 _reflns.d_resolution_low 44.11 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3242 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.0 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.067 _reflns.pdbx_Rpim_I_all 0.014 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 14.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 512 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.188 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.192 _reflns_shell.pdbx_Rpim_I_all 0.038 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.997 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 62.28 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8AEH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 44.11 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3242 _refine.ls_number_reflns_R_free 267 _refine.ls_number_reflns_R_work 5407 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.96 _refine.ls_percent_reflns_R_free 4.71 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2860 _refine.ls_R_factor_R_free 0.3011 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2852 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.68 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3EYC _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.3134 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3672 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 44.11 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 853 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 852 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0104 ? 860 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.4662 ? 1154 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0845 ? 138 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0083 ? 142 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.3344 ? 303 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.00 3.78 . . 131 2712 100.00 . . . 0.3063 . 0.2571 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.78 44.11 . . 136 2695 99.93 . . . 0.2992 . 0.2969 . . . . . . . . . . . # _struct.entry_id 8AEH _struct.title 'X-ray structure of Canis familiaris Odorant Binding Protein 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8AEH _struct_keywords.text 'Odorant binding protein, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 135 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 148 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id AA1 _struct_conf.beg_auth_seq_id 140 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id AA1 _struct_conf.end_auth_seq_id 153 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 73 SG ? ? ? 1_555 A CYS 164 SG ? ? AA1 CYS 78 AA1 CYS 169 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc1 metalc ? ? A ASP 46 OD1 ? ? ? 1_555 B CA . CA ? ? AA1 ASP 51 AA1 CA 201 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc2 metalc ? ? A ASP 46 OD2 ? ? ? 1_555 B CA . CA ? ? AA1 ASP 51 AA1 CA 201 1_555 ? ? ? ? ? ? ? 3.047 ? ? metalc3 metalc ? ? A ASN 70 OD1 ? ? ? 1_555 B CA . CA ? ? AA1 ASN 75 AA1 CA 201 1_555 ? ? ? ? ? ? ? 2.531 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 78 ? LEU A 80 ? VAL AA1 83 LEU AA1 85 AA1 2 LEU A 61 ? LYS A 64 ? LEU AA1 66 LYS AA1 69 AA1 3 MET A 51 ? LYS A 54 ? MET AA1 56 LYS AA1 59 AA1 4 GLY A 28 ? MET A 35 ? GLY AA1 33 MET AA1 40 AA1 5 MET A 124 ? GLY A 129 ? MET AA1 129 GLY AA1 134 AA1 6 HIS A 108 ? GLU A 114 ? HIS AA1 113 GLU AA1 119 AA1 7 VAL A 97 ? PRO A 102 ? VAL AA1 102 PRO AA1 107 AA2 1 VAL A 78 ? LEU A 80 ? VAL AA1 83 LEU AA1 85 AA2 2 LEU A 61 ? LYS A 64 ? LEU AA1 66 LYS AA1 69 AA2 3 MET A 51 ? LYS A 54 ? MET AA1 56 LYS AA1 59 AA2 4 GLY A 28 ? MET A 35 ? GLY AA1 33 MET AA1 40 AA2 5 LEU A 156 ? GLU A 157 ? LEU AA1 161 GLU AA1 162 AA3 1 SER A 47 ? VAL A 48 ? SER AA1 52 VAL AA1 53 AA3 2 THR A 66 ? LEU A 68 ? THR AA1 71 LEU AA1 73 AA3 3 CYS A 73 ? ASN A 75 ? CYS AA1 78 ASN AA1 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 80 ? O LEU AA1 85 N LEU A 61 ? N LEU AA1 66 AA1 2 3 O GLU A 62 ? O GLU AA1 67 N LYS A 54 ? N LYS AA1 59 AA1 3 4 O MET A 51 ? O MET AA1 56 N TRP A 30 ? N TRP AA1 35 AA1 4 5 N TYR A 31 ? N TYR AA1 36 O GLY A 129 ? O GLY AA1 134 AA1 5 6 O LEU A 128 ? O LEU AA1 133 N TYR A 109 ? N TYR AA1 114 AA1 6 7 O TYR A 112 ? O TYR AA1 117 N PHE A 99 ? N PHE AA1 104 AA2 1 2 O LEU A 80 ? O LEU AA1 85 N LEU A 61 ? N LEU AA1 66 AA2 2 3 O GLU A 62 ? O GLU AA1 67 N LYS A 54 ? N LYS AA1 59 AA2 3 4 O MET A 51 ? O MET AA1 56 N TRP A 30 ? N TRP AA1 35 AA2 4 5 N MET A 35 ? N MET AA1 40 O LEU A 156 ? O LEU AA1 161 AA3 1 2 N SER A 47 ? N SER AA1 52 O LEU A 68 ? O LEU AA1 73 AA3 2 3 N MET A 67 ? N MET AA1 72 O GLN A 74 ? O GLN AA1 79 # _atom_sites.entry_id 8AEH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011335 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011335 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026655 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CA ? ? 16.26893 3.65395 ? ? 3.58509 77.28589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 6 ? ? ? AA1 . n A 1 2 ARG 2 7 ? ? ? AA1 . n A 1 3 GLY 3 8 ? ? ? AA1 . n A 1 4 SER 4 9 ? ? ? AA1 . n A 1 5 HIS 5 10 ? ? ? AA1 . n A 1 6 HIS 6 11 ? ? ? AA1 . n A 1 7 HIS 7 12 ? ? ? AA1 . n A 1 8 HIS 8 13 ? ? ? AA1 . n A 1 9 HIS 9 14 ? ? ? AA1 . n A 1 10 HIS 10 15 ? ? ? AA1 . n A 1 11 THR 11 16 ? ? ? AA1 . n A 1 12 ASP 12 17 ? ? ? AA1 . n A 1 13 PRO 13 18 ? ? ? AA1 . n A 1 14 GLN 14 19 ? ? ? AA1 . n A 1 15 ASP 15 20 ? ? ? AA1 . n A 1 16 THR 16 21 ? ? ? AA1 . n A 1 17 PRO 17 22 ? ? ? AA1 . n A 1 18 ALA 18 23 ? ? ? AA1 . n A 1 19 LEU 19 24 ? ? ? AA1 . n A 1 20 GLY 20 25 ? ? ? AA1 . n A 1 21 LYS 21 26 ? ? ? AA1 . n A 1 22 ASP 22 27 ? ? ? AA1 . n A 1 23 THR 23 28 ? ? ? AA1 . n A 1 24 VAL 24 29 ? ? ? AA1 . n A 1 25 ALA 25 30 ? ? ? AA1 . n A 1 26 VAL 26 31 31 VAL VAL AA1 . n A 1 27 SER 27 32 32 SER SER AA1 . n A 1 28 GLY 28 33 33 GLY GLY AA1 . n A 1 29 LYS 29 34 34 LYS LYS AA1 . n A 1 30 TRP 30 35 35 TRP TRP AA1 . n A 1 31 TYR 31 36 36 TYR TYR AA1 . n A 1 32 LEU 32 37 37 LEU LEU AA1 . n A 1 33 LYS 33 38 38 LYS LYS AA1 . n A 1 34 ALA 34 39 39 ALA ALA AA1 . n A 1 35 MET 35 40 40 MET MET AA1 . n A 1 36 THR 36 41 41 THR THR AA1 . n A 1 37 ALA 37 42 ? ? ? AA1 . n A 1 38 ASP 38 43 ? ? ? AA1 . n A 1 39 GLN 39 44 ? ? ? AA1 . n A 1 40 GLU 40 45 ? ? ? AA1 . n A 1 41 VAL 41 46 ? ? ? AA1 . n A 1 42 PRO 42 47 ? ? ? AA1 . n A 1 43 GLU 43 48 ? ? ? AA1 . n A 1 44 LYS 44 49 49 LYS LYS AA1 . n A 1 45 PRO 45 50 50 PRO PRO AA1 . n A 1 46 ASP 46 51 51 ASP ASP AA1 . n A 1 47 SER 47 52 52 SER SER AA1 . n A 1 48 VAL 48 53 53 VAL VAL AA1 . n A 1 49 THR 49 54 54 THR THR AA1 . n A 1 50 PRO 50 55 55 PRO PRO AA1 . n A 1 51 MET 51 56 56 MET MET AA1 . n A 1 52 ILE 52 57 57 ILE ILE AA1 . n A 1 53 LEU 53 58 58 LEU LEU AA1 . n A 1 54 LYS 54 59 59 LYS LYS AA1 . n A 1 55 ALA 55 60 60 ALA ALA AA1 . n A 1 56 GLN 56 61 ? ? ? AA1 . n A 1 57 LYS 57 62 ? ? ? AA1 . n A 1 58 GLY 58 63 ? ? ? AA1 . n A 1 59 GLY 59 64 ? ? ? AA1 . n A 1 60 ASN 60 65 65 ASN ASN AA1 . n A 1 61 LEU 61 66 66 LEU LEU AA1 . n A 1 62 GLU 62 67 67 GLU GLU AA1 . n A 1 63 ALA 63 68 68 ALA ALA AA1 . n A 1 64 LYS 64 69 69 LYS LYS AA1 . n A 1 65 ILE 65 70 70 ILE ILE AA1 . n A 1 66 THR 66 71 71 THR THR AA1 . n A 1 67 MET 67 72 72 MET MET AA1 . n A 1 68 LEU 68 73 73 LEU LEU AA1 . n A 1 69 THR 69 74 74 THR THR AA1 . n A 1 70 ASN 70 75 75 ASN ASN AA1 . n A 1 71 GLY 71 76 76 GLY GLY AA1 . n A 1 72 GLN 72 77 77 GLN GLN AA1 . n A 1 73 CYS 73 78 78 CYS CYS AA1 . n A 1 74 GLN 74 79 79 GLN GLN AA1 . n A 1 75 ASN 75 80 80 ASN ASN AA1 . n A 1 76 ILE 76 81 81 ILE ILE AA1 . n A 1 77 THR 77 82 82 THR THR AA1 . n A 1 78 VAL 78 83 83 VAL VAL AA1 . n A 1 79 VAL 79 84 84 VAL VAL AA1 . n A 1 80 LEU 80 85 85 LEU LEU AA1 . n A 1 81 HIS 81 86 86 HIS HIS AA1 . n A 1 82 LYS 82 87 87 LYS LYS AA1 . n A 1 83 THR 83 88 88 THR THR AA1 . n A 1 84 SER 84 89 ? ? ? AA1 . n A 1 85 GLU 85 90 ? ? ? AA1 . n A 1 86 PRO 86 91 ? ? ? AA1 . n A 1 87 GLY 87 92 ? ? ? AA1 . n A 1 88 LYS 88 93 93 LYS LYS AA1 . n A 1 89 TYR 89 94 94 TYR TYR AA1 . n A 1 90 THR 90 95 95 THR THR AA1 . n A 1 91 ALA 91 96 ? ? ? AA1 . n A 1 92 TYR 92 97 ? ? ? AA1 . n A 1 93 GLU 93 98 ? ? ? AA1 . n A 1 94 GLY 94 99 ? ? ? AA1 . n A 1 95 GLN 95 100 ? ? ? AA1 . n A 1 96 ARG 96 101 101 ARG ARG AA1 . n A 1 97 VAL 97 102 102 VAL VAL AA1 . n A 1 98 VAL 98 103 103 VAL VAL AA1 . n A 1 99 PHE 99 104 104 PHE PHE AA1 . n A 1 100 ILE 100 105 105 ILE ILE AA1 . n A 1 101 GLN 101 106 106 GLN GLN AA1 . n A 1 102 PRO 102 107 107 PRO PRO AA1 . n A 1 103 SER 103 108 108 SER SER AA1 . n A 1 104 PRO 104 109 109 PRO PRO AA1 . n A 1 105 VAL 105 110 110 VAL VAL AA1 . n A 1 106 ARG 106 111 111 ARG ARG AA1 . n A 1 107 ASP 107 112 112 ASP ASP AA1 . n A 1 108 HIS 108 113 113 HIS HIS AA1 . n A 1 109 TYR 109 114 114 TYR TYR AA1 . n A 1 110 ILE 110 115 115 ILE ILE AA1 . n A 1 111 LEU 111 116 116 LEU LEU AA1 . n A 1 112 TYR 112 117 117 TYR TYR AA1 . n A 1 113 CYS 113 118 118 CYS CYS AA1 . n A 1 114 GLU 114 119 119 GLU GLU AA1 . n A 1 115 GLY 115 120 120 GLY GLY AA1 . n A 1 116 GLU 116 121 ? ? ? AA1 . n A 1 117 LEU 117 122 ? ? ? AA1 . n A 1 118 HIS 118 123 ? ? ? AA1 . n A 1 119 GLY 119 124 ? ? ? AA1 . n A 1 120 ARG 120 125 ? ? ? AA1 . n A 1 121 GLN 121 126 ? ? ? AA1 . n A 1 122 ILE 122 127 127 ILE ILE AA1 . n A 1 123 ARG 123 128 128 ARG ARG AA1 . n A 1 124 MET 124 129 129 MET MET AA1 . n A 1 125 ALA 125 130 130 ALA ALA AA1 . n A 1 126 LYS 126 131 131 LYS LYS AA1 . n A 1 127 LEU 127 132 132 LEU LEU AA1 . n A 1 128 LEU 128 133 133 LEU LEU AA1 . n A 1 129 GLY 129 134 134 GLY GLY AA1 . n A 1 130 ARG 130 135 135 ARG ARG AA1 . n A 1 131 ASP 131 136 136 ASP ASP AA1 . n A 1 132 PRO 132 137 137 PRO PRO AA1 . n A 1 133 GLU 133 138 138 GLU GLU AA1 . n A 1 134 GLN 134 139 139 GLN GLN AA1 . n A 1 135 SER 135 140 140 SER SER AA1 . n A 1 136 GLN 136 141 141 GLN GLN AA1 . n A 1 137 GLU 137 142 142 GLU GLU AA1 . n A 1 138 ALA 138 143 143 ALA ALA AA1 . n A 1 139 LEU 139 144 144 LEU LEU AA1 . n A 1 140 GLU 140 145 145 GLU GLU AA1 . n A 1 141 ASP 141 146 146 ASP ASP AA1 . n A 1 142 PHE 142 147 147 PHE PHE AA1 . n A 1 143 ARG 143 148 148 ARG ARG AA1 . n A 1 144 GLU 144 149 149 GLU GLU AA1 . n A 1 145 PHE 145 150 150 PHE PHE AA1 . n A 1 146 SER 146 151 151 SER SER AA1 . n A 1 147 ARG 147 152 152 ARG ARG AA1 . n A 1 148 ALA 148 153 153 ALA ALA AA1 . n A 1 149 LYS 149 154 154 LYS LYS AA1 . n A 1 150 GLY 150 155 155 GLY GLY AA1 . n A 1 151 LEU 151 156 156 LEU LEU AA1 . n A 1 152 ASN 152 157 157 ASN ASN AA1 . n A 1 153 GLN 153 158 158 GLN GLN AA1 . n A 1 154 GLU 154 159 159 GLU GLU AA1 . n A 1 155 ILE 155 160 160 ILE ILE AA1 . n A 1 156 LEU 156 161 161 LEU LEU AA1 . n A 1 157 GLU 157 162 162 GLU GLU AA1 . n A 1 158 LEU 158 163 163 LEU LEU AA1 . n A 1 159 ALA 159 164 164 ALA ALA AA1 . n A 1 160 GLN 160 165 165 GLN GLN AA1 . n A 1 161 SER 161 166 166 SER SER AA1 . n A 1 162 GLU 162 167 167 GLU GLU AA1 . n A 1 163 THR 163 168 168 THR THR AA1 . n A 1 164 CYS 164 169 169 CYS CYS AA1 . n A 1 165 SER 165 170 170 SER SER AA1 . n A 1 166 PRO 166 171 171 PRO PRO AA1 . n A 1 167 GLY 167 172 172 GLY GLY AA1 . n A 1 168 GLY 168 173 173 GLY GLY AA1 . n A 1 169 GLN 169 174 174 GLN GLN AA1 . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email loic.briand@inrae.fr _pdbx_contact_author.name_first Loic _pdbx_contact_author.name_last Briand _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8175-5936 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id AA1 _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 46 ? AA1 ASP 51 ? 1_555 CA ? B CA . ? AA1 CA 201 ? 1_555 OD2 ? A ASP 46 ? AA1 ASP 51 ? 1_555 45.1 ? 2 OD1 ? A ASP 46 ? AA1 ASP 51 ? 1_555 CA ? B CA . ? AA1 CA 201 ? 1_555 OD1 ? A ASN 70 ? AA1 ASN 75 ? 1_555 120.1 ? 3 OD2 ? A ASP 46 ? AA1 ASP 51 ? 1_555 CA ? B CA . ? AA1 CA 201 ? 1_555 OD1 ? A ASN 70 ? AA1 ASN 75 ? 1_555 76.6 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-08-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 8AEH _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET AA1 40 ? ? -171.12 143.68 2 1 TYR AA1 94 ? ? -126.62 -169.66 3 1 ASP AA1 112 ? ? 85.07 37.81 4 1 ALA AA1 153 ? ? -64.50 0.24 5 1 ASN AA1 157 ? ? -156.71 60.82 6 1 GLU AA1 159 ? ? 88.11 96.61 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AA1 VAL 31 ? CG1 ? A VAL 26 CG1 2 1 Y 1 AA1 VAL 31 ? CG2 ? A VAL 26 CG2 3 1 Y 1 AA1 SER 32 ? CB ? A SER 27 CB 4 1 Y 1 AA1 SER 32 ? OG ? A SER 27 OG 5 1 Y 1 AA1 LYS 59 ? CD ? A LYS 54 CD 6 1 Y 1 AA1 LYS 59 ? CE ? A LYS 54 CE 7 1 Y 1 AA1 LYS 59 ? NZ ? A LYS 54 NZ 8 1 Y 1 AA1 HIS 86 ? CD2 ? A HIS 81 CD2 9 1 Y 1 AA1 HIS 86 ? CE1 ? A HIS 81 CE1 10 1 Y 1 AA1 HIS 86 ? NE2 ? A HIS 81 NE2 11 1 Y 1 AA1 ARG 101 ? NE ? A ARG 96 NE 12 1 Y 1 AA1 ARG 101 ? CZ ? A ARG 96 CZ 13 1 Y 1 AA1 ARG 101 ? NH1 ? A ARG 96 NH1 14 1 Y 1 AA1 ARG 101 ? NH2 ? A ARG 96 NH2 15 1 Y 1 AA1 VAL 103 ? CG1 ? A VAL 98 CG1 16 1 Y 1 AA1 VAL 103 ? CG2 ? A VAL 98 CG2 17 1 Y 1 AA1 GLN 106 ? OE1 ? A GLN 101 OE1 18 1 Y 1 AA1 GLN 106 ? NE2 ? A GLN 101 NE2 19 1 Y 1 AA1 PRO 107 ? CD ? A PRO 102 CD 20 1 Y 1 AA1 PRO 109 ? CD ? A PRO 104 CD 21 1 Y 1 AA1 ARG 111 ? NH1 ? A ARG 106 NH1 22 1 Y 1 AA1 ARG 111 ? NH2 ? A ARG 106 NH2 23 1 Y 1 AA1 ILE 127 ? CD1 ? A ILE 122 CD1 24 1 Y 1 AA1 ARG 128 ? CG ? A ARG 123 CG 25 1 Y 1 AA1 ARG 128 ? CD ? A ARG 123 CD 26 1 Y 1 AA1 ARG 128 ? NE ? A ARG 123 NE 27 1 Y 1 AA1 ARG 128 ? CZ ? A ARG 123 CZ 28 1 Y 1 AA1 ARG 128 ? NH1 ? A ARG 123 NH1 29 1 Y 1 AA1 ARG 128 ? NH2 ? A ARG 123 NH2 30 1 Y 1 AA1 MET 129 ? CB ? A MET 124 CB 31 1 Y 1 AA1 MET 129 ? CG ? A MET 124 CG 32 1 Y 1 AA1 MET 129 ? SD ? A MET 124 SD 33 1 Y 1 AA1 MET 129 ? CE ? A MET 124 CE 34 1 Y 1 AA1 LYS 131 ? CG ? A LYS 126 CG 35 1 Y 1 AA1 LYS 131 ? CD ? A LYS 126 CD 36 1 Y 1 AA1 LYS 131 ? CE ? A LYS 126 CE 37 1 Y 1 AA1 LYS 131 ? NZ ? A LYS 126 NZ 38 1 Y 1 AA1 ARG 135 ? CG ? A ARG 130 CG 39 1 Y 1 AA1 ARG 135 ? CD ? A ARG 130 CD 40 1 Y 1 AA1 ARG 135 ? NE ? A ARG 130 NE 41 1 Y 1 AA1 ARG 135 ? CZ ? A ARG 130 CZ 42 1 Y 1 AA1 ARG 135 ? NH1 ? A ARG 130 NH1 43 1 Y 1 AA1 ARG 135 ? NH2 ? A ARG 130 NH2 44 1 Y 1 AA1 GLN 139 ? OE1 ? A GLN 134 OE1 45 1 Y 1 AA1 GLN 139 ? NE2 ? A GLN 134 NE2 46 1 Y 1 AA1 GLN 141 ? OE1 ? A GLN 136 OE1 47 1 Y 1 AA1 GLN 141 ? NE2 ? A GLN 136 NE2 48 1 Y 1 AA1 ARG 148 ? NE ? A ARG 143 NE 49 1 Y 1 AA1 ARG 148 ? CZ ? A ARG 143 CZ 50 1 Y 1 AA1 ARG 148 ? NH1 ? A ARG 143 NH1 51 1 Y 1 AA1 ARG 148 ? NH2 ? A ARG 143 NH2 52 1 Y 1 AA1 GLU 149 ? OE1 ? A GLU 144 OE1 53 1 Y 1 AA1 GLU 149 ? OE2 ? A GLU 144 OE2 54 1 Y 1 AA1 SER 151 ? OG ? A SER 146 OG 55 1 Y 1 AA1 ARG 152 ? CB ? A ARG 147 CB 56 1 Y 1 AA1 ARG 152 ? CG ? A ARG 147 CG 57 1 Y 1 AA1 ARG 152 ? CD ? A ARG 147 CD 58 1 Y 1 AA1 ARG 152 ? NE ? A ARG 147 NE 59 1 Y 1 AA1 ARG 152 ? CZ ? A ARG 147 CZ 60 1 Y 1 AA1 ARG 152 ? NH1 ? A ARG 147 NH1 61 1 Y 1 AA1 ARG 152 ? NH2 ? A ARG 147 NH2 62 1 Y 1 AA1 LEU 156 ? CG ? A LEU 151 CG 63 1 Y 1 AA1 LEU 156 ? CD1 ? A LEU 151 CD1 64 1 Y 1 AA1 LEU 156 ? CD2 ? A LEU 151 CD2 65 1 Y 1 AA1 ASN 157 ? OD1 ? A ASN 152 OD1 66 1 Y 1 AA1 ASN 157 ? ND2 ? A ASN 152 ND2 67 1 Y 1 AA1 GLN 158 ? CG ? A GLN 153 CG 68 1 Y 1 AA1 GLN 158 ? CD ? A GLN 153 CD 69 1 Y 1 AA1 GLN 158 ? OE1 ? A GLN 153 OE1 70 1 Y 1 AA1 GLN 158 ? NE2 ? A GLN 153 NE2 71 1 Y 1 AA1 GLU 159 ? CG ? A GLU 154 CG 72 1 Y 1 AA1 GLU 159 ? CD ? A GLU 154 CD 73 1 Y 1 AA1 GLU 159 ? OE1 ? A GLU 154 OE1 74 1 Y 1 AA1 GLU 159 ? OE2 ? A GLU 154 OE2 75 1 Y 1 AA1 ILE 160 ? CG1 ? A ILE 155 CG1 76 1 Y 1 AA1 ILE 160 ? CG2 ? A ILE 155 CG2 77 1 Y 1 AA1 ILE 160 ? CD1 ? A ILE 155 CD1 78 1 Y 1 AA1 GLN 174 ? CG ? A GLN 169 CG 79 1 Y 1 AA1 GLN 174 ? CD ? A GLN 169 CD 80 1 Y 1 AA1 GLN 174 ? OE1 ? A GLN 169 OE1 81 1 Y 1 AA1 GLN 174 ? NE2 ? A GLN 169 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AA1 MET 6 ? A MET 1 2 1 Y 1 AA1 ARG 7 ? A ARG 2 3 1 Y 1 AA1 GLY 8 ? A GLY 3 4 1 Y 1 AA1 SER 9 ? A SER 4 5 1 Y 1 AA1 HIS 10 ? A HIS 5 6 1 Y 1 AA1 HIS 11 ? A HIS 6 7 1 Y 1 AA1 HIS 12 ? A HIS 7 8 1 Y 1 AA1 HIS 13 ? A HIS 8 9 1 Y 1 AA1 HIS 14 ? A HIS 9 10 1 Y 1 AA1 HIS 15 ? A HIS 10 11 1 Y 1 AA1 THR 16 ? A THR 11 12 1 Y 1 AA1 ASP 17 ? A ASP 12 13 1 Y 1 AA1 PRO 18 ? A PRO 13 14 1 Y 1 AA1 GLN 19 ? A GLN 14 15 1 Y 1 AA1 ASP 20 ? A ASP 15 16 1 Y 1 AA1 THR 21 ? A THR 16 17 1 Y 1 AA1 PRO 22 ? A PRO 17 18 1 Y 1 AA1 ALA 23 ? A ALA 18 19 1 Y 1 AA1 LEU 24 ? A LEU 19 20 1 Y 1 AA1 GLY 25 ? A GLY 20 21 1 Y 1 AA1 LYS 26 ? A LYS 21 22 1 Y 1 AA1 ASP 27 ? A ASP 22 23 1 Y 1 AA1 THR 28 ? A THR 23 24 1 Y 1 AA1 VAL 29 ? A VAL 24 25 1 Y 1 AA1 ALA 30 ? A ALA 25 26 1 Y 1 AA1 ALA 42 ? A ALA 37 27 1 Y 1 AA1 ASP 43 ? A ASP 38 28 1 Y 1 AA1 GLN 44 ? A GLN 39 29 1 Y 1 AA1 GLU 45 ? A GLU 40 30 1 Y 1 AA1 VAL 46 ? A VAL 41 31 1 Y 1 AA1 PRO 47 ? A PRO 42 32 1 Y 1 AA1 GLU 48 ? A GLU 43 33 1 Y 1 AA1 GLN 61 ? A GLN 56 34 1 Y 1 AA1 LYS 62 ? A LYS 57 35 1 Y 1 AA1 GLY 63 ? A GLY 58 36 1 Y 1 AA1 GLY 64 ? A GLY 59 37 1 Y 1 AA1 SER 89 ? A SER 84 38 1 Y 1 AA1 GLU 90 ? A GLU 85 39 1 Y 1 AA1 PRO 91 ? A PRO 86 40 1 Y 1 AA1 GLY 92 ? A GLY 87 41 1 Y 1 AA1 ALA 96 ? A ALA 91 42 1 Y 1 AA1 TYR 97 ? A TYR 92 43 1 Y 1 AA1 GLU 98 ? A GLU 93 44 1 Y 1 AA1 GLY 99 ? A GLY 94 45 1 Y 1 AA1 GLN 100 ? A GLN 95 46 1 Y 1 AA1 GLU 121 ? A GLU 116 47 1 Y 1 AA1 LEU 122 ? A LEU 117 48 1 Y 1 AA1 HIS 123 ? A HIS 118 49 1 Y 1 AA1 GLY 124 ? A GLY 119 50 1 Y 1 AA1 ARG 125 ? A ARG 120 51 1 Y 1 AA1 GLN 126 ? A GLN 121 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 #